BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 51644063 Oc1ccc(cc1)-c1sc2cc(O)ccc2c1C(=O)c1ccc(OCCN2CCCCC2)cc1 InChI=1S/C28H27NO4S/c30-21-8-4-20(5-9-21)28-26(24-13-10-22(31)18-25(24)34-28)27(32)19-6-11-23(12-7-19)33-17-16-29-14-2-1-3-15-29/h4-13,18,30-31H,1-3,14-17H2 GZUITABIAKMVPG-UHFFFAOYSA-N 19441 Evista::CHEMBL81::Keoxifene::Raloxifene, 6::RALOXIFENE HYDROCHLORIDE::[6-hydroxy-2-(4-hydroxyphenyl)-1-benzothiophen-3-yl]-[4-(2-piperidin-1-ylethoxy)phenyl]methanone::2-(4-hydroxyphenyl)-3-({4-[2-(piperidin-1-yl)ethoxy]phenyl}carbonyl)-1-benzothiophen-6-ol::cid_11071264::Raloxifene::Raloxifene (7) Phenazine biosynthesis protein PhzB 2 55600 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=19441 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=19441&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 5035 46519463 CHEMBL81 DB00481 C07228 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644064 O=C(c1ccccc1)c1c(-c2ccc(O)cc2)sc2cc(O)ccc12 InChI=1S/C21H14O3S/c22-15-8-6-14(7-9-15)21-19(20(24)13-4-2-1-3-5-13)17-11-10-16(23)12-18(17)25-21/h1-12,22-23H YDZRLGBITFJWPV-UHFFFAOYSA-N 50662189 CHEMBL6165617 Phenazine biosynthesis protein PhzB 2 15600 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662189 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662189&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644065 Cc1ccc(cc1)C(=O)c1c(sc2cc(O)ccc12)-c1ccc(O)cc1 InChI=1S/C22H16O3S/c1-13-2-4-14(5-3-13)21(25)20-18-11-10-17(24)12-19(18)26-22(20)15-6-8-16(23)9-7-15/h2-12,23-24H,1H3 VBWCDXJRQBKNIN-UHFFFAOYSA-N 50145788 CHEMBL3765549 Phenazine biosynthesis protein PhzB 2 5400 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50145788 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50145788&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 11161698 104034477 CHEMBL3765549 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644066 O=C(c1ccc(F)cc1)c1c(-c2ccc(O)cc2)sc2cc(O)ccc12 InChI=1S/C21H13FO3S/c22-14-5-1-12(2-6-14)20(25)19-17-10-9-16(24)11-18(17)26-21(19)13-3-7-15(23)8-4-13/h1-11,23-24H TYXTVBAVZPPXPA-UHFFFAOYSA-N 50662190 CHEMBL6165767 Phenazine biosynthesis protein PhzB 2 10000 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662190 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662190&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644067 O=C(c1ccc(Cl)cc1)c1c(-c2ccc(O)cc2)sc2cc(O)ccc12 InChI=1S/C21H13ClO3S/c22-14-5-1-12(2-6-14)20(25)19-17-10-9-16(24)11-18(17)26-21(19)13-3-7-15(23)8-4-13/h1-11,23-24H MAHGILUQSRQUDZ-UHFFFAOYSA-N 50662191 CHEMBL6151266 Phenazine biosynthesis protein PhzB 2 1700 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662191 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662191&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644068 O=C(c1ccc(Br)cc1)c1c(-c2ccc(O)cc2)sc2cc(O)ccc12 InChI=1S/C21H13BrO3S/c22-14-5-1-12(2-6-14)20(25)19-17-10-9-16(24)11-18(17)26-21(19)13-3-7-15(23)8-4-13/h1-11,23-24H NWDHMXFJWJZLAD-UHFFFAOYSA-N 50662192 CHEMBL6147179 Phenazine biosynthesis protein PhzB 2 2600 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662192 