BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
255833	CC(C)(C)n1c(nc2cc(ccc12)-c1cnc(N)nc1)-c1nc(ccc1-n1cncn1)C#N	InChI=1S/C23H20N10/c1-23(2,3)33-18-6-4-14(15-10-27-22(25)28-11-15)8-17(18)31-21(33)20-19(32-13-26-12-29-32)7-5-16(9-24)30-20/h4-8,10-13H,1-3H3,(H2,25,27,28)	OCBGBXXDHBCZFF-UHFFFAOYSA-N	125939	US8772304, 1	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 7.1					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125939	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125939&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			56962361	225152301							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255834	Cc1ncn(n1)-c1ccc(nc1-c1nc2cc(ccc2n1C(C)(C)C)-c1cnc(N)nc1)C#N	InChI=1S/C24H22N10/c1-14-29-13-33(32-14)20-8-6-17(10-25)30-21(20)22-31-18-9-15(16-11-27-23(26)28-12-16)5-7-19(18)34(22)24(2,3)4/h5-9,11-13H,1-4H3,(H2,26,27,28)	RJRVZGMNKJRPPZ-UHFFFAOYSA-N	125940	US8772304, 2	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 4.2					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125940	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125940&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57335359	225152302							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255835	Cc1ncnn1-c1ccc(nc1-c1nc2cc(ccc2n1C(C)(C)C)-c1cnc(N)nc1)C#N	InChI=1S/C24H22N10/c1-14-29-13-30-34(14)20-8-6-17(10-25)31-21(20)22-32-18-9-15(16-11-27-23(26)28-12-16)5-7-19(18)33(22)24(2,3)4/h5-9,11-13H,1-4H3,(H2,26,27,28)	GNULTTOZNOKDFM-UHFFFAOYSA-N	125941	US8772304, 3	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 5.9					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125941	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125941&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57335361	225152303							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255836	CC(C)(C)n1c(nc2cc(ccc12)-c1cnc(N)nc1)-c1nc(ccc1-n1cncn1)C1CC1	InChI=1S/C25H25N9/c1-25(2,3)34-20-8-6-16(17-11-28-24(26)29-12-17)10-19(20)32-23(34)22-21(33-14-27-13-30-33)9-7-18(31-22)15-4-5-15/h6-15H,4-5H2,1-3H3,(H2,26,28,29)	NEGPZUDOKOYGIZ-UHFFFAOYSA-N	125942	US8772304, 4	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 13					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125942	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125942&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57335502	225152304							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255837	Cc1ncn(n1)-c1ccc(nc1-c1nc2cc(ccc2n1C1(C)CCC1)-c1cnc(N)nc1)C#N	InChI=1S/C25H22N10/c1-15-30-14-34(33-15)21-7-5-18(11-26)31-22(21)23-32-19-10-16(17-12-28-24(27)29-13-17)4-6-20(19)35(23)25(2)8-3-9-25/h4-7,10,12-14H,3,8-9H2,1-2H3,(H2,27,28,29)	QEVDFCUAKAADFH-UHFFFAOYSA-N	125943	US8772304, 5	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 29					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125943	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125943&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57335504	225152305							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255838	Cc1ncnn1-c1ccc(nc1-c1nc2cc(ccc2n1C1(C)CCC1)-c1cnc(N)nc1)C#N	InChI=1S/C25H22N10/c1-15-30-14-31-35(15)21-7-5-18(11-26)32-22(21)23-33-19-10-16(17-12-28-24(27)29-13-17)4-6-20(19)34(23)25(2)8-3-9-25/h4-7,10,12-14H,3,8-9H2,1-2H3,(H2,27,28,29)	SUBRTSYTNPDTMI-UHFFFAOYSA-N	125944	US8772304, 6	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 86					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125944	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125944&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57335506	225152306							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255839	COC(=O)c1cccnc1-c1nc2cc(ccc2n1C(C)(C)C)-c1cnc(N)nc1	InChI=1S/C22H22N6O2/c1-22(2,3)28-17-8-7-13(14-11-25-21(23)26-12-14)10-16(17)27-19(28)18-15(20(29)30-4)6-5-9-24-18/h5-12H,1-4H3,(H2,23,25,26)	OYOXDRLGJIXDMU-UHFFFAOYSA-N	