BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 254237 CC1C=CC=C1C(=O)N1CCN(CC1)C(=O)NC1CCN(CC1)c1ccc(cc1)C(O)=O |c:2,4| InChI=1S/C24H30N4O4/c1-17-3-2-4-21(17)22(29)27-13-15-28(16-14-27)24(32)25-19-9-11-26(12-10-19)20-7-5-18(6-8-20)23(30)31/h2-8,17,19H,9-16H2,1H3,(H,25,32)(H,30,31) LVDBZNXFTRKCRA-UHFFFAOYSA-N 124916 US8765750, 1 Hematopoietic prostaglandin D synthase Homo sapiens 67 8.0000 US Patent 10.7270/Q2862F43 aid1800529 US8765750 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 7/1/2014 11/18/2014 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124916 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124916&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 86766396 225151307 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 254238 CC1C=CC=C1C(=O)N1CCN(CC1)C(=O)NC1CCN(CC1)c1ccc(cc1)C(=O)NCCN1CCOCC1 |c:2,4| InChI=1S/C30H42N6O4/c1-23-3-2-4-27(23)29(38)35-15-17-36(18-16-35)30(39)32-25-9-12-34(13-10-25)26-7-5-24(6-8-26)28(37)31-11-14-33-19-21-40-22-20-33/h2-8,23,25H,9-22H2,1H3,(H,31,37)(H,32,39) XVEYLKHFXAXMPA-UHFFFAOYSA-N 124918 US8765750, 3 Hematopoietic prostaglandin D synthase Homo sapiens 27 8.0000 US Patent 10.7270/Q2862F43 aid1800529 US8765750 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 7/1/2014 11/18/2014 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124918 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124918&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 86766397 225151308 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 254239 CC1C=CC=C1C(=O)N1CCN(CC1)C(=O)NC1CCN(CC1)c1ccc(cc1)C(=O)N1CCOCC1 |c:2,4| InChI=1S/C28H37N5O4/c1-21-3-2-4-25(21)27(35)31-13-15-33(16-14-31)28(36)29-23-9-11-30(12-10-23)24-7-5-22(6-8-24)26(34)32-17-19-37-20-18-32/h2-8,21,23H,9-20H2,1H3,(H,29,36) MIIACXQQDWAHCE-UHFFFAOYSA-N 124919 US8765750, 4 Hematopoietic prostaglandin D synthase Homo sapiens 31 8.0000 US Patent 10.7270/Q2862F43 aid1800529 US8765750 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 7/1/2014 11/18/2014 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124919 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124919&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 86766398 225151309 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 254240 CC1C=CC=C1C(=O)N1CCN(CC1)C(=O)NC1CCN(CC1)c1ccc(cc1)C(=O)N1CCCCC1 |c:2,4| InChI=1S/C29H39N5O3/c1-22-6-5-7-26(22)28(36)33-18-20-34(21-19-33)29(37)30-24-12-16-31(17-13-24)25-10-8-23(9-11-25)27(35)32-14-3-2-4-15-32/h5-11,22,24H,2-4,12-21H2,1H3,(H,30,37) XEAIJIYYGAYXPA-UHFFFAOYSA-N 124920 US8765750, 5 Hematopoietic prostaglandin D synthase Homo sapiens 41 8.0000 US Patent 10.7270/Q2862F43 aid1800529 US8765750 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 7/1/2014 11/18/2014 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124920 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124920&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 86766399 225151310 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 254241 CC1C=CC=C1C(=O)N1CCN(CC1)C(=O)NC1CCN(CC1)c1ccc(cc1)C(=O)N1CCCC1 |c:2,4| InChI=1S/C28H37N5O3/c1-21-5-4-6-25(21)27(35)32-17-19-33(20-18-32)28(36)29-23-11-15-30(16-12-23)24-9-7-22(8-10-24)26(34)31-13-2-3-14-31/h4-10,21,23H,2-3,11-20H2,1H3,(H,29,36) WBBZBNDGTMIPPR-UHFFFAOYSA-N 124921 US8765750, 6 Hematopoietic prostaglandin D synthase Homo sapiens 52 8.0000 US Patent 10.7270/Q2862F43 aid1800529 US8765750 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 7/1/2014 11/18/2014 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124921 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124921&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 86766400 225151311 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 254242 CC1C=CC=C1C(=O)N1CCN(CC1)C(=O)NC1CCN(CC1)c1ccc(CCn2ccnn2)cc1 |c:2,4| InChI=1S/C27H35N7O2/c1-21-3-2-4-25(21)26(35)32-17-19-33(20-18-32)27(36)29-23-10-13-31(14-11-23)24-7-5-22(6-8-24)9-15-34-16-12-28-30-34/h2-8,12,16,21,23H,9-11,13-15,17-20H2,1H3,(H,29,36) DGMZYMWQUFSGIC-UHFFFAOYSA-N 124922 