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662192&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644069 Cc1cccc(C(=O)c2c(-c3ccc(O)cc3)sc3cc(O)ccc23)c1 InChI=1S/C22H16O3S/c1-13-3-2-4-15(11-13)21(25)20-18-10-9-17(24)12-19(18)26-22(20)14-5-7-16(23)8-6-14/h2-12,23-24H,1H3 KHYYYTBMVQFJSX-UHFFFAOYSA-N 50662193 CHEMBL6144626 Phenazine biosynthesis protein PhzB 2 7200 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662193 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662193&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644070 CC(C)c1cccc(C(=O)c2c(-c3ccc(O)cc3)sc3cc(O)ccc23)c1 InChI=1S/C24H20O3S/c1-14(2)16-4-3-5-17(12-16)23(27)22-20-11-10-19(26)13-21(20)28-24(22)15-6-8-18(25)9-7-15/h3-14,25-26H,1-2H3 MHSKHVGZTKCKMM-UHFFFAOYSA-N 50662194 CHEMBL6162888 Phenazine biosynthesis protein PhzB 2 900 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662194 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662194&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644071 O=C(c1cccc(F)c1)c1c(-c2ccc(O)cc2)sc2cc(O)ccc12 InChI=1S/C21H13FO3S/c22-14-3-1-2-13(10-14)20(25)19-17-9-8-16(24)11-18(17)26-21(19)12-4-6-15(23)7-5-12/h1-11,23-24H XJWZBTPEXWQFSX-UHFFFAOYSA-N 50662195 CHEMBL6173709 Phenazine biosynthesis protein PhzB 2 28300 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662195 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662195&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644072 O=C(c1cccc(Br)c1)c1c(-c2ccc(O)cc2)sc2cc(O)ccc12 InChI=1S/C21H13BrO3S/c22-14-3-1-2-13(10-14)20(25)19-17-9-8-16(24)11-18(17)26-21(19)12-4-6-15(23)7-5-12/h1-11,23-24H FZTODPPHGNNGPG-UHFFFAOYSA-N 50662196 CHEMBL6159945 Phenazine biosynthesis protein PhzB 2 2600 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662196 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662196&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644073 O=C(c1cccc(O)c1)c1c(-c2ccc(O)cc2)sc2cc(O)ccc12 InChI=1S/C21H14O4S/c22-14-6-4-12(5-7-14)21-19(17-9-8-16(24)11-18(17)26-21)20(25)13-2-1-3-15(23)10-13/h1-11,22-24H DWFBIALOCDMBGC-UHFFFAOYSA-N 50662197 CHEMBL6169578 Phenazine biosynthesis protein PhzB 2 127000 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662197 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662197&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644074 Cc1ccccc1C(=O)c1c(-c2ccc(O)cc2)sc2cc(O)ccc12 InChI=1S/C22H16O3S/c1-13-4-2-3-5-17(13)21(25)20-18-11-10-16(24)12-19(18)26-22(20)14-6-8-15(23)9-7-14/h2-12,23-24H,1H3 ZBJDRNQKVKGEDQ-UHFFFAOYSA-N 50662198 CHEMBL6165150 Phenazine biosynthesis protein PhzB 2 29900 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662198 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662198&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644075 O=C(c1ccccc1F)c1c(-c2ccc(O)cc2)sc2cc(O)ccc12 InChI=1S/C21H13FO3S/c22-17-4-2-1-3-15(17)20(25)19-16-10-9-14(24)11-18(16)26-21(19)12-5-7-13(23)8-6-12/h1-11,23-24H WKRKWVWOXGJDFF-UHFFFAOYSA-N 50662199 CHEMBL6165843 Phenazine biosynthesis protein PhzB 2 30700 