BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
51635306	c1c[nH]cn1	InChI=1S/C3H4N2/c1-2-5-3-4-1/h1-3H,(H,4,5)	RAXXELZNTBOGNW-UHFFFAOYSA-N	7882	CHEMBL540::1H-imidazole::imidazole::Imidazole (Im)::US9138393, Imidazole::US9144538, Imidazole	Glutaminyl-peptide cyclotransferase	Homo sapiens	 103000								ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7882	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7882&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search			795	11108645		CHEMBL540			C01589		1	MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL	9UD7,9U64,9ISD,8XGB,9LZV,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0	Glutaminyl-peptide cyclotransferase	QPCT_HUMAN	Q16769	Q16770 Q3KRG6 Q53TR4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635307	c1ccc2[nH]cnc2c1	InChI=1S/C7H6N2/c1-2-4-7-6(3-1)8-5-9-7/h1-5H,(H,8,9)	HYZJCKYKOHLVJF-UHFFFAOYSA-N	7939	1H-1,3-benzodiazole::Benzimidazole::Benzimidazole (Blm)::US9138393, Benzimidazole::US9144538, Benzimidazole	Glutaminyl-peptide cyclotransferase	Homo sapiens	 138000								ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7939	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7939&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search	BZI	1KXM,1L5F,1RYC,4DSU,4HPX,4NVE,4XV5,4XVA,5K1L,5PHK,6X0C,7KXC,7KYT,7LGX,7MT6,9BLV,9BNJ	5798	11108701					C02009		1	MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL	9UD7,9U64,9ISD,8XGB,9LZV,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0	Glutaminyl-peptide cyclotransferase	QPCT_HUMAN	Q16769	Q16770 Q3KRG6 Q53TR4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635308	Cn1ccnc1	InChI=1S/C4H6N2/c1-6-3-2-5-4-6/h2-4H,1H3	MCTWTZJPVLRJOU-UHFFFAOYSA-N	7884	1-methyl-1H-imidazole::US9138393, 1-Methylimidazole::US9144538, 1-Methylimidazole	Glutaminyl-peptide cyclotransferase	Homo sapiens	 30000								ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7884	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7884&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search			1390	11108646							1	MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL	9UD7,9U64,9ISD,8XGB,9LZV,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0	Glutaminyl-peptide cyclotransferase	QPCT_HUMAN	Q16769	Q16770 Q3KRG6 Q53TR4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635309	c1ccc(cc1)Cn2ccnc2	InChI=1S/C10H10N2/c1-2-4-10(5-3-1)8-12-7-6-11-9-12/h1-7,9H,8H2	KKKDZZRICRFGSD-UHFFFAOYSA-N	7887	1-benzylimidazole::1-Benzylimidazole (BI)::CHEMBL14192::1-benzyl-1H-imidazole::US9138393, 1-benzylimidazole	Glutaminyl-peptide cyclotransferase	Homo sapiens	 7100								ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7887	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7887&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search	1BN	2AFX,3PB9,5S8M,7D1D	77918	11108649		CHEMBL14192	DB04581				1	MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL	9UD7,9U64,9ISD,8XGB,9LZV,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0	Glutaminyl-peptide cyclotransferase	QPCT_HUMAN	Q16769	Q16770 Q3KRG6 Q53TR4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635310	CC(=O)NCCc1c[nH]cn1	InChI=1S/C7H11N3O/c1-6(11)9-3-2-7-4-8-5-10-7/h4-5H,2-3H2,1H3,(H,8,10)(H,9,11)	XJWPISBUKWZALE-UHFFFAOYSA-N	50658205	CHEMBL1230893	Glutaminyl-peptide cyclotransferase	Homo sapiens	 1700								ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50658205	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50658205&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search			69602	528504900							1	MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL	9UD7,9U64,9ISD,8XGB,9LZV,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0	Glutaminyl-peptide cyclotransferase	QPCT_HUMAN	Q16769	Q16770 Q3KRG6 Q53TR4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635311	COc1ccc(cc1OC)NC(=S)NCCCn2ccnc2	InChI=1S/C15H20N4O2S/c1-20-13-5-4-12(10-14(13)21-2)18-15(22)17-6-3-8-19-9-7-16-11-19/h4-5,7,9-11H,3,6,8H2,1-2H3,(H2,17,18,22)	FZQXMGLQANXZRP-UHFFFAOYSA-N	7918	PBD150::1-(3-(1H-Imidazol-1-yl)propyl)-3-(3,4-dimethoxyphenyl)thiourea::1-(3,4-dimethoxyphenyl)-3-[3-(1H-imidazol-1-yl)propyl]thiourea::1-alkylimidazole thiourea deriv. 