BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 270388 Cn1cccc1C(=O)N1CCN(CC1)C(=O)Nc1ccc(cc1)N1CCC(O)CC1 InChI=1S/C22H29N5O3/c1-24-10-2-3-20(24)21(29)26-13-15-27(16-14-26)22(30)23-17-4-6-18(7-5-17)25-11-8-19(28)9-12-25/h2-7,10,19,28H,8-9,11-16H2,1H3,(H,23,30) MCIXIOJTXYAIBD-UHFFFAOYSA-N 136514 US8865714, 1 Hematopoietic prostaglandin D synthase Homo sapiens 58 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136514 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136514&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 46911245 249812840 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270389 Cn1cccc1C(=O)N1CCN(CC1)C(=O)Nc1ccc(cc1)N1CCC(CC1)C(O)=O InChI=1S/C23H29N5O4/c1-25-10-2-3-20(25)21(29)27-13-15-28(16-14-27)23(32)24-18-4-6-19(7-5-18)26-11-8-17(9-12-26)22(30)31/h2-7,10,17H,8-9,11-16H2,1H3,(H,24,32)(H,30,31) MFBFXAMAOIFEDV-UHFFFAOYSA-N 136515 US8865714, 2 Hematopoietic prostaglandin D synthase Homo sapiens 86 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136515 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136515&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 46911246 249812841 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270390 Cn1cccc1C(=O)N1CCN(CC1)C(=O)Nc1ccc(cc1)N1CCC(CC1)C(=O)N1CCOCC1 InChI=1S/C27H36N6O4/c1-29-10-2-3-24(29)26(35)31-13-15-33(16-14-31)27(36)28-22-4-6-23(7-5-22)30-11-8-21(9-12-30)25(34)32-17-19-37-20-18-32/h2-7,10,21H,8-9,11-20H2,1H3,(H,28,36) ZNFJGCDCPYTEKF-UHFFFAOYSA-N 136516 US8865714, 3 Hematopoietic prostaglandin D synthase Homo sapiens 76 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136516 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136516&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 46911296 249812842 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270391 Cn1cccc1C(=O)N1CCN(CC1)C(=O)Nc1ccc(cc1)N1CCC(CN2CCOCC2)CC1 InChI=1S/C27H38N6O3/c1-29-10-2-3-25(29)26(34)32-13-15-33(16-14-32)27(35)28-23-4-6-24(7-5-23)31-11-8-22(9-12-31)21-30-17-19-36-20-18-30/h2-7,10,22H,8-9,11-21H2,1H3,(H,28,35) IXXKCLWHNVBNOT-UHFFFAOYSA-N 136517 US8865714, 4 Hematopoietic prostaglandin D synthase Homo sapiens 54 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136517 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136517&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 46911348 249812843 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270392 Cn1cccc1C(=O)N1CCN(CC1)C(=O)Nc1ccc(cc1)N1CCC(CCn2cncn2)C1 InChI=1S/C25H32N8O2/c1-29-10-2-3-23(29)24(34)30-13-15-31(16-14-30)25(35)28-21-4-6-22(7-5-21)32-11-8-20(17-32)9-12-33-19-26-18-27-33/h2-7,10,18-20H,8-9,11-17H2,1H3,(H,28,35) SHMGBVYQEIXSFM-UHFFFAOYSA-N 136518 US8865714, 5 Hematopoietic prostaglandin D synthase Homo sapiens 67 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136518 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136518&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 46911248 249812844 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270393 Cn1cccc1C(=O)N1CCN(CC1)C(=O)Nc1ccc(cc1)N1CCC(CCN2CCOCC2)CC1 InChI=1S/C28H40N6O3/c1-30-11-2-3-26(30)27(35)33-15-17-34(18-16-33)28(36)29-24-4-6-25(7-5-24)32-13-9-23(10-14-32)8-12-31-19-21-37-22-20-31/h2-7,11,23H,8-10,12-22H2,1H3,(H,29,36) XYSYJYTWKAIUAF-UHFFFAOYSA-N 136519 US8865714, 6 Hematopoietic prostaglandin D synthase Homo sapiens 43 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136519 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136519&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 46911247 249812845 