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662199 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662199&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644076 CCCNc1ccc(C(=O)c2c(-c3ccc(O)cc3)sc3cc(O)ccc23)cc1 InChI=1S/C24H21NO3S/c1-2-13-25-17-7-3-15(4-8-17)23(28)22-20-12-11-19(27)14-21(20)29-24(22)16-5-9-18(26)10-6-16/h3-12,14,25-27H,2,13H2,1H3 GIGLPXYZZURWTH-UHFFFAOYSA-N 50662200 CHEMBL6161269 Phenazine biosynthesis protein PhzB 2 3100 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662200 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662200&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644077 CC(C)CNc1ccc(C(=O)c2c(-c3ccc(O)cc3)sc3cc(O)ccc23)cc1 InChI=1S/C25H23NO3S/c1-15(2)14-26-18-7-3-16(4-8-18)24(29)23-21-12-11-20(28)13-22(21)30-25(23)17-5-9-19(27)10-6-17/h3-13,15,26-28H,14H2,1-2H3 JMCBHNOVOWCEBO-UHFFFAOYSA-N 50662201 CHEMBL6161553 Phenazine biosynthesis protein PhzB 2 3900 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662201 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662201&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644078 CCCCCNc1ccc(C(=O)c2c(-c3ccc(O)cc3)sc3cc(O)ccc23)cc1 InChI=1S/C26H25NO3S/c1-2-3-4-15-27-19-9-5-17(6-10-19)25(30)24-22-14-13-21(29)16-23(22)31-26(24)18-7-11-20(28)12-8-18/h5-14,16,27-29H,2-4,15H2,1H3 HMCPYYVXVGDLFI-UHFFFAOYSA-N 50662202 CHEMBL6151909 Phenazine biosynthesis protein PhzB 2 3000 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662202 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662202&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644079 CCCNc1ccccc1C(=O)c1c(-c2ccc(O)cc2)sc2cc(O)ccc12 InChI=1S/C24H21NO3S/c1-2-13-25-20-6-4-3-5-18(20)23(28)22-19-12-11-17(27)14-21(19)29-24(22)15-7-9-16(26)10-8-15/h3-12,14,25-27H,2,13H2,1H3 NVULFGKZTMAKQL-UHFFFAOYSA-N 50662203 CHEMBL6173293 Phenazine biosynthesis protein PhzB 2 6100 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662203 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662203&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644080 CC(C)CNc1ccccc1C(=O)c1c(-c2ccc(O)cc2)sc2cc(O)ccc12 InChI=1S/C25H23NO3S/c1-15(2)14-26-21-6-4-3-5-19(21)24(29)23-20-12-11-18(28)13-22(20)30-25(23)16-7-9-17(27)10-8-16/h3-13,15,26-28H,14H2,1-2H3 LHXIHNYBKAUCPW-UHFFFAOYSA-N 50662204 CHEMBL6149520 Phenazine biosynthesis protein PhzB 2 14100 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662204 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662204&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644081 CCCCCNc1ccccc1C(=O)c1c(-c2ccc(O)cc2)sc2cc(O)ccc12 InChI=1S/C26H25NO3S/c1-2-3-6-15-27-22-8-5-4-7-20(22)25(30)24-21-14-13-19(29)16-23(21)31-26(24)17-9-11-18(28)12-10-17/h4-5,7-14,16,27-29H,2-3,6,15H2,1H3 QLXXWGOUYKVOIV-UHFFFAOYSA-N 50662205 CHEMBL6150746 Phenazine biosynthesis protein PhzB 2 6900 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662205 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662205&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644082 O=C(c1ccccc1NCCN1CCOCC1)c1c(-c2ccc(O)cc2)sc2cc(O)ccc12 