BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 51631347 COc1cc(CNCCO)nc(Nc2cccc(-c3ccccc3)c2C)n1 InChI=1S/C21H24N4O2/c1-15-18(16-7-4-3-5-8-16)9-6-10-19(15)24-21-23-17(14-22-11-12-26)13-20(25-21)27-2/h3-10,13,22,26H,11-12,14H2,1-2H3,(H,23,24,25) KXKROLGNSJDVQB-UHFFFAOYSA-N 50656299 CHEMBL6147199 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 581 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656299 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656299&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631348 COc1cc(CNCCO)nc(Nc2cccc(-c3ccccc3)c2F)n1 InChI=1S/C20H21FN4O2/c1-27-18-12-15(13-22-10-11-26)23-20(25-18)24-17-9-5-8-16(19(17)21)14-6-3-2-4-7-14/h2-9,12,22,26H,10-11,13H2,1H3,(H,23,24,25) VCYOBICSDKPICM-UHFFFAOYSA-N 50656300 CHEMBL6162827 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 404 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656300 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656300&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631349 COc1cc(CNCCNC(C)=O)nc(Nc2cccc(-c3ccccc3)c2C)n1 InChI=1S/C23H27N5O2/c1-16-20(18-8-5-4-6-9-18)10-7-11-21(16)27-23-26-19(14-22(28-23)30-3)15-24-12-13-25-17(2)29/h4-11,14,24H,12-13,15H2,1-3H3,(H,25,29)(H,26,27,28) IDADSQSLFXGHHR-UHFFFAOYSA-N 50656301 CHEMBL6143776 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 2940 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656301 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656301&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631350 COc1cc(CNCCNC(C)=O)nc(Nc2cccc(-c3ccccc3)c2F)n1 InChI=1S/C22H24FN5O2/c1-15(29)25-12-11-24-14-17-13-20(30-2)28-22(26-17)27-19-10-6-9-18(21(19)23)16-7-4-3-5-8-16/h3-10,13,24H,11-12,14H2,1-2H3,(H,25,29)(H,26,27,28) NZHPEMLLKBCPSP-UHFFFAOYSA-N 50656302 CHEMBL6144578 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 7290 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656302 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656302&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631351 COc1cc(CN(C)CCO)nc(Nc2cccc(-c3ccccc3)c2C)n1 InChI=1S/C22H26N4O2/c1-16-19(17-8-5-4-6-9-17)10-7-11-20(16)24-22-23-18(14-21(25-22)28-3)15-26(2)12-13-27/h4-11,14,27H,12-13,15H2,1-3H3,(H,23,24,25) KUUMJQMGQSNTTF-UHFFFAOYSA-N 50656303 CHEMBL6153005 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 5710 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656303 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656303&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631352 COc1cc(CNCCN(C)C)nc(Nc2cccc(-c3ccccc3)c2C)n1 InChI=1S/C23H29N5O/c1-17-20(18-9-6-5-7-10-18)11-8-12-21(17)26-23-25-19(15-22(27-23)29-4)16-24-13-14-28(2)3/h5-12,15,24H,13-14,16H2,1-4H3,(H,25,26,27) NWGFUQQFGAWOHL-UHFFFAOYSA-N 50656304 CHEMBL6151365 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 774 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656304 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656304&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631353 COc1cc(CNC2CCOCC2)nc(Nc2cccc(-c3ccccc3)c2C)n1 InChI=1S/C24H28N4O2/c1-17-21(18-7-4-3-5-8-18)9-6-10-22(17)27-24-26-20(15-23(28-24)29-2)16-25-19-11-13-30-14-12-19/h3-10,15,19,25H,11-14,16H2,1-2H3,(H,26,27,28) LUALGNHOKBPCIN-UHFFFAOYSA-N 50656305 CHEMBL6150849 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 54170 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656305 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656305&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631354 COC(=O)CNCc1cc(OC)nc(Nc2cccc(-c3ccccc3)c2C)n1 InChI=1S/C22H24N4O3/c1-15-18(16-8-5-4-6-9-16)10-7-11-19(15)25-22-24-17(12-20(26-22)28-2)13-23-14-21(27)29-3/h4-12,23H,13-14H2,1-3H3,(H,24,25,26) MMWPZPYHBGVMMI-UHFFFAOYSA-N 50656306 CHEMBL6143519 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 6690 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656306 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656306&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631355 CCOC(=O)[C@@H](C)NCc1cc(OC)nc(Nc2cccc(-c3ccccc3)c2C)n1 InChI=1S/C24H28N4O3/c1-5-31-23(29)17(3)25-15-19-14-22(30-4)28-24(26-19)27-21-13-9-12-20(16(21)2)18-10-7-6-8-11-18/h6-14,17,25H,5,15H2,1-4H3,(H,26,27,28) ZJIZVBHTEZNWAX-UHFFFAOYSA-N 50656307 CHEMBL6146690 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 26570 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656307 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656307&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631356 