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270394 Cn1cccc1C(=O)N1CCN(CC1)C(=O)Nc1ccc(cc1)N1CCC(CCn2ccnn2)CC1 InChI=1S/C26H34N8O2/c1-30-12-2-3-24(30)25(35)32-17-19-33(20-18-32)26(36)28-22-4-6-23(7-5-22)31-13-8-21(9-14-31)10-15-34-16-11-27-29-34/h2-7,11-12,16,21H,8-10,13-15,17-20H2,1H3,(H,28,36) RHJLUSRCWRMVEY-UHFFFAOYSA-N 136520 US8865714, 7 Hematopoietic prostaglandin D synthase Homo sapiens 71 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136520 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136520&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 46911297 249812846 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270395 Cn1cccc1C(=O)N1CCN(CC1)C(=N)Nc1ccc(cc1)N1CCC(CCn2cncn2)CC1 InChI=1S/C26H35N9O/c1-31-11-2-3-24(31)25(36)33-15-17-34(18-16-33)26(27)30-22-4-6-23(7-5-22)32-12-8-21(9-13-32)10-14-35-20-28-19-29-35/h2-7,11,19-21H,8-10,12-18H2,1H3,(H2,27,30) ZOZUGQNXLOUPOX-UHFFFAOYSA-N 136521 US8865714, 8 Hematopoietic prostaglandin D synthase Homo sapiens 62 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136521 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136521&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 91667377 249812847 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270396 Cc1nc(C)n(CCC2CCN(CC2)c2ccc(NC(=O)N3CCN(CC3)C(=O)c3cccn3C)cc2)n1 InChI=1S/C28H38N8O2/c1-21-29-22(2)36(31-21)16-12-23-10-14-33(15-11-23)25-8-6-24(7-9-25)30-28(38)35-19-17-34(18-20-35)27(37)26-5-4-13-32(26)3/h4-9,13,23H,10-12,14-20H2,1-3H3,(H,30,38) XBZATZBFXPOSMS-UHFFFAOYSA-N 136522 US8865714, 9 Hematopoietic prostaglandin D synthase Homo sapiens 85 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136522 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136522&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 66584528 249812848 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270397 Cn1cccc1C(=O)N1CCN(CC1)C(=O)Nc1ccc(cc1)N1CCC(CCn2cccn2)CC1 InChI=1S/C27H35N7O2/c1-30-13-2-4-25(30)26(35)32-18-20-33(21-19-32)27(36)29-23-5-7-24(8-6-23)31-15-9-22(10-16-31)11-17-34-14-3-12-28-34/h2-8,12-14,22H,9-11,15-21H2,1H3,(H,29,36) YNDOYMIWZOONKU-UHFFFAOYSA-N 136523 US8865714, 10 Hematopoietic prostaglandin D synthase Homo sapiens 40 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136523 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136523&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 46911300 249812849 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270398 Cn1cccc1C(=O)N1CCN(CC1)C(=O)Nc1ccc(cc1)N1CCC(CCCn2cncn2)CC1 InChI=1S/C27H36N8O2/c1-31-12-3-5-25(31)26(36)33-16-18-34(19-17-33)27(37)30-23-6-8-24(9-7-23)32-14-10-22(11-15-32)4-2-13-35-21-28-20-29-35/h3,5-9,12,20-22H,2,4,10-11,13-19H2,1H3,(H,30,37) MJQUKLCVROIMDE-UHFFFAOYSA-N 136524 US8865714, 11 Hematopoietic prostaglandin D synthase Homo sapiens 46 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136524 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136524&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 46911349 249812850 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270399 Cn1cccc1C(=O)N1CCN(CC1)C(=O)Nc1ccc(cc1)N1CCC(CCCn2ccnn2)CC1 InChI=1S/C27H36N8O2/c1-31-13-3-5-25(31)26(36)33-18-20-34(21-19-33)27(37)29-23-6-8-24(9-7-23)32-15-10-22(11-16-32)4-2-14-35-17-12-28-30-35/h3,5-9,12-13,17,22H,2,4,10-11,14-16,18-21H2,1H3,(H,29,37) PCXBSEICUDUWMQ-UHFFFAOYSA-N 136525 US8865714, 12 Hematopoietic prostaglandin D synthase Homo sapiens 37 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136525 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136525&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 