BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 251804 OC(=O)CNC(=O)c1c2cc(ccc2c(O)oc1=O)-c1ccccc1 InChI=1S/C18H13NO6/c20-14(21)9-19-16(22)15-13-8-11(10-4-2-1-3-5-10)6-7-12(13)17(23)25-18(15)24/h1-8,23H,9H2,(H,19,22)(H,20,21) JSBJNPBPURQABI-UHFFFAOYSA-N 123016 US8742138, 34::US8742138, 1 Egl nine homolog 1 Rattus norvegicus 250 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123016 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123016&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765950 225149439 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251805 OC(=O)CNC(=O)c1c2cc(ccc2c(O)oc1=O)-c1ccccc1Cl InChI=1S/C18H12ClNO6/c19-13-4-2-1-3-10(13)9-5-6-11-12(7-9)15(18(25)26-17(11)24)16(23)20-8-14(21)22/h1-7,24H,8H2,(H,20,23)(H,21,22) MLIKFCLMFRVLLB-UHFFFAOYSA-N 123017 US8742138, 2 Egl nine homolog 1 Rattus norvegicus 150 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123017 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123017&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765951 225149440 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251806 OC(=O)CNC(=O)c1c2cc(ccc2c(O)oc1=O)-c1cccc(Cl)c1 InChI=1S/C18H12ClNO6/c19-11-3-1-2-9(6-11)10-4-5-12-13(7-10)15(18(25)26-17(12)24)16(23)20-8-14(21)22/h1-7,24H,8H2,(H,20,23)(H,21,22) XCKXIVYTASNKRE-UHFFFAOYSA-N 123018 US8742138, 3 Egl nine homolog 1 Rattus norvegicus 150 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123018 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123018&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765952 225149441 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251807 OC(=O)CNC(=O)c1c2cc(ccc2c(O)oc1=O)-c1ccc(Cl)cc1 InChI=1S/C18H12ClNO6/c19-11-4-1-9(2-5-11)10-3-6-12-13(7-10)15(18(25)26-17(12)24)16(23)20-8-14(21)22/h1-7,24H,8H2,(H,20,23)(H,21,22) UMQZZVAPEBPWGJ-UHFFFAOYSA-N 123019 US8742138, 4 Egl nine homolog 1 Rattus norvegicus 150 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123019 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123019&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765953 225149442 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251808 OC(=O)CNC(=O)c1c2cc(ccc2c(O)oc1=O)-c1cccc(c1)C(F)(F)F InChI=1S/C19H12F3NO6/c20-19(21,22)11-3-1-2-9(6-11)10-4-5-12-13(7-10)15(18(28)29-17(12)27)16(26)23-8-14(24)25/h1-7,27H,8H2,(H,23,26)(H,24,25) WTTRLRBNAWJQPR-UHFFFAOYSA-N 123020 US8742138, 5 Egl nine homolog 1 Rattus norvegicus 150 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123020 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123020&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765954 225149443 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251809 OC(=O)CNC(=O)c1c2cc(ccc2c(O)oc1=O)-c1ccc(cc1)C(F)(F)F InChI=1S/C19H12F3NO6/c20-19(21,22)11-4-1-9(2-5-11)10-3-6-12-13(7-10)15(18(28)29-17(12)27)16(26)23-8-14(24)25/h1-7,27H,8H2,(H,23,26)(H,24,25) KGACLNFYRWFTRM-UHFFFAOYSA-N 123021 US8742138, 6 Egl nine homolog 1 Rattus norvegicus 150 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123021 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123021&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765955 225149444 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251810 OC(=O)CNC(=O)c1c2cc(ccc2c(O)oc1=O)-c1cccc(OC(F)(F)F)c1 InChI=1S/C19H12F3NO7/c20-19(21,22)30-11-3-1-2-9(6-11)10-4-5-12-13(7-10)15(18(28)29-17(12)27)16(26)23-8-14(24)25/h1-7,27H,8H2,(H,23,26)(H,24,25) FRAQPZUFJJIURS-UHFFFAOYSA-N 123022 US8742138, 7 Egl nine homolog 1 Rattus norvegicus 150 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123022 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123022&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765956 225149445 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251811 