US8765750, 7 Hematopoietic prostaglandin D synthase Homo sapiens 15 8.0000 US Patent 10.7270/Q2862F43 aid1800529 US8765750 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 7/1/2014 11/18/2014 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124922 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124922&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 86766401 225151312 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 254243 CC1C=CC=C1C(=O)N1CCN(CC1)C(=O)NC1CCN(CC1)c1ccc(CCCn2nc(C)nc2C)cc1 |c:2,4| InChI=1S/C30H41N7O2/c1-22-6-4-8-28(22)29(38)35-18-20-36(21-19-35)30(39)32-26-13-16-34(17-14-26)27-11-9-25(10-12-27)7-5-15-37-24(3)31-23(2)33-37/h4,6,8-12,22,26H,5,7,13-21H2,1-3H3,(H,32,39) IGZZVSIUJUMJGN-UHFFFAOYSA-N 124924 US8765750, 9 Hematopoietic prostaglandin D synthase Homo sapiens 61 8.0000 US Patent 10.7270/Q2862F43 aid1800529 US8765750 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 7/1/2014 11/18/2014 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124924 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124924&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 86766402 225151313 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 254244 CC1C=CC=C1C(=O)N1CCN(CC1)C(=O)NC1CCN(CC1)c1ccc(CCCn2ccnn2)cc1 |c:2,4| InChI=1S/C28H37N7O2/c1-22-4-2-6-26(22)27(36)33-18-20-34(21-19-33)28(37)30-24-11-15-32(16-12-24)25-9-7-23(8-10-25)5-3-14-35-17-13-29-31-35/h2,4,6-10,13,17,22,24H,3,5,11-12,14-16,18-21H2,1H3,(H,30,37) HVXLKGLWRYLXLH-UHFFFAOYSA-N 124925 US8765750, 10 Hematopoietic prostaglandin D synthase Homo sapiens 27 8.0000 US Patent 10.7270/Q2862F43 aid1800529 US8765750 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 7/1/2014 11/18/2014 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124925 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124925&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 86766403 225151314 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 254245 CCC1C=CC=C1C(=O)N1CCN(CC1)C(=O)NC1CCN(CC1)c1ccc(cc1)C(=O)NCCN1CCOCC1 |c:3,5| InChI=1S/C31H44N6O4/c1-2-24-4-3-5-28(24)30(39)36-16-18-37(19-17-36)31(40)33-26-10-13-35(14-11-26)27-8-6-25(7-9-27)29(38)32-12-15-34-20-22-41-23-21-34/h3-9,24,26H,2,10-23H2,1H3,(H,32,38)(H,33,40) KKFVMROCXUQOLL-UHFFFAOYSA-N 124926 US8765750, 15 Hematopoietic prostaglandin D synthase Homo sapiens 39 8.0000 US Patent 10.7270/Q2862F43 aid1800529 US8765750 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 7/1/2014 11/18/2014 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124926 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124926&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 86766404 225151315 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 254246 CCC1C=CC=C1C(=O)N1CCN(CC1)C(=O)NC1CCN(CC1)c1ccc(CCn2ccnn2)cc1 |c:3,5| InChI=1S/C28H37N7O2/c1-2-23-4-3-5-26(23)27(36)33-18-20-34(21-19-33)28(37)30-24-11-14-32(15-12-24)25-8-6-22(7-9-25)10-16-35-17-13-29-31-35/h3-9,13,17,23-24H,2,10-12,14-16,18-21H2,1H3,(H,30,37) WKHWCLMRUHFOPT-UHFFFAOYSA-N 124927 US8765750, 16 Hematopoietic prostaglandin D synthase Homo sapiens 68.4 8.0000 US Patent 10.7270/Q2862F43 aid1800529 US8765750 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 7/1/2014 11/18/2014 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124927 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124927&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 86766405 225151316 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 254247 O=C(NC1CCN(CC1)c1ccc(cc1)C(=O)NCCN1CCOCC1)N1CCN(CC1)C(=O)c1ccc[nH]1 InChI=1S/C28H39N7O4/c36-26(30-10-13-32-18-20-39-21-19-32)22-3-5-24(6-4-22)33-11-7-23(8-12-33)31-28(38)35-16-14-34(15-17-35)27(37)25-2-1-9-29-25/h1-6,9,23,29H,7-8,10-21H2,(H,30,36)(H,31,38) LFUMESUYPVIAMD-UHFFFAOYSA-N 124928 US8765750, Reference Example 1 Hematopoietic prostaglandin D synthase Homo sapiens 334 8.0000 US Patent 10.7270/Q2862F43 aid1800529 US8765750 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 7/1/2014 11/18/2014 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124928 