46911399 249812851 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270400 CCn1cccc1C(=O)N1CCN(CC1)C(=O)Nc1ccc(cc1)N1CCC(CC1)C(=O)N1CCOCC1 InChI=1S/C28H38N6O4/c1-2-30-11-3-4-25(30)27(36)32-14-16-34(17-15-32)28(37)29-23-5-7-24(8-6-23)31-12-9-22(10-13-31)26(35)33-18-20-38-21-19-33/h3-8,11,22H,2,9-10,12-21H2,1H3,(H,29,37) OGPSMHXWWRBXJY-UHFFFAOYSA-N 136526 US8865714, 13 Hematopoietic prostaglandin D synthase Homo sapiens 91 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136526 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136526&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 46911352 249812852 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270401 Cn1cccc1C(=O)N1CCN(CC1)C(=O)Nc1ccc(cc1)N1CCC(CC1)C(=O)N1CCCCC1 InChI=1S/C28H38N6O3/c1-30-13-5-6-25(30)27(36)33-18-20-34(21-19-33)28(37)29-23-7-9-24(10-8-23)31-16-11-22(12-17-31)26(35)32-14-3-2-4-15-32/h5-10,13,22H,2-4,11-12,14-21H2,1H3,(H,29,37) DYCWDVDJZWQLNX-UHFFFAOYSA-N 136527 US8865714, 14 Hematopoietic prostaglandin D synthase Homo sapiens 32 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136527 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136527&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 46911351 249812853 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270402 CN1CCN(CC1)C(=O)C1CCN(CC1)c1ccc(NC(=O)N2CCN(CC2)C(=O)c2cccn2C)cc1 InChI=1S/C28H39N7O3/c1-30-14-16-33(17-15-30)26(36)22-9-12-32(13-10-22)24-7-5-23(6-8-24)29-28(38)35-20-18-34(19-21-35)27(37)25-4-3-11-31(25)2/h3-8,11,22H,9-10,12-21H2,1-2H3,(H,29,38) OAUPRNHAMRWWOG-UHFFFAOYSA-N 136528 US8865714, 15 Hematopoietic prostaglandin D synthase Homo sapiens 60 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136528 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136528&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 46911350 249812854 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270403 Cn1cccc1C(=O)N1CCN(CC1)C(=O)Nc1ccc(cc1)N1CCC(CC1)C(=O)NCCN1CCOCC1 InChI=1S/C29H41N7O4/c1-32-11-2-3-26(32)28(38)35-15-17-36(18-16-35)29(39)31-24-4-6-25(7-5-24)34-12-8-23(9-13-34)27(37)30-10-14-33-19-21-40-22-20-33/h2-7,11,23H,8-10,12-22H2,1H3,(H,30,37)(H,31,39) QEPAIZPHKGNYIB-UHFFFAOYSA-N 136529 US8865714, 16 Hematopoietic prostaglandin D synthase Homo sapiens 59 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136529 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136529&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 46911400 249812855 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270404 Cn1cccc1C(=O)N1CCN(CC1)C(=O)Nc1ccc(cc1)N1CCC(CC1)C(=O)NCc1cccnc1 InChI=1S/C29H35N7O3/c1-33-13-3-5-26(33)28(38)35-16-18-36(19-17-35)29(39)32-24-6-8-25(9-7-24)34-14-10-23(11-15-34)27(37)31-21-22-4-2-12-30-20-22/h2-9,12-13,20,23H,10-11,14-19,21H2,1H3,(H,31,37)(H,32,39) ABURWQHMGKKILS-UHFFFAOYSA-N 136530 US8865714, 17 Hematopoietic prostaglandin D synthase Homo sapiens 60 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136530 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136530&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 66584468 249812856 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270405 O=C(Nc1ccc(cc1)N1CCC(CC1)C(=O)N1CCOCC1)N1CCN(CC1)C(=O)c1ccc[nH]1 InChI=1S/C26H34N6O4/c33-24(31-16-18-36-19-17-31)20-7-10-29(11-8-20)22-5-3-21(4-6-22)28-26(35)32-14-12-30(13-15-32)25(34)23-2-1-9-27-23/h1-6,9,20,27H,7-8,10-19H2,(H,28,35) JYMWKNLROMAJBX-UHFFFAOYSA-N 136531 US8865714, Reference Example 1 Hematopoietic prostaglandin D synthase Homo sapiens >1000 