OC(=O)CNC(=O)c1c2cc(ccc2c(O)oc1=O)-c1ccc(OC(F)(F)F)cc1 InChI=1S/C19H12F3NO7/c20-19(21,22)30-11-4-1-9(2-5-11)10-3-6-12-13(7-10)15(18(28)29-17(12)27)16(26)23-8-14(24)25/h1-7,27H,8H2,(H,23,26)(H,24,25) RTKAOCMTYDQWLO-UHFFFAOYSA-N 123023 US8742138, 8 Egl nine homolog 1 Rattus norvegicus 150 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123023 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123023&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765957 225149446 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251812 OC(=O)CNC(=O)c1c2cc(ccc2c(O)oc1=O)-c1ccc(Cl)c(Cl)c1 InChI=1S/C18H11Cl2NO6/c19-12-4-2-9(6-13(12)20)8-1-3-10-11(5-8)15(18(26)27-17(10)25)16(24)21-7-14(22)23/h1-6,25H,7H2,(H,21,24)(H,22,23) CMNNKDUCUWKUPB-UHFFFAOYSA-N 123024 US8742138, 9 Egl nine homolog 1 Rattus norvegicus 150 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123024 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123024&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765958 225149447 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251813 OC(=O)CNC(=O)c1c2cc(ccc2c(O)oc1=O)-c1ccc(F)c(F)c1 InChI=1S/C18H11F2NO6/c19-12-4-2-9(6-13(12)20)8-1-3-10-11(5-8)15(18(26)27-17(10)25)16(24)21-7-14(22)23/h1-6,25H,7H2,(H,21,24)(H,22,23) QVTJZCLNDKHRRZ-UHFFFAOYSA-N 123025 US8742138, 10 Egl nine homolog 1 Rattus norvegicus 150 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123025 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123025&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765959 225149448 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251814 OC(=O)CNC(=O)c1c2cc(ccc2c(O)oc1=O)-c1cc(F)c(F)c(F)c1 InChI=1S/C18H10F3NO6/c19-11-4-8(5-12(20)15(11)21)7-1-2-9-10(3-7)14(18(27)28-17(9)26)16(25)22-6-13(23)24/h1-5,26H,6H2,(H,22,25)(H,23,24) VXGRECMXJKQTTL-UHFFFAOYSA-N 123026 US8742138, 11 Egl nine homolog 1 Rattus norvegicus 150 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123026 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123026&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765960 225149449 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251815 COc1cccc(c1)-c1ccc2c(O)oc(=O)c(C(=O)NCC(O)=O)c2c1 InChI=1S/C19H15NO7/c1-26-12-4-2-3-10(7-12)11-5-6-13-14(8-11)16(19(25)27-18(13)24)17(23)20-9-15(21)22/h2-8,24H,9H2,1H3,(H,20,23)(H,21,22) DQVYQGMSLXYGFO-UHFFFAOYSA-N 123027 US8742138, 12 Egl nine homolog 1 Rattus norvegicus 150 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123027 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123027&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765961 225149450 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251816 COc1ccc(cc1)-c1ccc2c(O)oc(=O)c(C(=O)NCC(O)=O)c2c1 InChI=1S/C19H15NO7/c1-26-12-5-2-10(3-6-12)11-4-7-13-14(8-11)16(19(25)27-18(13)24)17(23)20-9-15(21)22/h2-8,24H,9H2,1H3,(H,20,23)(H,21,22) IRNCXEJGEIMWOV-UHFFFAOYSA-N 123028 US8742138, 13 Egl nine homolog 1 Rattus norvegicus 150 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123028 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123028&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765962 225149451 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251817 Cc1cccc(c1)-c1ccc2c(O)oc(=O)c(C(=O)NCC(O)=O)c2c1 InChI=1S/C19H15NO6/c1-10-3-2-4-11(7-10)12-5-6-13-14(8-12)16(19(25)26-18(13)24)17(23)20-9-15(21)22/h2-8,24H,9H2,1H3,(H,20,23)(H,21,22) TYPRUQFXYRAUBB-UHFFFAOYSA-N 123029 US8742138, 14 Egl nine homolog 1 Rattus norvegicus 300 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123029 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123029&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765963 225149452 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251818 Cc1ccc(cc1)-c1ccc2c(O)oc(=O)c(C(=O)NCC(O)=O)c2c1 