125945	US8772304, 7	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 540					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125945	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125945&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57335649	225152307							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255840	CNC(=O)c1cccnc1-c1nc2cc(ccc2n1C(C)(C)C)-c1cnc(N)nc1	InChI=1S/C22H23N7O/c1-22(2,3)29-17-8-7-13(14-11-26-21(23)27-12-14)10-16(17)28-19(29)18-15(20(30)24-4)6-5-9-25-18/h5-12H,1-4H3,(H,24,30)(H2,23,26,27)	KQGJLGAHHLIGJA-UHFFFAOYSA-N	125946	US8772304, 8	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 620					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125946	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125946&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57335651	225152308							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255841	COC(=O)c1ccc(nc1-c1nc2cc(ccc2n1C(C)(C)C)-c1cnc(N)nc1)C#N	InChI=1S/C23H21N7O2/c1-23(2,3)30-18-8-5-13(14-11-26-22(25)27-12-14)9-17(18)29-20(30)19-16(21(31)32-4)7-6-15(10-24)28-19/h5-9,11-12H,1-4H3,(H2,25,26,27)	GGASVROGGRQYMR-UHFFFAOYSA-N	125947	US8772304, 9	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 110					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125947	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125947&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57335653	225152309							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255842	CNC(=O)c1ccc(nc1-c1nc2cc(ccc2n1C(C)(C)C)-c1cnc(N)nc1)C#N	InChI=1S/C23H22N8O/c1-23(2,3)31-18-8-5-13(14-11-27-22(25)28-12-14)9-17(18)30-20(31)19-16(21(32)26-4)7-6-15(10-24)29-19/h5-9,11-12H,1-4H3,(H,26,32)(H2,25,27,28)	ZZVDYVDVUXYJKJ-UHFFFAOYSA-N	125948	US8772304, 10	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 138					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125948	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125948&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57335782	225152310							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255843	COc1cccc(n1)-c1nc2cc(ccc2n1C(C)(C)C)-c1cnc(N)nc1	InChI=1S/C21H22N6O/c1-21(2,3)27-17-9-8-13(14-11-23-20(22)24-12-14)10-16(17)26-19(27)15-6-5-7-18(25-15)28-4/h5-12H,1-4H3,(H2,22,23,24)	WECKLERIGDQMJL-UHFFFAOYSA-N	125949	US8772304, 11	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 46					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125949	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125949&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57335784	225152311							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255844	CC(C)(C)n1c(nc2cc(ccc12)-c1cnc(N)nc1)-c1ccccn1	InChI=1S/C20H20N6/c1-20(2,3)26-17-8-7-13(14-11-23-19(21)24-12-14)10-16(17)25-18(26)15-6-4-5-9-22-15/h4-12H,1-3H3,(H2,21,23,24)	KXQABCVJSVWUGZ-UHFFFAOYSA-N	125950	US8772304, 12	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 700					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125950	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125950&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57335786	225152312							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255845	CC(C)(C)Oc1cccc(n1)-c1nc2cc(ccc2n1C(C)(C)C)-c1cnc(N)nc1	InChI=1S/C24H28N6O/c1-23(2,3)30-19-11-10-15(16-13-26-22(25)27-14-16)12-18(19)29-21(30)17-8-7-9-20(28-17)31-24(4,5)6/h7-14H,1-6H3,(H2,25,26,27)	PALYSIUIEZDNIW-UHFFFAOYSA-N	125951	US8772304, 13	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 51					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125951	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125951&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57335926	225152313							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255846	CC(C)(C)n1c(nc2cc(ccc12)-c1cnc(N)nc1)-c1cccc(F)n1	