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136531 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136531&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 91667378 249812857 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270406 Cc1cc(C)c([nH]1)C(=O)N1CCN(CC1)C(=O)Nc1ccc(cc1)N1CCC(CC1)C(=O)N1CCOCC1 InChI=1S/C28H38N6O4/c1-20-19-21(2)29-25(20)27(36)32-11-13-34(14-12-32)28(37)30-23-3-5-24(6-4-23)31-9-7-22(8-10-31)26(35)33-15-17-38-18-16-33/h3-6,19,22,29H,7-18H2,1-2H3,(H,30,37) XYSSPOKFEGUTRJ-UHFFFAOYSA-N 136532 US8865714, Reference Example 2 Hematopoietic prostaglandin D synthase Homo sapiens >1000 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136532 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136532&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 91667379 249812858 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270407 Cn1ccc(c1)C(=O)N1CCN(CC1)C(=O)Nc1ccc(cc1)N1CCC(CC1)C(=O)N1CCOCC1 InChI=1S/C27H36N6O4/c1-29-9-6-22(20-29)26(35)31-12-14-33(15-13-31)27(36)28-23-2-4-24(5-3-23)30-10-7-21(8-11-30)25(34)32-16-18-37-19-17-32/h2-6,9,20-21H,7-8,10-19H2,1H3,(H,28,36) YSEZCXAMDOZDMG-UHFFFAOYSA-N 136533 US8865714, Reference Example 3 Hematopoietic prostaglandin D synthase Homo sapiens >1000 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136533 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136533&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 91667380 249812859 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270408 O=C(Nc1ccc(cc1)N1CCC(CC1)C(=O)N1CCOCC1)N1CCN(CC1)C(=O)c1cccs1 InChI=1S/C26H33N5O4S/c32-24(30-15-17-35-18-16-30)20-7-9-28(10-8-20)22-5-3-21(4-6-22)27-26(34)31-13-11-29(12-14-31)25(33)23-2-1-19-36-23/h1-6,19-20H,7-18H2,(H,27,34) KSYRTHJLBXIEBQ-UHFFFAOYSA-N 136534 US8865714, Reference Example 4 Hematopoietic prostaglandin D synthase Homo sapiens 340 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136534 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136534&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 91667381 249812860 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270409 O=C(Nc1ccc(cc1)N1CCC(CC1)C(=O)N1CCOCC1)N1CCN(CC1)C(=O)c1ccsc1 InChI=1S/C26H33N5O4S/c32-24(30-14-16-35-17-15-30)20-5-8-28(9-6-20)23-3-1-22(2-4-23)27-26(34)31-12-10-29(11-13-31)25(33)21-7-18-36-19-21/h1-4,7,18-20H,5-6,8-17H2,(H,27,34) NTHRGPPXZKXQHD-UHFFFAOYSA-N 136535 US8865714, Reference Example 5 Hematopoietic prostaglandin D synthase Homo sapiens 732 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136535 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136535&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 91667382 249812861 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270410 O=C(Nc1ccc(cc1)N1CCC(CC1)C(=O)N1CCOCC1)N1CCN(CC1)C(=O)c1ccco1 InChI=1S/C26H33N5O5/c32-24(30-15-18-35-19-16-30)20-7-9-28(10-8-20)22-5-3-21(4-6-22)27-26(34)31-13-11-29(12-14-31)25(33)23-2-1-17-36-23/h1-6,17,20H,7-16,18-19H2,(H,27,34) DDAVCDFLBYSXEM-UHFFFAOYSA-N 136536 US8865714, Reference Example 6 Hematopoietic prostaglandin D synthase Homo sapiens >1000 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136536 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136536&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 91667383 249812862 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270411 O=C(Nc1ccc(cc1)N1CCC(CC1)C(=O)N1CCOCC1)N1CCN(CC1)C(=O)c1ccoc1 InChI=1S/C26H33N5O5/c32-24(30-14-17-35-18-15-30)20-5-8-28(9-6-20)23-3-1-22(2-4-23)27-26(34)31-12-10-29(11-13-31)25(33)21-7-16-36-19-21/h1-4,7,16,19-20H,5-6,8-15,17-18H2,(H,27,34) VUBPAZULEHITLV-UHFFFAOYSA-N 