InChI=1S/C27H26N2O4S/c30-19-7-5-18(6-8-19)27-25(22-10-9-20(31)17-24(22)34-27)26(32)21-3-1-2-4-23(21)28-11-12-29-13-15-33-16-14-29/h1-10,17,28,30-31H,11-16H2 RXOCKHFCIVFNLT-UHFFFAOYSA-N 50662206 CHEMBL6168101 Phenazine biosynthesis protein PhzB 2 122000 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662206 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662206&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644083 O=C(c1ccc(O)cc1)c1c(-c2ccc(O)cc2)sc2cc(O)ccc12 InChI=1S/C21H14O4S/c22-14-5-1-12(2-6-14)20(25)19-17-10-9-16(24)11-18(17)26-21(19)13-3-7-15(23)8-4-13/h1-11,22-24H CTMKIRXPVZYQJP-UHFFFAOYSA-N 50662207 CHEMBL3754181 Phenazine biosynthesis protein PhzB 2 21700 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662207 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662207&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644084 CCCCCOc1ccc(C(=O)c2c(-c3ccc(O)cc3)sc3cc(O)ccc23)cc1 InChI=1S/C26H24O4S/c1-2-3-4-15-30-21-12-7-17(8-13-21)25(29)24-22-14-11-20(28)16-23(22)31-26(24)18-5-9-19(27)10-6-18/h5-14,16,27-28H,2-4,15H2,1H3 HGJWLKWZXSAQCN-UHFFFAOYSA-N 50662208 CHEMBL6150665 Phenazine biosynthesis protein PhzB 2 2800 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662208 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662208&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644085 O=C(c1ccccc1O)c1c(-c2ccc(O)cc2)sc2cc(O)ccc12 InChI=1S/C21H14O4S/c22-13-7-5-12(6-8-13)21-19(16-10-9-14(23)11-18(16)26-21)20(25)15-3-1-2-4-17(15)24/h1-11,22-24H OQGOSHZJAKDQGK-UHFFFAOYSA-N 50662209 CHEMBL6174027 Phenazine biosynthesis protein PhzB 2 30600 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662209 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662209&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644086 COc1ccccc1C(=O)c1c(-c2ccc(O)cc2)sc2cc(O)ccc12 InChI=1S/C22H16O4S/c1-26-18-5-3-2-4-16(18)21(25)20-17-11-10-15(24)12-19(17)27-22(20)13-6-8-14(23)9-7-13/h2-12,23-24H,1H3 YHIDGDXKNDYPLM-UHFFFAOYSA-N 50662210 CHEMBL6164186 Phenazine biosynthesis protein PhzB 2 54600 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662210 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662210&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644087 CC(C)COc1ccccc1C(=O)c1c(-c2ccc(O)cc2)sc2cc(O)ccc12 InChI=1S/C25H22O4S/c1-15(2)14-29-21-6-4-3-5-19(21)24(28)23-20-12-11-18(27)13-22(20)30-25(23)16-7-9-17(26)10-8-16/h3-13,15,26-27H,14H2,1-2H3 DFWGKQXTMLWNBZ-UHFFFAOYSA-N 50662211 CHEMBL6171420 Phenazine biosynthesis protein PhzB 2 20700 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662211 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662211&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644088 CCCCCOc1ccccc1C(=O)c1c(-c2ccc(O)cc2)sc2cc(O)ccc12 InChI=1S/C26H24O4S/c1-2-3-6-15-30-22-8-5-4-7-20(22)25(29)24-21-14-13-19(28)16-23(21)31-26(24)17-9-11-18(27)12-10-17/h4-5,7-14,16,27-28H,2-3,6,15H2,1H3 QWWXMGJMAIOCHG-UHFFFAOYSA-N 50662212 CHEMBL6148255 Phenazine biosynthesis protein PhzB 2 19100 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662212 