53	Glutaminyl-peptide cyclotransferase	Homo sapiens	 95000								ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7918	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7918&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search	PBD	3PB7,3PBB,3SI2,4F9U,4F9V,4FAI,4FBE,4MHY,4MHZ,4YWY,9FXJ	6539196	11108680							1	MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL	9UD7,9U64,9ISD,8XGB,9LZV,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0	Glutaminyl-peptide cyclotransferase	QPCT_HUMAN	Q16769	Q16770 Q3KRG6 Q53TR4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635312	CCCOc1ccc(C2C(=O)NC(=O)N2c2ccc3[nH]cnc3c2)cc1	InChI=1S/C19H18N4O3/c1-2-9-26-14-6-3-12(4-7-14)17-18(24)22-19(25)23(17)13-5-8-15-16(10-13)21-11-20-15/h3-8,10-11,17H,2,9H2,1H3,(H,20,21)(H,22,24,25)	GTFPAKYEYXNXOT-UHFFFAOYSA-N	149363	US8962860, 6	Glutaminyl-peptide cyclotransferase	Homo sapiens	 38								ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=149363	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=149363&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search			46174642	252149318							1	MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL	9UD7,9U64,9ISD,8XGB,9LZV,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0	Glutaminyl-peptide cyclotransferase	QPCT_HUMAN	Q16769	Q16770 Q3KRG6 Q53TR4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635313	CCCOc1ccc([C@H]2CNC(=O)N2c2ccc3[nH]cnc3c2)cc1	InChI=1S/C19H20N4O2/c1-2-9-25-15-6-3-13(4-7-15)18-11-20-19(24)23(18)14-5-8-16-17(10-14)22-12-21-16/h3-8,10,12,18H,2,9,11H2,1H3,(H,20,24)(H,21,22)	XHIKZWOEFZENIX-UHFFFAOYSA-N	308046	US9650362, 14::(S)-1-(1H- benzo[d]imidazol-5-yl)-5-(4- propoxyphenyl)imidazolidin- 2-one	Glutaminyl-peptide cyclotransferase	Homo sapiens	 29								ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=308046	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=308046&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search			51030870	382364118							1	MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL	9UD7,9U64,9ISD,8XGB,9LZV,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0	Glutaminyl-peptide cyclotransferase	QPCT_HUMAN	Q16769	Q16770 Q3KRG6 Q53TR4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635314	O=C1C[C@H](c2c(F)cc(OCCC(F)F)cc2F)N1c1ccc2[nH]cnc2c1	InChI=1S/C19H15F4N3O2/c20-12-6-11(28-4-3-17(22)23)7-13(21)19(12)16-8-18(27)26(16)10-1-2-14-15(5-10)25-9-24-14/h1-2,5-7,9,16-17H,3-4,8H2,(H,24,25)	GURVAWDLVHIGNH-UHFFFAOYSA-N	637687	US11834440, Compound RF-1B	Glutaminyl-peptide cyclotransferase	Homo sapiens	 2.4								ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=637687	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=637687&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search			138503585	486503265							1	MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL	9UD7,9U64,9ISD,8XGB,9LZV,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0	Glutaminyl-peptide cyclotransferase	QPCT_HUMAN	Q16769	Q16770 Q3KRG6 Q53TR4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635315	CCCOc1ccc(C2c3c(nn(C)c3C)C(=O)N2c2ccc3[nH]cnc3c2)c(F)c1	InChI=1S/C23H22FN5O2/c1-4-9-31-15-6-7-16(17(24)11-15)22-20-13(2)28(3)27-21(20)23(30)29(22)14-5-8-18-19(10-14)26-12-25-18/h5-8,10-12,22H,4,9H2,1-3H3,(H,25,26)	JCVCXIDCZJOENC-UHFFFAOYSA-N	50658206	CHEMBL6152981	Glutaminyl-peptide cyclotransferase	Homo sapiens	<100								ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50658206	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50658206&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search			155576705	528504901							1	MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL	9UD7,9U64,9ISD,8XGB,9LZV,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0	Glutaminyl-peptide cyclotransferase	QPCT_HUMAN	Q16769	Q16770 Q3KRG6 Q53TR4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635316	c1c[nH]cn1	InChI=1S/C3H4N2/c1-2-5-3-4-1/h1-3H,(H,4,5)	RAXXELZNTBOGNW-UHFFFAOYSA-N	7882	CHEMBL540::1H-imidazole::imidazole::Imidazole (Im)::US9138393, Imidazole::US9144538, Imidazole	Glutaminyl-peptide cyclotransferase-like protein	Homo sapiens	 219000								ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7882	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6339&target=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7882&enzyme=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search			795	11108645		CHEMBL540			C01589		1	MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLIGSLPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKFLEATLRSLTAGWHVELDPFTASTPLGPVDFGNVVATLDPRAARHLTLACHYDSKLFPPGSTPFVGATDSAVPCALLLELAQALDLELSRAKKQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL	3PB9,3PB8,3PB7,3PB6,3PB4,8XGA,8XFV	Glutaminyl-peptide cyclotransferase-like protein	QPCTL_HUMAN	Q9NXS2	