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124928&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 71073990 225151317 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 254248 Cc1cc(C)c([nH]1)C(=O)N1CCN(CC1)C(=O)NC1CCN(CC1)c1ccc(cc1)C(=O)NCCN1CCOCC1 InChI=1S/C30H43N7O4/c1-22-21-23(2)32-27(22)29(39)36-13-15-37(16-14-36)30(40)33-25-7-10-35(11-8-25)26-5-3-24(4-6-26)28(38)31-9-12-34-17-19-41-20-18-34/h3-6,21,25,32H,7-20H2,1-2H3,(H,31,38)(H,33,40) XKNZPVJWNXIRHQ-UHFFFAOYSA-N 124929 US8765750, Reference Example 2 Hematopoietic prostaglandin D synthase Homo sapiens >1000 8.0000 US Patent 10.7270/Q2862F43 aid1800529 US8765750 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 7/1/2014 11/18/2014 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124929 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124929&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 71073932 225151318 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 254249 Cn1ccc(c1)C(=O)N1CCN(CC1)C(=O)NC1CCN(CC1)c1ccc(cc1)C(=O)NCCN1CCOCC1 InChI=1S/C29H41N7O4/c1-32-10-6-24(22-32)28(38)35-14-16-36(17-15-35)29(39)31-25-7-11-34(12-8-25)26-4-2-23(3-5-26)27(37)30-9-13-33-18-20-40-21-19-33/h2-6,10,22,25H,7-9,11-21H2,1H3,(H,30,37)(H,31,39) VOWHNTVVDVABKT-UHFFFAOYSA-N 124930 US8765750, Reference Example 3 Hematopoietic prostaglandin D synthase Homo sapiens >1000 8.0000 US Patent 10.7270/Q2862F43 aid1800529 US8765750 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 7/1/2014 11/18/2014 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124930 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124930&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 71073864 225151319 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 254250 O=C(NC1CCN(CC1)c1ccc(cc1)C(=O)NCCN1CCOCC1)N1CCN(CC1)C(=O)c1cccs1 InChI=1S/C28H38N6O4S/c35-26(29-9-12-31-17-19-38-20-18-31)22-3-5-24(6-4-22)32-10-7-23(8-11-32)30-28(37)34-15-13-33(14-16-34)27(36)25-2-1-21-39-25/h1-6,21,23H,7-20H2,(H,29,35)(H,30,37) VTMGOGFYMGJLPE-UHFFFAOYSA-N 124931 US8765750, Reference Example 4 Hematopoietic prostaglandin D synthase Homo sapiens 201 8.0000 US Patent 10.7270/Q2862F43 aid1800529 US8765750 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 7/1/2014 11/18/2014 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124931 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124931&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 71073921 225151320 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 254251 O=C(NC1CCN(CC1)c1ccc(cc1)C(=O)NCCN1CCOCC1)N1CCN(CC1)C(=O)c1ccsc1 InChI=1S/C28H38N6O4S/c35-26(29-8-11-31-16-18-38-19-17-31)22-1-3-25(4-2-22)32-9-5-24(6-10-32)30-28(37)34-14-12-33(13-15-34)27(36)23-7-20-39-21-23/h1-4,7,20-21,24H,5-6,8-19H2,(H,29,35)(H,30,37) PQGCVZVPSINNEM-UHFFFAOYSA-N 124932 US8765750, Reference Example 5 Hematopoietic prostaglandin D synthase Homo sapiens 327 8.0000 US Patent 10.7270/Q2862F43 aid1800529 US8765750 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 7/1/2014 11/18/2014 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124932 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124932&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 71073710 225151321 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 254252 O=C(NC1CCN(CC1)c1ccc(cc1)C(=O)NCCN1CCOCC1)N1CCN(CC1)C(=O)c1ccco1 InChI=1S/C28H38N6O5/c35-26(29-9-12-31-17-20-38-21-18-31)22-3-5-24(6-4-22)32-10-7-23(8-11-32)30-28(37)34-15-13-33(14-16-34)27(36)25-2-1-19-39-25/h1-6,19,23H,7-18,20-21H2,(H,29,35)(H,30,37) YJYGUWQDFSHNIJ-UHFFFAOYSA-N 124933 US8765750, Reference Example 6 Hematopoietic prostaglandin D synthase Homo sapiens 445 8.0000 US Patent 10.7270/Q2862F43 aid1800529 US8765750 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 7/1/2014 11/18/2014 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124933 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124933&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 71073989 225151322 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 