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662212&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644089 O=C(c1c(-c2ccc(O)cc2)sc2cc(O)ccc12)C1CCCC1 InChI=1S/C20H18O3S/c21-14-7-5-13(6-8-14)20-18(19(23)12-3-1-2-4-12)16-10-9-15(22)11-17(16)24-20/h5-12,21-22H,1-4H2 OKICETCVEMQBIM-UHFFFAOYSA-N 50662213 CHEMBL6152401 Phenazine biosynthesis protein PhzB 2 18100 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662213 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662213&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644090 O=C(c1c(-c2ccc(O)cc2)sc2cc(O)ccc12)C1CCCCC1 InChI=1S/C21H20O3S/c22-15-8-6-14(7-9-15)21-19(20(24)13-4-2-1-3-5-13)17-11-10-16(23)12-18(17)25-21/h6-13,22-23H,1-5H2 NUUDUIQPJQCRRH-UHFFFAOYSA-N 50662214 CHEMBL6149631 Phenazine biosynthesis protein PhzB 2 7600 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662214 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662214&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644091 CCCCCC(=O)c1c(-c2ccc(O)cc2)sc2cc(O)ccc12 InChI=1S/C20H20O3S/c1-2-3-4-5-17(23)19-16-11-10-15(22)12-18(16)24-20(19)13-6-8-14(21)9-7-13/h6-12,21-22H,2-5H2,1H3 SPNMICFWLIQOEM-UHFFFAOYSA-N 50662215 CHEMBL6149289 Phenazine biosynthesis protein PhzB 2 5300 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662215 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662215&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644092 O=C(c1ccc(Cl)cc1)c1c(-c2ccc(O)cc2)sc2ccccc12 InChI=1S/C21H13ClO2S/c22-15-9-5-13(6-10-15)20(24)19-17-3-1-2-4-18(17)25-21(19)14-7-11-16(23)12-8-14/h1-12,23H HTZYRZQECOXVQX-UHFFFAOYSA-N 50662216 CHEMBL6165805 Phenazine biosynthesis protein PhzB 2 4200 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662216 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662216&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644093 O=C(c1ccc(Cl)cc1)c1c(-c2ccccc2)sc2cc(O)ccc12 InChI=1S/C21H13ClO2S/c22-15-8-6-13(7-9-15)20(24)19-17-11-10-16(23)12-18(17)25-21(19)14-4-2-1-3-5-14/h1-12,23H HKHKKZZFJJXUGK-UHFFFAOYSA-N 50662217 CHEMBL6165774 Phenazine biosynthesis protein PhzB 2 13400 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662217 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662217&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644094 O=C(c1cccc(Br)c1)c1c(-c2ccc(O)cc2)sc2ccccc12 InChI=1S/C21H13BrO2S/c22-15-5-3-4-14(12-15)20(24)19-17-6-1-2-7-18(17)25-21(19)13-8-10-16(23)11-9-13/h1-12,23H UYXBIBXHCJINDT-UHFFFAOYSA-N 50662218 CHEMBL6170434 Phenazine biosynthesis protein PhzB 2 3200 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662218 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662218&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644095 O=C(c1cccc(Br)c1)c1c(-c2ccccc2)sc2cc(O)ccc12 InChI=1S/C21H13BrO2S/c22-15-8-4-7-14(11-15)20(24)19-17-10-9-16(23)12-18(17)25-21(19)13-5-2-1-3-6-13/h1-12,23H DBMFVTRWJKBRGN-UHFFFAOYSA-N 50662219 CHEMBL6168811 Phenazine biosynthesis protein PhzB 2 7800 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662219 