CCOC(=O)[C@H](C)NCc1cc(OC)nc(Nc2cccc(-c3ccccc3)c2C)n1 InChI=1S/C24H28N4O3/c1-5-31-23(29)17(3)25-15-19-14-22(30-4)28-24(26-19)27-21-13-9-12-20(16(21)2)18-10-7-6-8-11-18/h6-14,17,25H,5,15H2,1-4H3,(H,26,27,28) ZJIZVBHTEZNWAX-UHFFFAOYSA-N 50656308 CHEMBL6169102 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 24740 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656308 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656308&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631357 CCOC(=O)[C@@H](CO)NCc1cc(OC)nc(Nc2cccc(-c3ccccc3)c2C)n1 InChI=1S/C24H28N4O4/c1-4-32-23(30)21(15-29)25-14-18-13-22(31-3)28-24(26-18)27-20-12-8-11-19(16(20)2)17-9-6-5-7-10-17/h5-13,21,25,29H,4,14-15H2,1-3H3,(H,26,27,28) OCWNEZOWMHXZEI-UHFFFAOYSA-N 50656309 CHEMBL6148316 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 5280 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656309 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656309&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631358 CCOC(=O)[C@H](CO)NCc1cc(OC)nc(Nc2cccc(-c3ccccc3)c2C)n1 InChI=1S/C24H28N4O4/c1-4-32-23(30)21(15-29)25-14-18-13-22(31-3)28-24(26-18)27-20-12-8-11-19(16(20)2)17-9-6-5-7-10-17/h5-13,21,25,29H,4,14-15H2,1-3H3,(H,26,27,28) OCWNEZOWMHXZEI-UHFFFAOYSA-N 50656310 CHEMBL6102605 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 4980 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656310 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656310&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631359 COc1cc(CNCC(=O)O)nc(Nc2cccc(-c3ccccc3)c2C)n1 InChI=1S/C21H22N4O3/c1-14-17(15-7-4-3-5-8-15)9-6-10-18(14)24-21-23-16(11-19(25-21)28-2)12-22-13-20(26)27/h3-11,22H,12-13H2,1-2H3,(H,26,27)(H,23,24,25) WUXNKAGRUSCRBQ-UHFFFAOYSA-N 50656311 CHEMBL6132737 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 613 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656311 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656311&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631360 COc1cc(CN[C@H](C)C(=O)O)nc(Nc2cccc(-c3ccccc3)c2C)n1 InChI=1S/C22H24N4O3/c1-14-18(16-8-5-4-6-9-16)10-7-11-19(14)25-22-24-17(12-20(26-22)29-3)13-23-15(2)21(27)28/h4-12,15,23H,13H2,1-3H3,(H,27,28)(H,24,25,26) LWORIKJAGOGHPE-UHFFFAOYSA-N 50656312 CHEMBL6151043 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 616 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656312 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656312&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631361 COc1cc(CN[C@@H](C)C(=O)O)nc(Nc2cccc(-c3ccccc3)c2C)n1 InChI=1S/C22H24N4O3/c1-14-18(16-8-5-4-6-9-16)10-7-11-19(14)25-22-24-17(12-20(26-22)29-3)13-23-15(2)21(27)28/h4-12,15,23H,13H2,1-3H3,(H,27,28)(H,24,25,26) LWORIKJAGOGHPE-UHFFFAOYSA-N 50656313 CHEMBL6161064 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 562 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656313 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656313&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631362 COc1cc(CN[C@H](CO)C(=O)O)nc(Nc2cccc(-c3ccccc3)c2C)n1 InChI=1S/C22H24N4O4/c1-14-17(15-7-4-3-5-8-15)9-6-10-18(14)25-22-24-16(11-20(26-22)30-2)12-23-19(13-27)21(28)29/h3-11,19,23,27H,12-13H2,1-2H3,(H,28,29)(H,24,25,26) QSHNMTVUJAVARU-UHFFFAOYSA-N 50656314 CHEMBL6166770 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 519 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656314 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656314&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631363 COc1cc(CN[C@@H](CO)C(=O)O)nc(Nc2cccc(-c3ccccc3)c2C)n1 InChI=1S/C22H24N4O4/c1-14-17(15-7-4-3-5-8-15)9-6-10-18(14)25-22-24-16(11-20(26-22)30-2)12-23-19(13-27)21(28)29/h3-11,19,23,27H,12-13H2,1-2H3,(H,28,29)(H,24,25,26) QSHNMTVUJAVARU-UHFFFAOYSA-N 50656315 CHEMBL6101892 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 272 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656315 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656315&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631364 COc1cc(CNCCO)nc(Nc2cccc(O)c2)n1 InChI=1S/C14H18N4O3/c1-21-13-8-11(9-15-5-6-19)17-14(18-13)16-10-3-2-4-12(20)7-10/h2-4,7-8,15,19-20H,5-6,9H2,1H3,(H,16,17,18) KCTPHIOYWMANBF-UHFFFAOYSA-N 50639009 CHEMBL5561473 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 360 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639009 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639009&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 