Q53HE4 Q96F74																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635317	c1ccc2[nH]cnc2c1	InChI=1S/C7H6N2/c1-2-4-7-6(3-1)8-5-9-7/h1-5H,(H,8,9)	HYZJCKYKOHLVJF-UHFFFAOYSA-N	7939	1H-1,3-benzodiazole::Benzimidazole::Benzimidazole (Blm)::US9138393, Benzimidazole::US9144538, Benzimidazole	Glutaminyl-peptide cyclotransferase-like protein	Homo sapiens	 199000								ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7939	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6339&target=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7939&enzyme=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search	BZI	1KXM,1L5F,1RYC,4DSU,4HPX,4NVE,4XV5,4XVA,5K1L,5PHK,6X0C,7KXC,7KYT,7LGX,7MT6,9BLV,9BNJ	5798	11108701					C02009		1	MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLIGSLPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKFLEATLRSLTAGWHVELDPFTASTPLGPVDFGNVVATLDPRAARHLTLACHYDSKLFPPGSTPFVGATDSAVPCALLLELAQALDLELSRAKKQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL	3PB9,3PB8,3PB7,3PB6,3PB4,8XGA,8XFV	Glutaminyl-peptide cyclotransferase-like protein	QPCTL_HUMAN	Q9NXS2	Q53HE4 Q96F74																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635318	Cn1ccnc1	InChI=1S/C4H6N2/c1-6-3-2-5-4-6/h2-4H,1H3	MCTWTZJPVLRJOU-UHFFFAOYSA-N	7884	1-methyl-1H-imidazole::US9138393, 1-Methylimidazole::US9144538, 1-Methylimidazole	Glutaminyl-peptide cyclotransferase-like protein	Homo sapiens	 79000								ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7884	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6339&target=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7884&enzyme=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search			1390	11108646							1	MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLIGSLPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKFLEATLRSLTAGWHVELDPFTASTPLGPVDFGNVVATLDPRAARHLTLACHYDSKLFPPGSTPFVGATDSAVPCALLLELAQALDLELSRAKKQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL	3PB9,3PB8,3PB7,3PB6,3PB4,8XGA,8XFV	Glutaminyl-peptide cyclotransferase-like protein	QPCTL_HUMAN	Q9NXS2	Q53HE4 Q96F74																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635319	c1ccc(cc1)Cn2ccnc2	InChI=1S/C10H10N2/c1-2-4-10(5-3-1)8-12-7-6-11-9-12/h1-7,9H,8H2	KKKDZZRICRFGSD-UHFFFAOYSA-N	7887	1-benzylimidazole::1-Benzylimidazole (BI)::CHEMBL14192::1-benzyl-1H-imidazole::US9138393, 1-benzylimidazole	Glutaminyl-peptide cyclotransferase-like protein	Homo sapiens	 7300								ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7887	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6339&target=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7887&enzyme=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search	1BN	2AFX,3PB9,5S8M,7D1D	77918	11108649		CHEMBL14192	DB04581				1	MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLIGSLPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKFLEATLRSLTAGWHVELDPFTASTPLGPVDFGNVVATLDPRAARHLTLACHYDSKLFPPGSTPFVGATDSAVPCALLLELAQALDLELSRAKKQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL	3PB9,3PB8,3PB7,3PB6,3PB4,8XGA,8XFV	Glutaminyl-peptide cyclotransferase-like protein	QPCTL_HUMAN	Q9NXS2	Q53HE4 Q96F74																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635320	CC(=O)NCCc1c[nH]cn1	InChI=1S/C7H11N3O/c1-6(11)9-3-2-7-4-8-5-10-7/h4-5H,2-3H2,1H3,(H,8,10)(H,9,11)	XJWPISBUKWZALE-UHFFFAOYSA-N	50658205	CHEMBL1230893	Glutaminyl-peptide cyclotransferase-like protein	Homo sapiens	 5700								ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50658205	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6339&target=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50658205&enzyme=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search			69602	528504900							1	MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLIGSLPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKFLEATLRSLTAGWHVELDPFTASTPLGPVDFGNVVATLDPRAARHLTLACHYDSKLFPPGSTPFVGATDSAVPCALLLELAQALDLELSRAKKQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL	3PB9,3PB8,3PB7,3PB6,3PB4,8XGA,8XFV	Glutaminyl-peptide cyclotransferase-like protein	QPCTL_HUMAN	Q9NXS2	Q53HE4 Q96F74																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635321	COc1ccc(cc1OC)NC(=S)NCCCn2ccnc2	InChI=1S/C15H20N4O2S/c1-20-13-5-4-12(10-14(13)21-2)18-15(22)17-6-3-8-19-9-7-16-11-19/h4-5,7,9-11H,3,6,8H2,1-2H3,(H2,17,18,22)	FZQXMGLQANXZRP-UHFFFAOYSA-N	7918	PBD150::1-(3-(1H-Imidazol-1-yl)propyl)-3-(3,4-dimethoxyphenyl)thiourea::1-(3,4-dimethoxyphenyl)-3-[3-(1H-imidazol-1-yl)propyl]thiourea::1-alkylimidazole thiourea deriv. 