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50005117&target=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662219&enzyme=Phenazine+biosynthesis+protein+PhzB+2&column=ki&startPg=0&Increment=50&submit=Search 1 MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT 3FF0 Phenazine biosynthesis protein PhzB 2 PHZB2_PSEAB Q02L47 51644096 Oc1ccc(cc1)-c1sc2cc(O)ccc2c1C(=O)c1ccc(OCCN2CCCCC2)cc1 InChI=1S/C28H27NO4S/c30-21-8-4-20(5-9-21)28-26(24-13-10-22(31)18-25(24)34-28)27(32)19-6-11-23(12-7-19)33-17-16-29-14-2-1-3-15-29/h4-13,18,30-31H,1-3,14-17H2 GZUITABIAKMVPG-UHFFFAOYSA-N 19441 Evista::CHEMBL81::Keoxifene::Raloxifene, 6::RALOXIFENE HYDROCHLORIDE::[6-hydroxy-2-(4-hydroxyphenyl)-1-benzothiophen-3-yl]-[4-(2-piperidin-1-ylethoxy)phenyl]methanone::2-(4-hydroxyphenyl)-3-({4-[2-(piperidin-1-yl)ethoxy]phenyl}carbonyl)-1-benzothiophen-6-ol::cid_11071264::Raloxifene::Raloxifene (7) Estrogen receptor Homo sapiens 1.4 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=19441 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=369&target=Estrogen+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=19441&enzyme=Estrogen+receptor&column=ki&startPg=0&Increment=50&submit=Search 5035 46519463 CHEMBL81 DB00481 C07228 1 MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV 3ERT,3ERD,1R5K,1L2I,2IOK,2OUZ,1ERR,1ERE,3DT3,2YJA,3L03,3HM1,3HLV,3UUC,1QKU Estrogen receptor ESR1_HUMAN P03372 Q13511 Q14276 Q5T5H7 Q6MZQ9 Q9NU51 Q9UDZ7 Q9UIS7 51644097 O=C(c1ccc(Cl)cc1)c1c(-c2ccc(O)cc2)sc2cc(O)ccc12 InChI=1S/C21H13ClO3S/c22-14-5-1-12(2-6-14)20(25)19-17-10-9-16(24)11-18(17)26-21(19)13-3-7-15(23)8-4-13/h1-11,23-24H MAHGILUQSRQUDZ-UHFFFAOYSA-N 50662191 CHEMBL6151266 Estrogen receptor Homo sapiens 0.180000 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662191 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=369&target=Estrogen+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662191&enzyme=Estrogen+receptor&column=ki&startPg=0&Increment=50&submit=Search 1 MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV 3ERT,3ERD,1R5K,1L2I,2IOK,2OUZ,1ERR,1ERE,3DT3,2YJA,3L03,3HM1,3HLV,3UUC,1QKU Estrogen receptor ESR1_HUMAN P03372 Q13511 Q14276 Q5T5H7 Q6MZQ9 Q9NU51 Q9UDZ7 Q9UIS7 51644098 O=C(c1cccc(Br)c1)c1c(-c2ccc(O)cc2)sc2cc(O)ccc12 InChI=1S/C21H13BrO3S/c22-14-3-1-2-13(10-14)20(25)19-17-9-8-16(24)11-18(17)26-21(19)12-4-6-15(23)7-5-12/h1-11,23-24H FZTODPPHGNNGPG-UHFFFAOYSA-N 50662196 CHEMBL6159945 Estrogen receptor Homo sapiens 0.250000 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662196 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=369&target=Estrogen+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662196&enzyme=Estrogen+receptor&column=ki&startPg=0&Increment=50&submit=Search 1 MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV 3ERT,3ERD,1R5K,1L2I,2IOK,2OUZ,1ERR,1ERE,3DT3,2YJA,3L03,3HM1,3HLV,3UUC,1QKU Estrogen receptor ESR1_HUMAN P03372 Q13511 Q14276 Q5T5H7 Q6MZQ9 Q9NU51 Q9UDZ7 Q9UIS7 51644099 O=C(c1ccc(Cl)cc1)c1c(-c2ccc(O)cc2)sc2ccccc12 InChI=1S/C21H13ClO2S/c22-15-9-5-13(6-10-15)20(24)19-17-3-1-2-4-18(17)25-21(19)14-7-11-16(23)12-8-14/h1-12,23H