InChI=1S/C19H15NO6/c1-10-2-4-11(5-3-10)12-6-7-13-14(8-12)16(19(25)26-18(13)24)17(23)20-9-15(21)22/h2-8,24H,9H2,1H3,(H,20,23)(H,21,22) LBCWZFMIMLHFJY-UHFFFAOYSA-N 123030 US8742138, 15 Egl nine homolog 1 Rattus norvegicus 150 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123030 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123030&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765964 225149453 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251819 OC(=O)CNC(=O)c1c2c(cccc2c(O)oc1=O)-c1ccccc1 InChI=1S/C18H13NO6/c20-13(21)9-19-16(22)15-14-11(10-5-2-1-3-6-10)7-4-8-12(14)17(23)25-18(15)24/h1-8,23H,9H2,(H,19,22)(H,20,21) PWFZZPHMGXZBAW-UHFFFAOYSA-N 123031 US8742138, 16 Egl nine homolog 1 Rattus norvegicus 350 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123031 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123031&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765965 225149454 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251820 OC(=O)CNC(=O)c1c2c(cccc2c(O)oc1=O)-c1ccccc1Cl InChI=1S/C18H12ClNO6/c19-12-7-2-1-4-9(12)10-5-3-6-11-14(10)15(18(25)26-17(11)24)16(23)20-8-13(21)22/h1-7,24H,8H2,(H,20,23)(H,21,22) XZBMMMCYZZBWKP-UHFFFAOYSA-N 123032 US8742138, 17 Egl nine homolog 1 Rattus norvegicus 200 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123032 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123032&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765966 225149455 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251821 OC(=O)CNC(=O)c1c2c(cccc2c(O)oc1=O)-c1cccc(Cl)c1 InChI=1S/C18H12ClNO6/c19-10-4-1-3-9(7-10)11-5-2-6-12-14(11)15(18(25)26-17(12)24)16(23)20-8-13(21)22/h1-7,24H,8H2,(H,20,23)(H,21,22) CTQGPSJGSUHBCD-UHFFFAOYSA-N 123033 US8742138, 18 Egl nine homolog 1 Rattus norvegicus 90 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123033 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123033&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765967 225149456 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251822 OC(=O)CNC(=O)c1c2c(cccc2c(O)oc1=O)-c1ccc(Cl)cc1 InChI=1S/C18H12ClNO6/c19-10-6-4-9(5-7-10)11-2-1-3-12-14(11)15(18(25)26-17(12)24)16(23)20-8-13(21)22/h1-7,24H,8H2,(H,20,23)(H,21,22) JYSREMXNKDHNHN-UHFFFAOYSA-N 123034 US8742138, 19 Egl nine homolog 1 Rattus norvegicus 150 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123034 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123034&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765968 225149457 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251823 OC(=O)CNC(=O)c1c2c(cccc2c(O)oc1=O)-c1cccc(c1)C(F)(F)F InChI=1S/C19H12F3NO6/c20-19(21,22)10-4-1-3-9(7-10)11-5-2-6-12-14(11)15(18(28)29-17(12)27)16(26)23-8-13(24)25/h1-7,27H,8H2,(H,23,26)(H,24,25) CIIIPWFIWHNXSF-UHFFFAOYSA-N 123035 US8742138, 20 Egl nine homolog 1 Rattus norvegicus 100 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123035 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123035&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765969 225149458 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251824 OC(=O)CNC(=O)c1c2c(cccc2c(O)oc1=O)-c1ccc(cc1)C(F)(F)F InChI=1S/C19H12F3NO6/c20-19(21,22)10-6-4-9(5-7-10)11-2-1-3-12-14(11)15(18(28)29-17(12)27)16(26)23-8-13(24)25/h1-7,27H,8H2,(H,23,26)(H,24,25) KALGDVSCXIKWNW-UHFFFAOYSA-N 123036 US8742138, 21 Egl nine homolog 1 Rattus norvegicus 90 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123036 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123036&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765970 225149459 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251825 OC(=O)CNC(=O)c1c2c(cccc2c(O)oc1=O)-c1cccc(OC(F)(F)F)c1 InChI=1S/C19H12F3NO7/c20-19(21,22)30-10-4-1-3-9(7-10)11-5-2-6-12-14(11)15(18(28)29-17(12)27)16(26)23-8-13(24)25/h1-7,27H,8H2,(H,23,26)(H,24,25) TYNGBTFQLHIIJC-UHFFFAOYSA-N 