254253 O=C(NC1CCN(CC1)c1ccc(cc1)C(=O)NCCN1CCOCC1)N1CCN(CC1)C(=O)c1ccoc1 InChI=1S/C28H38N6O5/c35-26(29-8-11-31-16-19-38-20-17-31)22-1-3-25(4-2-22)32-9-5-24(6-10-32)30-28(37)34-14-12-33(13-15-34)27(36)23-7-18-39-21-23/h1-4,7,18,21,24H,5-6,8-17,19-20H2,(H,29,35)(H,30,37) VKDMHOZKONMHKU-UHFFFAOYSA-N 124934 US8765750, Reference Example 7 Hematopoietic prostaglandin D synthase Homo sapiens >1000 8.0000 US Patent 10.7270/Q2862F43 aid1800529 US8765750 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 7/1/2014 11/18/2014 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124934 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124934&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 71073951 225151323 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 254254 O=C(NC1CCN(CC1)c1ccc(cc1)C(=O)NCCN1CCOCC1)N1CCN(CC1)C(=O)c1ccno1 InChI=1S/C27H37N7O5/c35-25(28-9-12-31-17-19-38-20-18-31)21-1-3-23(4-2-21)32-10-6-22(7-11-32)30-27(37)34-15-13-33(14-16-34)26(36)24-5-8-29-39-24/h1-5,8,22H,6-7,9-20H2,(H,28,35)(H,30,37) QQCWXUJNEZPUPV-UHFFFAOYSA-N 124935 US8765750, Reference Example 8 Hematopoietic prostaglandin D synthase Homo sapiens >1000 8.0000 US Patent 10.7270/Q2862F43 aid1800529 US8765750 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 7/1/2014 11/18/2014 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124935 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124935&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 71073849 225151324 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 254255 Cn1ccnc1C(=O)N1CCN(CC1)C(=O)NC1CCN(CC1)c1ccc(cc1)C(=O)NCCN1CCOCC1 InChI=1S/C28H40N8O4/c1-32-12-8-29-25(32)27(38)35-14-16-36(17-15-35)28(39)31-23-6-10-34(11-7-23)24-4-2-22(3-5-24)26(37)30-9-13-33-18-20-40-21-19-33/h2-5,8,12,23H,6-7,9-11,13-21H2,1H3,(H,30,37)(H,31,39) YJRJKJFXBMZXDR-UHFFFAOYSA-N 124936 US8765750, Reference Example 9 Hematopoietic prostaglandin D synthase Homo sapiens >1000 8.0000 US Patent 10.7270/Q2862F43 aid1800529 US8765750 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 7/1/2014 11/18/2014 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124936 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124936&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 71073837 225151325 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 254256 O=C(NC1CCN(CC1)c1ccc(cc1)C(=O)NCCN1CCOCC1)N1CCN(CC1)C(=O)C1CCCC1 InChI=1S/C29H44N6O4/c36-27(30-11-14-32-19-21-39-22-20-32)23-5-7-26(8-6-23)33-12-9-25(10-13-33)31-29(38)35-17-15-34(16-18-35)28(37)24-3-1-2-4-24/h5-8,24-25H,1-4,9-22H2,(H,30,36)(H,31,38) GJGHPUGZHYRIPI-UHFFFAOYSA-N 124937 US8765750, Reference Example 10 Hematopoietic prostaglandin D synthase Homo sapiens >1000 8.0000 US Patent 10.7270/Q2862F43 aid1800529 US8765750 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 7/1/2014 11/18/2014 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124937 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124937&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 71074171 225151326 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 254257 O=C(NC1CCN(CC1)c1ccc(cc1)C(=O)NCCN1CCOCC1)N1CCN(CC1)C(=O)c1ccccc1 InChI=1S/C30H40N6O4/c37-28(31-12-15-33-20-22-40-23-21-33)24-6-8-27(9-7-24)34-13-10-26(11-14-34)32-30(39)36-18-16-35(17-19-36)29(38)25-4-2-1-3-5-25/h1-9,26H,10-23H2,(H,31,37)(H,32,39) SDCUAVIBLZLEIP-UHFFFAOYSA-N 124938 US8765750, Reference Example 11 Hematopoietic prostaglandin D synthase Homo sapiens 249 8.0000 US Patent 10.7270/Q2862F43 aid1800529 US8765750 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 7/1/2014 11/18/2014 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124938 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124938&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 71073622 225151327 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 254258 Fc1cccc(c1)C(=O)N1CCN(CC1)C(=O)Nc1nc2ccc(Br)cc2s1 InChI=1S/C19H16BrFN4O2S/c20-13-4-5-15-16(11-13)28-18(22-15)23-19(27)25-8-6-24(7-9-25)17(26)12-2-1-3-14(21)10-12/h1-5,10-11H,6-9H2,(H,22,23,27) CFOSRSHKAHRGQK-UHFFFAOYSA-N 