53	Glutaminyl-peptide cyclotransferase-like protein	Homo sapiens	 1800								ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7918	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6339&target=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7918&enzyme=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search	PBD	3PB7,3PBB,3SI2,4F9U,4F9V,4FAI,4FBE,4MHY,4MHZ,4YWY,9FXJ	6539196	11108680							1	MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLIGSLPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKFLEATLRSLTAGWHVELDPFTASTPLGPVDFGNVVATLDPRAARHLTLACHYDSKLFPPGSTPFVGATDSAVPCALLLELAQALDLELSRAKKQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL	3PB9,3PB8,3PB7,3PB6,3PB4,8XGA,8XFV	Glutaminyl-peptide cyclotransferase-like protein	QPCTL_HUMAN	Q9NXS2	Q53HE4 Q96F74																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635322	O=C(NCCc1c[nH]cn1)C(=O)NCCc1c[nH]cn1	InChI=1S/C12H16N6O2/c19-11(15-3-1-9-5-13-7-17-9)12(20)16-4-2-10-6-14-8-18-10/h5-8H,1-4H2,(H,13,17)(H,14,18)(H,15,19)(H,16,20)	SRJWMAXOCIEGRK-UHFFFAOYSA-N	50658207	CHEMBL6144519	Glutaminyl-peptide cyclotransferase-like protein	Homo sapiens		 2700							ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50658207	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6339&target=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50658207&enzyme=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search			86566962	528504902							1	MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLIGSLPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKFLEATLRSLTAGWHVELDPFTASTPLGPVDFGNVVATLDPRAARHLTLACHYDSKLFPPGSTPFVGATDSAVPCALLLELAQALDLELSRAKKQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL	3PB9,3PB8,3PB7,3PB6,3PB4,8XGA,8XFV	Glutaminyl-peptide cyclotransferase-like protein	QPCTL_HUMAN	Q9NXS2	Q53HE4 Q96F74																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635323	O=C(NCCc1c[nH]cn1)c1cccc(C(=O)NCCc2c[nH]cn2)c1	InChI=1S/C18H20N6O2/c25-17(21-6-4-15-9-19-11-23-15)13-2-1-3-14(8-13)18(26)22-7-5-16-10-20-12-24-16/h1-3,8-12H,4-7H2,(H,19,23)(H,20,24)(H,21,25)(H,22,26)	ROSNIOAWJWZICE-UHFFFAOYSA-N	50658208	CHEMBL6147225	Glutaminyl-peptide cyclotransferase-like protein	Homo sapiens		 4700							ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50658208	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6339&target=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50658208&enzyme=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search			86567033	528504903							1	MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLIGSLPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKFLEATLRSLTAGWHVELDPFTASTPLGPVDFGNVVATLDPRAARHLTLACHYDSKLFPPGSTPFVGATDSAVPCALLLELAQALDLELSRAKKQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL	3PB9,3PB8,3PB7,3PB6,3PB4,8XGA,8XFV	Glutaminyl-peptide cyclotransferase-like protein	QPCTL_HUMAN	Q9NXS2	Q53HE4 Q96F74																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635324	O=C(CC(=O)NCCc1c[nH]cn1)NCCc1c[nH]cn1	InChI=1S/C13H18N6O2/c20-12(16-3-1-10-6-14-8-18-10)5-13(21)17-4-2-11-7-15-9-19-11/h6-9H,1-5H2,(H,14,18)(H,15,19)(H,16,20)(H,17,21)	MWORBFIKQWWKQH-UHFFFAOYSA-N	50658209	CHEMBL6144377	Glutaminyl-peptide cyclotransferase-like protein	Homo sapiens		 6300							ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50658209	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6339&target=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50658209&enzyme=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search			86566963	528504904							1	MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLIGSLPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKFLEATLRSLTAGWHVELDPFTASTPLGPVDFGNVVATLDPRAARHLTLACHYDSKLFPPGSTPFVGATDSAVPCALLLELAQALDLELSRAKKQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL	3PB9,3PB8,3PB7,3PB6,3PB4,8XGA,8XFV	Glutaminyl-peptide cyclotransferase-like protein	QPCTL_HUMAN	Q9NXS2	Q53HE4 Q96F74																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635325	O=C(NCCc1cnc[nH]1)c1ccc(C(=O)NCCc2cnc[nH]2)cc1	InChI=1S/C18H20N6O2/c25-17(21-7-5-15-9-19-11-23-15)13-1-2-14(4-3-13)18(26)22-8-6-16-10-20-12-24-16/h1-4,9-12H,5-8H2,(H,19,23)(H,20,24)(H,21,25)(H,22,26)	LNYCWKAPVGWLRX-UHFFFAOYSA-N	642195	US11845740, No X::US20240116898, No X	Glutaminyl-peptide cyclotransferase-like protein	Homo sapiens		 80							ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=642195	