123037 US8742138, 22 Egl nine homolog 1 Rattus norvegicus 100 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123037 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123037&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765971 225149460 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251826 OC(=O)CNC(=O)c1c2c(cccc2c(O)oc1=O)-c1ccc(OC(F)(F)F)cc1 InChI=1S/C19H12F3NO7/c20-19(21,22)30-10-6-4-9(5-7-10)11-2-1-3-12-14(11)15(18(28)29-17(12)27)16(26)23-8-13(24)25/h1-7,27H,8H2,(H,23,26)(H,24,25) MXZILTYUQNZUTJ-UHFFFAOYSA-N 123038 US8742138, 23 Egl nine homolog 1 Rattus norvegicus 150 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123038 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123038&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765972 225149461 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251827 OC(=O)CNC(=O)c1c2c(cccc2c(O)oc1=O)-c1ccc(Cl)c(Cl)c1 InChI=1S/C18H11Cl2NO6/c19-11-5-4-8(6-12(11)20)9-2-1-3-10-14(9)15(18(26)27-17(10)25)16(24)21-7-13(22)23/h1-6,25H,7H2,(H,21,24)(H,22,23) FYICZFUMQLKDAL-UHFFFAOYSA-N 123039 US8742138, 24 Egl nine homolog 1 Rattus norvegicus 30 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123039 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123039&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765973 225149462 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251828 OC(=O)CNC(=O)c1c2c(cccc2c(O)oc1=O)-c1ccc(F)c(F)c1 InChI=1S/C18H11F2NO6/c19-11-5-4-8(6-12(11)20)9-2-1-3-10-14(9)15(18(26)27-17(10)25)16(24)21-7-13(22)23/h1-6,25H,7H2,(H,21,24)(H,22,23) GJZOTRGBNZONHJ-UHFFFAOYSA-N 123040 US8742138, 25 Egl nine homolog 1 Rattus norvegicus 150 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123040 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123040&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765974 225149463 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251829 OC(=O)CNC(=O)c1c2c(cccc2c(O)oc1=O)-c1cc(F)c(F)c(F)c1 InChI=1S/C18H10F3NO6/c19-10-4-7(5-11(20)15(10)21)8-2-1-3-9-13(8)14(18(27)28-17(9)26)16(25)22-6-12(23)24/h1-5,26H,6H2,(H,22,25)(H,23,24) DSAUJJJRDDRPQE-UHFFFAOYSA-N 123041 US8742138, 26 Egl nine homolog 1 Rattus norvegicus 150 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123041 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123041&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765975 225149464 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251830 COc1cccc(c1)-c1cccc2c(O)oc(=O)c(C(=O)NCC(O)=O)c12 InChI=1S/C19H15NO7/c1-26-11-5-2-4-10(8-11)12-6-3-7-13-15(12)16(19(25)27-18(13)24)17(23)20-9-14(21)22/h2-8,24H,9H2,1H3,(H,20,23)(H,21,22) KUAAWLYMRHJGEW-UHFFFAOYSA-N 123042 US8742138, 27 Egl nine homolog 1 Rattus norvegicus 150 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123042 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123042&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765976 225149465 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251831 COc1ccc(cc1)-c1cccc2c(O)oc(=O)c(C(=O)NCC(O)=O)c12 InChI=1S/C19H15NO7/c1-26-11-7-5-10(6-8-11)12-3-2-4-13-15(12)16(19(25)27-18(13)24)17(23)20-9-14(21)22/h2-8,24H,9H2,1H3,(H,20,23)(H,21,22) VWJCXGPXZKKYBO-UHFFFAOYSA-N 123043 US8742138, 28 Egl nine homolog 1 Rattus norvegicus 80 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123043 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123043&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765977 225149466 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251832 Cc1cccc(c1)-c1cccc2c(O)oc(=O)c(C(=O)NCC(O)=O)c12 InChI=1S/C19H15NO6/c1-10-4-2-5-11(8-10)12-6-3-7-13-15(12)16(19(25)26-18(13)24)17(23)20-9-14(21)22/h2-8,24H,9H2,1H3,(H,20,23)(H,21,22) ZAEZVXDATUNLKE-UHFFFAOYSA-N 123044 US8742138, 29 