124939 US8765750, Reference Example 12 Hematopoietic prostaglandin D synthase Homo sapiens 106 8.0000 US Patent 10.7270/Q2862F43 aid1800529 US8765750 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 7/1/2014 11/18/2014 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124939 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124939&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 25095564 225151328 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 254259 Cc1cc2nc(NC(=O)N3CCN(CC3)C(=O)c3cccc(F)c3)sc2cc1C InChI=1S/C21H21FN4O2S/c1-13-10-17-18(11-14(13)2)29-20(23-17)24-21(28)26-8-6-25(7-9-26)19(27)15-4-3-5-16(22)12-15/h3-5,10-12H,6-9H2,1-2H3,(H,23,24,28) FGOMBTJJMSKTFN-UHFFFAOYSA-N 124940 US8765750, Reference Example 13 Hematopoietic prostaglandin D synthase Homo sapiens 222 8.0000 US Patent 10.7270/Q2862F43 aid1800529 US8765750 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 7/1/2014 11/18/2014 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124940 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124940&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 86766406 225151329 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 254260 Cc1ccc2nc(NC(=O)N3CCN(CC3)C(=O)c3cccc(F)c3)sc2c1 InChI=1S/C20H19FN4O2S/c1-13-5-6-16-17(11-13)28-19(22-16)23-20(27)25-9-7-24(8-10-25)18(26)14-3-2-4-15(21)12-14/h2-6,11-12H,7-10H2,1H3,(H,22,23,27) HAVAPNGNRHSMFI-UHFFFAOYSA-N 124941 US8765750, Reference Example 14 Hematopoietic prostaglandin D synthase Homo sapiens 260 8.0000 US Patent 10.7270/Q2862F43 aid1800529 US8765750 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 7/1/2014 11/18/2014 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124941 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124941&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 57959383 225151330 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 254261 COc1ccc2nc(NC(=O)N3CCN(CC3)C(=O)c3cccc(F)c3)sc2c1 InChI=1S/C20H19FN4O3S/c1-28-15-5-6-16-17(12-15)29-19(22-16)23-20(27)25-9-7-24(8-10-25)18(26)13-3-2-4-14(21)11-13/h2-6,11-12H,7-10H2,1H3,(H,22,23,27) LOALUDBNYIAWTL-UHFFFAOYSA-N 124942 US8765750, Reference Example 15 Hematopoietic prostaglandin D synthase Homo sapiens 318 8.0000 US Patent 10.7270/Q2862F43 aid1800529 US8765750 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 7/1/2014 11/18/2014 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124942 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124942&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 86766407 225151331 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 254262 Fc1cccc(c1)C(=O)N1CCN(CC1)C(=O)Nc1nc2ccc(Cl)cc2s1 InChI=1S/C19H16ClFN4O2S/c20-13-4-5-15-16(11-13)28-18(22-15)23-19(27)25-8-6-24(7-9-25)17(26)12-2-1-3-14(21)10-12/h1-5,10-11H,6-9H2,(H,22,23,27) VQTQJTNJENBEND-UHFFFAOYSA-N 124943 US8765750, Reference Example 16 Hematopoietic prostaglandin D synthase Homo sapiens 204 8.0000 US Patent 10.7270/Q2862F43 aid1800529 US8765750 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 7/1/2014 11/18/2014 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124943 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124943&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 86766408 225151332 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 254263 Fc1cccc(c1)C(=O)N1CCN(CC1)C(=O)Nc1ccc(cc1)C(F)(F)F InChI=1S/C19H17F4N3O2/c20-15-3-1-2-13(12-15)17(27)25-8-10-26(11-9-25)18(28)24-16-6-4-14(5-7-16)19(21,22)23/h1-7,12H,8-11H2,(H,24,28) MQJOIYABXQPCDH-UHFFFAOYSA-N 124944 US8765750, Reference Example 17 Hematopoietic prostaglandin D synthase Homo sapiens 5817 8.0000 US Patent 10.7270/Q2862F43 aid1800529 US8765750 Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K 7/1/2014 11/18/2014 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=124944 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=124944&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 86766409 225151333 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9