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6339&target=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=642195&enzyme=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search			146458550	488875056							1	MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLIGSLPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKFLEATLRSLTAGWHVELDPFTASTPLGPVDFGNVVATLDPRAARHLTLACHYDSKLFPPGSTPFVGATDSAVPCALLLELAQALDLELSRAKKQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL	3PB9,3PB8,3PB7,3PB6,3PB4,8XGA,8XFV	Glutaminyl-peptide cyclotransferase-like protein	QPCTL_HUMAN	Q9NXS2	Q53HE4 Q96F74																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635326	O=C1CCCC(=O)N1CCc1cnc[nH]1	InChI=1S/C10H13N3O2/c14-9-2-1-3-10(15)13(9)5-4-8-6-11-7-12-8/h6-7H,1-5H2,(H,11,12)	DYKZYSKWOHKZMF-UHFFFAOYSA-N	50658210	CHEMBL6145905	Glutaminyl-peptide cyclotransferase-like protein	Homo sapiens		 50900							ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50658210	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6339&target=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50658210&enzyme=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search			24826317	528504905							1	MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLIGSLPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKFLEATLRSLTAGWHVELDPFTASTPLGPVDFGNVVATLDPRAARHLTLACHYDSKLFPPGSTPFVGATDSAVPCALLLELAQALDLELSRAKKQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL	3PB9,3PB8,3PB7,3PB6,3PB4,8XGA,8XFV	Glutaminyl-peptide cyclotransferase-like protein	QPCTL_HUMAN	Q9NXS2	Q53HE4 Q96F74																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635327	Cn1cnnc1C1CCN(CC1)c1ncccc1-c1ccc(F)nc1	InChI=1S/C18H19FN6/c1-24-12-22-23-17(24)13-6-9-25(10-7-13)18-15(3-2-8-20-18)14-4-5-16(19)21-11-14/h2-5,8,11-13H,6-7,9-10H2,1H3	AJIAMIPUWJQSPR-UHFFFAOYSA-N	50519291	CHEMBL4462495::US20240059675, Compound SEN177::US20240101544, Example SEN177	Glutaminyl-peptide cyclotransferase-like protein	Homo sapiens		 13							ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50519291	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6339&target=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50519291&enzyme=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search			91618245	440727873							1	MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLIGSLPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKFLEATLRSLTAGWHVELDPFTASTPLGPVDFGNVVATLDPRAARHLTLACHYDSKLFPPGSTPFVGATDSAVPCALLLELAQALDLELSRAKKQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL	3PB9,3PB8,3PB7,3PB6,3PB4,8XGA,8XFV	Glutaminyl-peptide cyclotransferase-like protein	QPCTL_HUMAN	Q9NXS2	Q53HE4 Q96F74																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635328	Cn1cnnc1C1CCN(CC1)c1c(cccc1-c1ccc(F)nc1)C#N	InChI=1S/C20H19FN6/c1-26-13-24-25-20(26)14-7-9-27(10-8-14)19-15(11-22)3-2-4-17(19)16-5-6-18(21)23-12-16/h2-6,12-14H,7-10H2,1H3	LCDPXGBXYYBDQE-UHFFFAOYSA-N	661116	US20240101544, Example 1::US20240101544, Example 41::3-(6-fluoropyridin-3-yl)-2-[4-(4- methyl-4H-1,2,4-triazol-3-yl)piperidin- 1-yl]benzonitrile::US20240246981, Example 1	Glutaminyl-peptide cyclotransferase-like protein	Homo sapiens		 15							ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=661116	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6339&target=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=661116&enzyme=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search			169494341	496709599							1	MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLIGSLPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKFLEATLRSLTAGWHVELDPFTASTPLGPVDFGNVVATLDPRAARHLTLACHYDSKLFPPGSTPFVGATDSAVPCALLLELAQALDLELSRAKKQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL	3PB9,3PB8,3PB7,3PB6,3PB4,8XGA,8XFV	Glutaminyl-peptide cyclotransferase-like protein	QPCTL_HUMAN	Q9NXS2	Q53HE4 Q96F74																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635329	Cn1cncc1C1CCN(c2c(C#N)cccc2-c2ccc(F)nc2)CC1	InChI=1S/C21H20FN5/c1-26-14-24-13-19(26)15-7-9-27(10-8-15)21-16(11-23)3-2-4-18(21)17-5-6-20(22)25-12-17/h2-6,12-15H,7-10H2,1H3	IUBVPNGSCDYBJU-UHFFFAOYSA-N	50658211	CHEMBL6170024	Glutaminyl-peptide cyclotransferase-like protein	Homo sapiens		 3.8							ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50658211	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6339&target=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50658211&enzyme=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search											