InChI=1S/C20H19FN6/c1-20(2,3)27-16-8-7-12(13-10-23-19(22)24-11-13)9-15(16)26-18(27)14-5-4-6-17(21)25-14/h4-11H,1-3H3,(H2,22,23,24)	XOEAAZDMLDGUPE-UHFFFAOYSA-N	125952	US8772304, 14	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 279					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125952	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125952&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57335928	225152314							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255847	CC(C)(C)n1c(nc2cc(ccc12)-c1cnc(NCc2cccc(F)n2)nc1)-c1cccc(F)n1	InChI=1S/C26H23F2N7/c1-26(2,3)35-21-11-10-16(12-20(21)34-24(35)19-7-5-9-23(28)33-19)17-13-29-25(30-14-17)31-15-18-6-4-8-22(27)32-18/h4-14H,15H2,1-3H3,(H,29,30,31)	DVZXQLQMTHXHEH-UHFFFAOYSA-N	125953	US8772304, 15	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 870					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125953	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125953&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57335930	225152315							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255848	COc1cccnc1-c1nc2cc(ccc2n1C(C)(C)C)-c1cnc(N)nc1	InChI=1S/C21H22N6O/c1-21(2,3)27-16-8-7-13(14-11-24-20(22)25-12-14)10-15(16)26-19(27)18-17(28-4)6-5-9-23-18/h5-12H,1-4H3,(H2,22,24,25)	KOWHFQJWPHOPTR-UHFFFAOYSA-N	125954	US8772304, 16	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 960					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125954	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125954&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57336074	225152316							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255849	COc1cc(-c2nc3cc(ccc3n2C(C)(C)C)-c2cnc(N)nc2)c(F)cn1	InChI=1S/C21H21FN6O/c1-21(2,3)28-17-6-5-12(13-9-25-20(23)26-10-13)7-16(17)27-19(28)14-8-18(29-4)24-11-15(14)22/h5-11H,1-4H3,(H2,23,25,26)	NVCYXCSOEGBRNC-UHFFFAOYSA-N	125955	US8772304, 17	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 58					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125955	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125955&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57336076	225152317							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255850	CC(C)(C)n1c(nc2cc(ccc12)-c1cnc(N)nc1)-c1ccncc1	InChI=1S/C20H20N6/c1-20(2,3)26-17-5-4-14(15-11-23-19(21)24-12-15)10-16(17)25-18(26)13-6-8-22-9-7-13/h4-12H,1-3H3,(H2,21,23,24)	MCELGPSEUJCOEX-UHFFFAOYSA-N	125956	US8772304, 18	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 450					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125956	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125956&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57335358	225152318							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255851	CC(C)(C)n1c(nc2cc(ccc12)-c1cnc(N)nc1)-c1ccnc(Br)c1	InChI=1S/C20H19BrN6/c1-20(2,3)27-16-5-4-12(14-10-24-19(22)25-11-14)8-15(16)26-18(27)13-6-7-23-17(21)9-13/h4-11H,1-3H3,(H2,22,24,25)	RWVSVDXVRVHMQL-UHFFFAOYSA-N	125957	US8772304, 19	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 270					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125957	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125957&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57335360	225152319							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255852	CC(C)(C)n1c(nc2cc(ccc12)-c1cnc(N)nc1)-c1cccnc1-n1cncn1	InChI=1S/C22H21N9/c1-22(2,3)31-18-7-6-14(15-10-26-21(23)27-11-15)9-17(18)29-20(31)16-5-4-8-25-19(16)30-13-24-12-28-30/h4-13H,1-3H3,(H2,23,26,27)	WFQDAKDMJXMEML-UHFFFAOYSA-N	125958	US8772304, 20	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 19					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125958	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125958&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57335501	225152320							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255853	CC(C)(C)n1c(nc2cc(ccc12)-c1cnc(N)nc1)-c1cc(F)cnc1-n1cncn1	