136537 US8865714, Reference Example 7 Hematopoietic prostaglandin D synthase Homo sapiens >1000 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136537 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136537&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 91667384 249812863 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270412 O=C(Nc1ccc(cc1)N1CCC(CC1)C(=O)N1CCOCC1)N1CCN(CC1)C(=O)c1ccno1 InChI=1S/C25H32N6O5/c32-23(30-15-17-35-18-16-30)19-6-9-28(10-7-19)21-3-1-20(2-4-21)27-25(34)31-13-11-29(12-14-31)24(33)22-5-8-26-36-22/h1-5,8,19H,6-7,9-18H2,(H,27,34) INMKZTDIBHQPRI-UHFFFAOYSA-N 136538 US8865714, Reference Example 8 Hematopoietic prostaglandin D synthase Homo sapiens >1000 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136538 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136538&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 91667385 249812864 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270413 Cn1ccnc1C(=O)N1CCN(CC1)C(=O)Nc1ccc(cc1)N1CCC(CC1)C(=O)N1CCOCC1 InChI=1S/C26H35N7O4/c1-29-11-8-27-23(29)25(35)31-12-14-33(15-13-31)26(36)28-21-2-4-22(5-3-21)30-9-6-20(7-10-30)24(34)32-16-18-37-19-17-32/h2-5,8,11,20H,6-7,9-10,12-19H2,1H3,(H,28,36) XGZCTQJZXSELHP-UHFFFAOYSA-N 136539 US8865714, Reference Example 9 Hematopoietic prostaglandin D synthase Homo sapiens >1000 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136539 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136539&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 91667386 249812865 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270414 O=C(Nc1ccc(cc1)N1CCC(CC1)C(=O)N1CCOCC1)N1CCN(CC1)C(=O)C1CCCC1 InChI=1S/C27H39N5O4/c33-25(21-3-1-2-4-21)30-13-15-32(16-14-30)27(35)28-23-5-7-24(8-6-23)29-11-9-22(10-12-29)26(34)31-17-19-36-20-18-31/h5-8,21-22H,1-4,9-20H2,(H,28,35) BBBSYTNJFFQWMP-UHFFFAOYSA-N 136540 US8865714, Reference Example 10 Hematopoietic prostaglandin D synthase Homo sapiens >1000 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136540 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136540&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 91667387 249812866 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270415 O=C(Nc1ccc(cc1)N1CCC(CC1)C(=O)N1CCOCC1)N1CCN(CC1)C(=O)c1ccccc1 InChI=1S/C28H35N5O4/c34-26(22-4-2-1-3-5-22)31-14-16-33(17-15-31)28(36)29-24-6-8-25(9-7-24)30-12-10-23(11-13-30)27(35)32-18-20-37-21-19-32/h1-9,23H,10-21H2,(H,29,36) HRBGCQSCHHZQJA-UHFFFAOYSA-N 136541 US8865714, Reference Example 11 Hematopoietic prostaglandin D synthase Homo sapiens 437 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136541 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136541&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 91667388 249812867 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270416 CC1C(=Cc2ccccc12)C(=O)N1CCN(CC1)C(=O)Nc1ccc(cc1)N1CCC(CC1)C(=O)N1CCOCC1 |c:2| InChI=1S/C32H39N5O4/c1-23-28-5-3-2-4-25(28)22-29(23)31(39)35-14-16-37(17-15-35)32(40)33-26-6-8-27(9-7-26)34-12-10-24(11-13-34)30(38)36-18-20-41-21-19-36/h2-9,22-24H,10-21H2,1H3,(H,33,40) NPLVWYCSUFTLJC-UHFFFAOYSA-N 136542 US8865714, Reference Example 12 Hematopoietic prostaglandin D synthase Homo sapiens >1000 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136542 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136542&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 91667389 249812868 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270417 Fc1cccc(c1)C(=O)N1CCN(CC1)C(=O)Nc1nc2ccc(Br)cc2s1 