1	MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLIGSLPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKFLEATLRSLTAGWHVELDPFTASTPLGPVDFGNVVATLDPRAARHLTLACHYDSKLFPPGSTPFVGATDSAVPCALLLELAQALDLELSRAKKQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL	3PB9,3PB8,3PB7,3PB6,3PB4,8XGA,8XFV	Glutaminyl-peptide cyclotransferase-like protein	QPCTL_HUMAN	Q9NXS2	Q53HE4 Q96F74																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635330	Cc1ccc(-c2ccsc2)c(N2CCC(c3nnc(N)n3C)CC2)n1	InChI=1S/C18H22N6S/c1-12-3-4-15(14-7-10-25-11-14)17(20-12)24-8-5-13(6-9-24)16-21-22-18(19)23(16)2/h3-4,7,10-11,13H,5-6,8-9H2,1-2H3,(H2,19,22)	LAOMUGOGDCBALW-UHFFFAOYSA-N	50658212	CHEMBL6166405	Glutaminyl-peptide cyclotransferase-like protein	Homo sapiens		<1.000000							ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50658212	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6339&target=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50658212&enzyme=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search											1	MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLIGSLPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKFLEATLRSLTAGWHVELDPFTASTPLGPVDFGNVVATLDPRAARHLTLACHYDSKLFPPGSTPFVGATDSAVPCALLLELAQALDLELSRAKKQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL	3PB9,3PB8,3PB7,3PB6,3PB4,8XGA,8XFV	Glutaminyl-peptide cyclotransferase-like protein	QPCTL_HUMAN	Q9NXS2	Q53HE4 Q96F74																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635331	Cn1cnnc1C1(F)CCN(CC1)c1c(ccnc1-c1cnc2nn(cc2c1)C(C)(C)C)C#N	InChI=1S/C24H26FN9/c1-23(2,3)34-14-18-11-17(13-28-21(18)31-34)19-20(16(12-26)5-8-27-19)33-9-6-24(25,7-10-33)22-30-29-15-32(22)4/h5,8,11,13-15H,6-7,9-10H2,1-4H3	GUIGECLAWNMCPW-UHFFFAOYSA-N	652305	US20240059675, Example 8	Glutaminyl-peptide cyclotransferase-like protein	Homo sapiens		<1.000000							ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=652305	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6339&target=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=652305&enzyme=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search			170761999	494496458							1	MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLIGSLPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKFLEATLRSLTAGWHVELDPFTASTPLGPVDFGNVVATLDPRAARHLTLACHYDSKLFPPGSTPFVGATDSAVPCALLLELAQALDLELSRAKKQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL	3PB9,3PB8,3PB7,3PB6,3PB4,8XGA,8XFV	Glutaminyl-peptide cyclotransferase-like protein	QPCTL_HUMAN	Q9NXS2	Q53HE4 Q96F74																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635332	O=C(NCCc1c[nH]cn1)C(=O)NCCc1c[nH]cn1	InChI=1S/C12H16N6O2/c19-11(15-3-1-9-5-13-7-17-9)12(20)16-4-2-10-6-14-8-18-10/h5-8H,1-4H2,(H,13,17)(H,14,18)(H,15,19)(H,16,20)	SRJWMAXOCIEGRK-UHFFFAOYSA-N	50658207	CHEMBL6144519	Glutaminyl-peptide cyclotransferase	Homo sapiens		 1400							ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50658207	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50658207&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search			86566962	528504902							1	MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL	9UD7,9U64,9ISD,8XGB,9LZV,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0	Glutaminyl-peptide cyclotransferase	QPCT_HUMAN	Q16769	Q16770 Q3KRG6 Q53TR4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635333	O=C(NCCc1c[nH]cn1)c1cccc(C(=O)NCCc2c[nH]cn2)c1	InChI=1S/C18H20N6O2/c25-17(21-6-4-15-9-19-11-23-15)13-2-1-3-14(8-13)18(26)22-7-5-16-10-20-12-24-16/h1-3,8-12H,4-7H2,(H,19,23)(H,20,24)(H,21,25)(H,22,26)	ROSNIOAWJWZICE-UHFFFAOYSA-N	50658208	CHEMBL6147225	Glutaminyl-peptide cyclotransferase	Homo sapiens		 2900							ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50658208	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50658208&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search			86567033	528504903							1	MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL	9UD7,9U64,9ISD,8XGB,9LZV,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0	Glutaminyl-peptide cyclotransferase	QPCT_HUMAN	Q16769	Q16770 Q3KRG6 Q53TR4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635334	Cn1cnnc1C1CCN(CC1)c1ncccc1-c1ccc(F)nc1	InChI=1S/C18H19FN6/c1-24-12-22-23-17(24)13-6-9-25(10-7-13)18-15(3-2-8-20-18)14-4-5-16(19)21-11-14/h2-5,8,11-13H,6-7,9-10H2,1H3	AJIAMIPUWJQSPR-UHFFFAOYSA-N	50519291	CHEMBL4462495::US20240059675, Compound SEN177::US20240101544, Example SEN177	