InChI=1S/C22H20FN9/c1-22(2,3)32-18-5-4-13(14-8-27-21(24)28-9-14)6-17(18)30-20(32)16-7-15(23)10-26-19(16)31-12-25-11-29-31/h4-12H,1-3H3,(H2,24,27,28)	XPVAAGSPAUMGQZ-UHFFFAOYSA-N	125959	US8772304, 21	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 20					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125959	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125959&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57335503	225152321							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255854	CC(C)(C)n1c(nc2cc(ccc12)-c1cnc(N)nc1)-c1cc(Cl)cnc1-n1cncn1	InChI=1S/C22H20ClN9/c1-22(2,3)32-18-5-4-13(14-8-27-21(24)28-9-14)6-17(18)30-20(32)16-7-15(23)10-26-19(16)31-12-25-11-29-31/h4-12H,1-3H3,(H2,24,27,28)	OYRYPGRGMUKOIH-UHFFFAOYSA-N	125960	US8772304, 22	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 3.2					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125960	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125960&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57335505	225152322							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255855	CC(C)(C)n1c(nc2cc(ccc12)-c1cnc(N)nc1)-c1cc(Br)cnc1-n1cncn1	InChI=1S/C22H20BrN9/c1-22(2,3)32-18-5-4-13(14-8-27-21(24)28-9-14)6-17(18)30-20(32)16-7-15(23)10-26-19(16)31-12-25-11-29-31/h4-12H,1-3H3,(H2,24,27,28)	HLMARNZNRRJDOA-UHFFFAOYSA-N	125961	US8772304, 23	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 4					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125961	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125961&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57335648	225152323							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255856	Cc1ncnn1-c1ncccc1-c1nc2cc(ccc2n1C(C)(C)C)-c1cnc(N)nc1	InChI=1S/C23H23N9/c1-14-28-13-29-32(14)20-17(6-5-9-25-20)21-30-18-10-15(16-11-26-22(24)27-12-16)7-8-19(18)31(21)23(2,3)4/h5-13H,1-4H3,(H2,24,26,27)	LBKCQCPAMPPJPF-UHFFFAOYSA-N	125962	US8772304, 24	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 23					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125962	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125962&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57335650	225152324							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255857	Cc1ncn(n1)-c1ncccc1-c1nc2cc(ccc2n1C(C)(C)C)-c1cnc(N)nc1	InChI=1S/C23H23N9/c1-14-28-13-31(30-14)20-17(6-5-9-25-20)21-29-18-10-15(16-11-26-22(24)27-12-16)7-8-19(18)32(21)23(2,3)4/h5-13H,1-4H3,(H2,24,26,27)	QUYKIIWKHMOUBL-UHFFFAOYSA-N	125963	US8772304, 25	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 12					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125963	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125963&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57335652	225152325							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255858	CC(C)(C)n1c(nc2cc(ccc12)-c1cnc(N)nc1)-c1cc(cnc1-n1cncn1)C#N	InChI=1S/C23H20N10/c1-23(2,3)33-19-5-4-15(16-10-28-22(25)29-11-16)7-18(19)31-21(33)17-6-14(8-24)9-27-20(17)32-13-26-12-30-32/h4-7,9-13H,1-3H3,(H2,25,28,29)	LJQWUPDBJRODAK-UHFFFAOYSA-N	125964	US8772304, 26	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 10					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125964	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125964&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57335781	225152326							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255859	CCC(C)(C)n1c(nc2cc(ccc12)-c1cnc(N)nc1)-c1cc(Br)cnc1-n1cncn1	InChI=1S/C23H22BrN9/c1-4-23(2,3)33-19-6-5-14(15-9-28-22(25)29-10-15)7-18(19)31-21(33)17-8-16(24)11-27-20(17)32-13-26-12-30-32/h5-13H,4H2,1-3H3,(H2,25,28,29)	LFNSJHKHGUCMKJ-UHFFFAOYSA-N	125965	US8772304, 27	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 23					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125965	