InChI=1S/C19H16BrFN4O2S/c20-13-4-5-15-16(11-13)28-18(22-15)23-19(27)25-8-6-24(7-9-25)17(26)12-2-1-3-14(21)10-12/h1-5,10-11H,6-9H2,(H,22,23,27) CFOSRSHKAHRGQK-UHFFFAOYSA-N 124939 US8765750, Reference Example 12 Hematopoietic prostaglandin D synthase Homo sapiens 106 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124939 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124939&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 25095564 225151328 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270418 Cc1cc2nc(NC(=O)N3CCN(CC3)C(=O)c3cccc(F)c3)sc2cc1C InChI=1S/C21H21FN4O2S/c1-13-10-17-18(11-14(13)2)29-20(23-17)24-21(28)26-8-6-25(7-9-26)19(27)15-4-3-5-16(22)12-15/h3-5,10-12H,6-9H2,1-2H3,(H,23,24,28) FGOMBTJJMSKTFN-UHFFFAOYSA-N 124940 US8765750, Reference Example 13 Hematopoietic prostaglandin D synthase Homo sapiens 222 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124940 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124940&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 86766406 225151329 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270419 Cc1ccc2nc(NC(=O)N3CCN(CC3)C(=O)c3cccc(F)c3)sc2c1 InChI=1S/C20H19FN4O2S/c1-13-5-6-16-17(11-13)28-19(22-16)23-20(27)25-9-7-24(8-10-25)18(26)14-3-2-4-15(21)12-14/h2-6,11-12H,7-10H2,1H3,(H,22,23,27) HAVAPNGNRHSMFI-UHFFFAOYSA-N 124941 US8765750, Reference Example 14 Hematopoietic prostaglandin D synthase Homo sapiens 260 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124941 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124941&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 57959383 225151330 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270420 COc1ccc2nc(NC(=O)N3CCN(CC3)C(=O)c3cccc(F)c3)sc2c1 InChI=1S/C20H19FN4O3S/c1-28-15-5-6-16-17(12-15)29-19(22-16)23-20(27)25-9-7-24(8-10-25)18(26)13-3-2-4-14(21)11-13/h2-6,11-12H,7-10H2,1H3,(H,22,23,27) LOALUDBNYIAWTL-UHFFFAOYSA-N 124942 US8765750, Reference Example 15 Hematopoietic prostaglandin D synthase Homo sapiens 318 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124942 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124942&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 86766407 225151331 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270421 Fc1cccc(c1)C(=O)N1CCN(CC1)C(=O)Nc1nc2ccc(Cl)cc2s1 InChI=1S/C19H16ClFN4O2S/c20-13-4-5-15-16(11-13)28-18(22-15)23-19(27)25-8-6-24(7-9-25)17(26)12-2-1-3-14(21)10-12/h1-5,10-11H,6-9H2,(H,22,23,27) VQTQJTNJENBEND-UHFFFAOYSA-N 124943 US8765750, Reference Example 16 Hematopoietic prostaglandin D synthase Homo sapiens 204 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124943 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124943&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 86766408 225151332 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 270422 Fc1cccc(n1)C(=O)N1CCN(CC1)C(=O)Nc1nc2ccc(cc2s1)C(F)(F)F InChI=1S/C19H15F4N5O2S/c20-15-3-1-2-13(24-15)16(29)27-6-8-28(9-7-27)18(30)26-17-25-12-5-4-11(19(21,22)23)10-14(12)31-17/h1-5,10H,6-9H2,(H,25,26,30) KIUYATMXEIQVOB-UHFFFAOYSA-N 136543 US8865714, Reference Example 18 Hematopoietic prostaglandin D synthase Homo sapiens >1000 8.0000 25.00 C US Patent 10.7270/Q2QF8RKC aid1800723 US8865714 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 10/21/2014 4/6/2015 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=136543 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=136543&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 91667390 249812869 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9