Glutaminyl-peptide cyclotransferase	Homo sapiens		 53							ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50519291	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50519291&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search			91618245	440727873							1	MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL	9UD7,9U64,9ISD,8XGB,9LZV,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0	Glutaminyl-peptide cyclotransferase	QPCT_HUMAN	Q16769	Q16770 Q3KRG6 Q53TR4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635335	Cn1cncc1C1CCN(c2c(C#N)cccc2-c2ccc(F)nc2)CC1	InChI=1S/C21H20FN5/c1-26-14-24-13-19(26)15-7-9-27(10-8-15)21-16(11-23)3-2-4-18(21)17-5-6-20(22)25-12-17/h2-6,12-15H,7-10H2,1H3	IUBVPNGSCDYBJU-UHFFFAOYSA-N	50658211	CHEMBL6170024	Glutaminyl-peptide cyclotransferase	Homo sapiens		 4.0							ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50658211	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50658211&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search											1	MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL	9UD7,9U64,9ISD,8XGB,9LZV,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0	Glutaminyl-peptide cyclotransferase	QPCT_HUMAN	Q16769	Q16770 Q3KRG6 Q53TR4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635336	Cn1cnnc1C1(F)CCN(CC1)c1c(ccnc1-c1cnc2nn(cc2c1)C(C)(C)C)C#N	InChI=1S/C24H26FN9/c1-23(2,3)34-14-18-11-17(13-28-21(18)31-34)19-20(16(12-26)5-8-27-19)33-9-6-24(25,7-10-33)22-30-29-15-32(22)4/h5,8,11,13-15H,6-7,9-10H2,1-4H3	GUIGECLAWNMCPW-UHFFFAOYSA-N	652305	US20240059675, Example 8	Glutaminyl-peptide cyclotransferase	Homo sapiens		 1.000000							ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=652305	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=652305&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search			170761999	494496458							1	MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL	9UD7,9U64,9ISD,8XGB,9LZV,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0	Glutaminyl-peptide cyclotransferase	QPCT_HUMAN	Q16769	Q16770 Q3KRG6 Q53TR4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635337	CCCOc1ccc(C2C(=O)NC(=O)N2c2ccc3[nH]cnc3c2)cc1	InChI=1S/C19H18N4O3/c1-2-9-26-14-6-3-12(4-7-14)17-18(24)22-19(25)23(17)13-5-8-15-16(10-13)21-11-20-15/h3-8,10-11,17H,2,9H2,1H3,(H,20,21)(H,22,24,25)	GTFPAKYEYXNXOT-UHFFFAOYSA-N	149363	US8962860, 6	Glutaminyl-peptide cyclotransferase-like protein	Homo sapiens	 4.0								ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=149363	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6339&target=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=149363&enzyme=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search			46174642	252149318							1	MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLIGSLPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKFLEATLRSLTAGWHVELDPFTASTPLGPVDFGNVVATLDPRAARHLTLACHYDSKLFPPGSTPFVGATDSAVPCALLLELAQALDLELSRAKKQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL	3PB9,3PB8,3PB7,3PB6,3PB4,8XGA,8XFV	Glutaminyl-peptide cyclotransferase-like protein	QPCTL_HUMAN	Q9NXS2	Q53HE4 Q96F74																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635338	CCCOc1ccc([C@H]2CNC(=O)N2c2ccc3[nH]cnc3c2)cc1	InChI=1S/C19H20N4O2/c1-2-9-25-15-6-3-13(4-7-15)18-11-20-19(24)23(18)14-5-8-16-17(10-14)22-12-21-16/h3-8,10,12,18H,2,9,11H2,1H3,(H,20,24)(H,21,22)	XHIKZWOEFZENIX-UHFFFAOYSA-N	308046	US9650362, 14::(S)-1-(1H- benzo[d]imidazol-5-yl)-5-(4- propoxyphenyl)imidazolidin- 2-one	Glutaminyl-peptide cyclotransferase-like protein	Homo sapiens	 5.0								ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=308046	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6339&target=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=308046&enzyme=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search			51030870	382364118							1	MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLIGSLPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKFLEATLRSLTAGWHVELDPFTASTPLGPVDFGNVVATLDPRAARHLTLACHYDSKLFPPGSTPFVGATDSAVPCALLLELAQALDLELSRAKKQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL	3PB9,3PB8,3PB7,3PB6,3PB4,8XGA,8XFV	Glutaminyl-peptide cyclotransferase-like protein	QPCTL_HUMAN	Q9NXS2	Q53HE4 Q96F74																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635339	O=C1C[C@H](c2c(F)cc(OCCC(F)F)cc2F)N1c1ccc2[nH]cnc2c1	InChI=1S/C19H15F4N3O2/c20-12-6-11(28-4-3-17(22)23)7-13(21)19(12)16-8-18(27)26(16)10-1-2-14-15(5-10)25-9-24-14/h1-2,5-7,9,16-17H,3-4,8H2,(H,24,25)	