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125965&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57335783	225152327							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255860	Cc1ccc(-c2nc3cc(ccc3n2C(C)(C)C)-c2cnc(N)nc2)c(n1)-n1cncn1	InChI=1S/C23H23N9/c1-14-5-7-17(20(29-14)31-13-25-12-28-31)21-30-18-9-15(16-10-26-22(24)27-11-16)6-8-19(18)32(21)23(2,3)4/h5-13H,1-4H3,(H2,24,26,27)	PBHABSPOZARAGR-UHFFFAOYSA-N	125966	US8772304, 28	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 17					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125966	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125966&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57335785	225152328							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255861	COc1cncc(c1)-c1nc2cc(ccc2n1C(C)(C)C)-c1cnc(N)nc1	InChI=1S/C21H22N6O/c1-21(2,3)27-18-6-5-13(15-10-24-20(22)25-11-15)8-17(18)26-19(27)14-7-16(28-4)12-23-9-14/h5-12H,1-4H3,(H2,22,24,25)	GTKGWJKBBJXNPG-UHFFFAOYSA-N	125967	US8772304, 29	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 300					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125967	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125967&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57335925	225152329							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255862	CC(C)(C)n1c(nc2cc(ccc12)-c1cnc(N)nc1)-c1ccc(nc1)N1CCOCC1	InChI=1S/C24H27N7O/c1-24(2,3)31-20-6-4-16(18-14-27-23(25)28-15-18)12-19(20)29-22(31)17-5-7-21(26-13-17)30-8-10-32-11-9-30/h4-7,12-15H,8-11H2,1-3H3,(H2,25,27,28)	WPXZLALFJCMZLL-UHFFFAOYSA-N	125968	US8772304, 30	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 180					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125968	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125968&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57335927	225152330							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255863	CC(C)(C)n1c(nc2cc(ccc12)-c1cnc(N)nc1)-c1cccnc1	InChI=1S/C20H20N6/c1-20(2,3)26-17-7-6-13(15-11-23-19(21)24-12-15)9-16(17)25-18(26)14-5-4-8-22-10-14/h4-12H,1-3H3,(H2,21,23,24)	LRTZWBNPMBHIQL-UHFFFAOYSA-N	125969	US8772304, 31	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 542					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125969	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125969&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57335929	225152331							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255864	COc1ncccc1-c1nc2cc(ccc2n1C(C)(C)C)-c1cnc(N)nc1	InChI=1S/C21H22N6O/c1-21(2,3)27-17-8-7-13(14-11-24-20(22)25-12-14)10-16(17)26-18(27)15-6-5-9-23-19(15)28-4/h5-12H,1-4H3,(H2,22,24,25)	QHAWSJSJQQZZFD-UHFFFAOYSA-N	125970	US8772304, 32	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 220					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125970	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125970&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57336073	225152332							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
255865	CCOc1ncccc1-c1nc2cc(ccc2n1C(C)(C)C)-c1cnc(N)nc1	InChI=1S/C22H24N6O/c1-5-29-20-16(7-6-10-24-20)19-27-17-11-14(15-12-25-21(23)26-13-15)8-9-18(17)28(19)22(2,3)4/h6-13H,5H2,1-4H3,(H2,23,25,26)	DWCWSXDKJPOINU-UHFFFAOYSA-N	125971	US8772304, 33	Arachidonate 5-lipoxygenase-activating protein	Homo sapiens		 34					7.5000		US Patent		10.7270/Q22F7M4M		aid1800549	US8772304	De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA	7/8/2014	12/8/2014	Boehringer Ingelheim International	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=125971	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=125971&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search			57336075	225152333							1	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP		Arachidonate 5-lipoxygenase-activating protein	AL5AP_HUMAN	P20292	Q5VV04																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