Egl nine homolog 1 Rattus norvegicus 150 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123044 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123044&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765978 225149467 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251833 Cc1ccc(cc1)-c1cccc2c(O)oc(=O)c(C(=O)NCC(O)=O)c12 InChI=1S/C19H15NO6/c1-10-5-7-11(8-6-10)12-3-2-4-13-15(12)16(19(25)26-18(13)24)17(23)20-9-14(21)22/h2-8,24H,9H2,1H3,(H,20,23)(H,21,22) CCVJXBNRIUOSRW-UHFFFAOYSA-N 123045 US8742138, 30 Egl nine homolog 1 Rattus norvegicus 80 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123045 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123045&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765979 225149468 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251834 OC(=O)CNC(=O)c1c2cc(ccc2c(O)oc1=O)-c1cccnc1 InChI=1S/C17H12N2O6/c20-13(21)8-19-15(22)14-12-6-9(10-2-1-5-18-7-10)3-4-11(12)16(23)25-17(14)24/h1-7,23H,8H2,(H,19,22)(H,20,21) MZIUPCFHSPKVQJ-UHFFFAOYSA-N 123048 US8742138, 33 Egl nine homolog 1 Rattus norvegicus 200 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123048 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123048&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765980 225149469 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251835 OC(=O)CNC(=O)c1c2cc(ccc2c(O)oc1=O)-c1ccccc1 InChI=1S/C18H13NO6/c20-14(21)9-19-16(22)15-13-8-11(10-4-2-1-3-5-10)6-7-12(13)17(23)25-18(15)24/h1-8,23H,9H2,(H,19,22)(H,20,21) JSBJNPBPURQABI-UHFFFAOYSA-N 123016 US8742138, 34::US8742138, 1 Egl nine homolog 1 Rattus norvegicus 150 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123016 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123016&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765950 225149439 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251836 OC(=O)CNC(=O)c1c2cc(Br)ccc2c(O)oc1=O InChI=1S/C12H8BrNO6/c13-5-1-2-6-7(3-5)9(12(19)20-11(6)18)10(17)14-4-8(15)16/h1-3,18H,4H2,(H,14,17)(H,15,16) GFNQOAZDBJEEOM-UHFFFAOYSA-N 123050 US8742138, 35 Egl nine homolog 1 Rattus norvegicus 150 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123050 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123050&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765981 225149471 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251837 OC(=O)CNC(=O)c1c2c(Br)cccc2c(O)oc1=O InChI=1S/C12H8BrNO6/c13-6-3-1-2-5-8(6)9(12(19)20-11(5)18)10(17)14-4-7(15)16/h1-3,18H,4H2,(H,14,17)(H,15,16) CCHAAFYNHWGLRD-UHFFFAOYSA-N 123051 US8742138, 36 Egl nine homolog 1 Rattus norvegicus 300 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123051 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123051&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765982 225149472 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6 251838 OC(=O)CNC(=O)c1c2ccc(Br)cc2c(O)oc1=O InChI=1S/C12H8BrNO6/c13-5-1-2-6-7(3-5)11(18)20-12(19)9(6)10(17)14-4-8(15)16/h1-3,18H,4H2,(H,14,17)(H,15,16) KZWABJGZWIXHQS-UHFFFAOYSA-N 123009 US8742138, 37::US8742158, EX 21 Egl nine homolog 1 Rattus norvegicus 700 25.00 C US Patent 10.7270/Q23R0RJD aid1800468 US8742138 Kang, X; Long, W; Ma, C; Wang, Y; Cao, H; Wang, Y; Tan, F; Hu, Y 6/3/2014 10/28/2014 Betta Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=123009 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6234&target=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=123009&enzyme=Egl+nine+homolog+1&column=ki&startPg=0&Increment=50&submit=Search 86765948 225149432 1 PRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSSTAASRVPGPEDATQAGSGPGPAEPSSEDPPPSRSPGPERASLCPAGGGPGEALSPSGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV 8Z33,8Z32,2HBU,2HBT,8RV1,8RUZ,8RUT,8RUV,8Z35,8Z31 Egl nine homolog 1 EGLN1_RAT P59722 Q642G6