GURVAWDLVHIGNH-UHFFFAOYSA-N	637687	US11834440, Compound RF-1B	Glutaminyl-peptide cyclotransferase-like protein	Homo sapiens	 0.200000								ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=637687	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6339&target=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=637687&enzyme=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search			138503585	486503265							1	MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLIGSLPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKFLEATLRSLTAGWHVELDPFTASTPLGPVDFGNVVATLDPRAARHLTLACHYDSKLFPPGSTPFVGATDSAVPCALLLELAQALDLELSRAKKQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL	3PB9,3PB8,3PB7,3PB6,3PB4,8XGA,8XFV	Glutaminyl-peptide cyclotransferase-like protein	QPCTL_HUMAN	Q9NXS2	Q53HE4 Q96F74																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635340	CCCOc1ccc(C2c3c(nn(C)c3C)C(=O)N2c2ccc3[nH]cnc3c2)c(F)c1	InChI=1S/C23H22FN5O2/c1-4-9-31-15-6-7-16(17(24)11-15)22-20-13(2)28(3)27-21(20)23(30)29(22)14-5-8-18-19(10-14)26-12-25-18/h5-8,10-12,22H,4,9H2,1-3H3,(H,25,26)	JCVCXIDCZJOENC-UHFFFAOYSA-N	50658206	CHEMBL6152981	Glutaminyl-peptide cyclotransferase-like protein	Homo sapiens	<25								ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50658206	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6339&target=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50658206&enzyme=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search			155576705	528504901							1	MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLIGSLPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKFLEATLRSLTAGWHVELDPFTASTPLGPVDFGNVVATLDPRAARHLTLACHYDSKLFPPGSTPFVGATDSAVPCALLLELAQALDLELSRAKKQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL	3PB9,3PB8,3PB7,3PB6,3PB4,8XGA,8XFV	Glutaminyl-peptide cyclotransferase-like protein	QPCTL_HUMAN	Q9NXS2	Q53HE4 Q96F74																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635341	O=C1[C@H](O)[C@H](c2c(F)cc(-c3cnn(C(F)F)c3)cc2F)N1c1ccc2nc[nH]c2c1	InChI=1S/C20H13F4N5O2/c21-12-3-9(10-6-27-28(7-10)20(23)24)4-13(22)16(12)17-18(30)19(31)29(17)11-1-2-14-15(5-11)26-8-25-14/h1-8,17-18,20,30H,(H,25,26)	UFGUAXKGGZSGIA-UHFFFAOYSA-N	50658213	CHEMBL6172996	Glutaminyl-peptide cyclotransferase-like protein	Homo sapiens	<2.0								ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50658213	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6339&target=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50658213&enzyme=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search			168817625	528504908							1	MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLIGSLPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKFLEATLRSLTAGWHVELDPFTASTPLGPVDFGNVVATLDPRAARHLTLACHYDSKLFPPGSTPFVGATDSAVPCALLLELAQALDLELSRAKKQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL	3PB9,3PB8,3PB7,3PB6,3PB4,8XGA,8XFV	Glutaminyl-peptide cyclotransferase-like protein	QPCTL_HUMAN	Q9NXS2	Q53HE4 Q96F74																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51635342	c1cc(c(cc1C2=CC(=O)c3c(cc(cc3O2)O)O)O)O	InChI=1S/C15H10O6/c16-8-4-11(19)15-12(20)6-13(21-14(15)5-8)7-1-2-9(17)10(18)3-7/h1-6,16-19H	IQPNAANSBPBGFQ-UHFFFAOYSA-N	7459	2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4H-chromen-4-one::CHEMBL151::cid_5280445::2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-chromen-4-one::luteolin::Luteolin (27)::Luteolin (4)::med.21724, Compound 3::acs.jmedchem.1c00409_ST.600	Glutaminyl-peptide cyclotransferase-like protein	Homo sapiens			 9400						ChEMBL		10.7270/Q2NK3KXN	39746038			Yu, L; Sun, Y; Xie, L; Tan, X; Wang, P; Xu, S	//0	6/5/2026	Tongji University Cancer Center	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7459	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6339&target=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7459&enzyme=Glutaminyl-peptide+cyclotransferase-like+protein&column=ki&startPg=0&Increment=50&submit=Search	LU2	3SZ1,4DEW,4DGN,4HKN,4QXV,4QYA,5AUU,5II2,5NDF,6M8A,6YA5,7D3B,7EBV,8I94,8WR2	5280445	11108250		CHEMBL151			C01514		1	MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLIGSLPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKFLEATLRSLTAGWHVELDPFTASTPLGPVDFGNVVATLDPRAARHLTLACHYDSKLFPPGSTPFVGATDSAVPCALLLELAQALDLELSRAKKQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL	3PB9,3PB8,3PB7,3PB6,3PB4,8XGA,8XFV	Glutaminyl-peptide cyclotransferase-like protein	QPCTL_HUMAN	Q9NXS2	Q53HE4 Q96F74