HTZYRZQECOXVQX-UHFFFAOYSA-N 50662216 CHEMBL6165805 Estrogen receptor Homo sapiens 40 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662216 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=369&target=Estrogen+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662216&enzyme=Estrogen+receptor&column=ki&startPg=0&Increment=50&submit=Search 1 MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV 3ERT,3ERD,1R5K,1L2I,2IOK,2OUZ,1ERR,1ERE,3DT3,2YJA,3L03,3HM1,3HLV,3UUC,1QKU Estrogen receptor ESR1_HUMAN P03372 Q13511 Q14276 Q5T5H7 Q6MZQ9 Q9NU51 Q9UDZ7 Q9UIS7 51644100 O=C(c1ccc(Cl)cc1)c1c(-c2ccccc2)sc2cc(O)ccc12 InChI=1S/C21H13ClO2S/c22-15-8-6-13(7-9-15)20(24)19-17-11-10-16(23)12-18(17)25-21(19)14-4-2-1-3-5-14/h1-12,23H HKHKKZZFJJXUGK-UHFFFAOYSA-N 50662217 CHEMBL6165774 Estrogen receptor Homo sapiens 1.9 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662217 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=369&target=Estrogen+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662217&enzyme=Estrogen+receptor&column=ki&startPg=0&Increment=50&submit=Search 1 MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV 3ERT,3ERD,1R5K,1L2I,2IOK,2OUZ,1ERR,1ERE,3DT3,2YJA,3L03,3HM1,3HLV,3UUC,1QKU Estrogen receptor ESR1_HUMAN P03372 Q13511 Q14276 Q5T5H7 Q6MZQ9 Q9NU51 Q9UDZ7 Q9UIS7 51644101 O=C(c1cccc(Br)c1)c1c(-c2ccc(O)cc2)sc2ccccc12 InChI=1S/C21H13BrO2S/c22-15-5-3-4-14(12-15)20(24)19-17-6-1-2-7-18(17)25-21(19)13-8-10-16(23)11-9-13/h1-12,23H UYXBIBXHCJINDT-UHFFFAOYSA-N 50662218 CHEMBL6170434 Estrogen receptor Homo sapiens 82 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662218 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=369&target=Estrogen+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662218&enzyme=Estrogen+receptor&column=ki&startPg=0&Increment=50&submit=Search 1 MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV 3ERT,3ERD,1R5K,1L2I,2IOK,2OUZ,1ERR,1ERE,3DT3,2YJA,3L03,3HM1,3HLV,3UUC,1QKU Estrogen receptor ESR1_HUMAN P03372 Q13511 Q14276 Q5T5H7 Q6MZQ9 Q9NU51 Q9UDZ7 Q9UIS7 51644102 O=C(c1cccc(Br)c1)c1c(-c2ccccc2)sc2cc(O)ccc12 InChI=1S/C21H13BrO2S/c22-15-8-4-7-14(11-15)20(24)19-17-10-9-16(23)12-18(17)25-21(19)13-5-2-1-3-6-13/h1-12,23H DBMFVTRWJKBRGN-UHFFFAOYSA-N 50662219 CHEMBL6168811 Estrogen receptor Homo sapiens 13 ChEMBL 10.7270/Q2GH9PWG 40156840 Thiemann, M; Zimmermann, M; Diederich, C; Zhan, H; Lebedev, M; Pletz, J; Baumgarten, J; Handke, M; Müsken, M; Breinbauer, R; Krasteva-Christ, G; Zanin, E; Empting, M; Schiedel, M; Kunick, C; Blankenfeldt, W //0 6/5/2026 Technische Universitat Braunschweig http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50662219 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=369&target=Estrogen+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50662219&enzyme=Estrogen+receptor&column=ki&startPg=0&Increment=50&submit=Search 1 MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV 3ERT,3ERD,1R5K,1L2I,2IOK,2OUZ,1ERR,1ERE,3DT3,2YJA,3L03,3HM1,3HLV,3UUC,1QKU Estrogen receptor ESR1_HUMAN P03372 Q13511 Q14276 Q5T5H7 Q6MZQ9 Q9NU51 Q9UDZ7 Q9UIS7