169101447 519659412 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631365 COc1cc(CNCCO)nc(Nc2cccc(-c3cccc(C#N)c3)c2C)n1 InChI=1S/C22H23N5O2/c1-15-19(17-6-3-5-16(11-17)13-23)7-4-8-20(15)26-22-25-18(14-24-9-10-28)12-21(27-22)29-2/h3-8,11-12,24,28H,9-10,14H2,1-2H3,(H,25,26,27) NCUFVTYEYULHMZ-UHFFFAOYSA-N 50656316 CHEMBL6102932 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 3760 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656316 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656316&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631366 COc1cc(CNCCO)nc(Nc2cccc(-c3ccc([N+](=O)[O-])cc3)c2C)n1 InChI=1S/C21H23N5O4/c1-14-18(15-6-8-17(9-7-15)26(28)29)4-3-5-19(14)24-21-23-16(13-22-10-11-27)12-20(25-21)30-2/h3-9,12,22,27H,10-11,13H2,1-2H3,(H,23,24,25) PPXWWPYKFIQCDW-UHFFFAOYSA-N 50656317 CHEMBL6120545 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 2840 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656317 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656317&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631367 COC(=O)c1ccc(-c2cccc(Nc3nc(CNCCO)cc(OC)n3)c2C)cc1 InChI=1S/C23H26N4O4/c1-15-19(16-7-9-17(10-8-16)22(29)31-3)5-4-6-20(15)26-23-25-18(14-24-11-12-28)13-21(27-23)30-2/h4-10,13,24,28H,11-12,14H2,1-3H3,(H,25,26,27) YOSJDAHNSPAKGT-UHFFFAOYSA-N 50656318 CHEMBL6163531 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 4180 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656318 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656318&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631368 COc1cc(CNCCO)nc(Nc2cccc(-c3ccc(-c4ccc5c(c4)C(=O)CCC5)cc3)c2C)n1 InChI=1S/C31H32N4O3/c1-20-26(6-4-7-28(20)34-31-33-25(19-32-15-16-36)18-30(35-31)38-2)23-11-9-21(10-12-23)24-14-13-22-5-3-8-29(37)27(22)17-24/h4,6-7,9-14,17-18,32,36H,3,5,8,15-16,19H2,1-2H3,(H,33,34,35) QZDQYVDYLIEYKI-UHFFFAOYSA-N 50656319 CHEMBL6149613 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 9280 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656319 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656319&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631369 COc1cc(CNCCO)nc(Nc2cccc(-c3ccc(-c4ccc5c(c4)CCC5=O)cc3)c2C)n1 InChI=1S/C30H30N4O3/c1-19-25(21-8-6-20(7-9-21)22-10-12-26-23(16-22)11-13-28(26)36)4-3-5-27(19)33-30-32-24(18-31-14-15-35)17-29(34-30)37-2/h3-10,12,16-17,31,35H,11,13-15,18H2,1-2H3,(H,32,33,34) XWJQIYGCSYQXKU-UHFFFAOYSA-N 50656320 CHEMBL6148451 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 4450 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656320 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656320&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631370 COc1cc(CNCCO)nc(Nc2cccc(-c3ccc(-c4cccc(O)c4)cc3)c2C)n1 InChI=1S/C27H28N4O3/c1-18-24(20-11-9-19(10-12-20)21-5-3-6-23(33)15-21)7-4-8-25(18)30-27-29-22(17-28-13-14-32)16-26(31-27)34-2/h3-12,15-16,28,32-33H,13-14,17H2,1-2H3,(H,29,30,31) NHHHVHNFVPEMPL-UHFFFAOYSA-N 50656321 CHEMBL6143356 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 22490 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656321 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656321&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631371 COc1cccc(-c2ccc(-c3cccc(Nc4nc(CNCCO)cc(OC)n4)c3C)cc2)c1 InChI=1S/C28H30N4O3/c1-19-25(21-12-10-20(11-13-21)22-6-4-7-24(16-22)34-2)8-5-9-26(19)31-28-30-23(18-29-14-15-33)17-27(32-28)35-3/h4-13,16-17,29,33H,14-15,18H2,1-3H3,(H,30,31,32) XKXJAFPRHBYGEQ-UHFFFAOYSA-N 50656322 CHEMBL6164330 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 5090 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656322 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656322&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631372 COc1cc(CNCCO)nc(Nc2cccc(-c3ccc(-c4ccc(F)cc4)cc3)c2C)n1 InChI=1S/C27H27FN4O2/c1-18-24(21-8-6-19(7-9-21)20-10-12-22(28)13-11-20)4-3-5-25(18)31-27-30-23(17-29-14-15-33)16-26(32-27)34-2/h3-13,16,29,33H,14-15,17H2,1-2H3,(H,30,31,32) JOFHDMMPBXKNJU-UHFFFAOYSA-N 50656323 CHEMBL6143052 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 3980 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656323 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656323&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631373 COc1cc(CNCCO)nc(Nc2cccc(-c3ccc(-c4ccccc4C)cc3)c2C)n1 InChI=1S/C28H30N4O2/c1-19-7-4-5-8-24(19)21-11-13-22(14-12-21)25-9-6-10-26(20(25)2)31-28-30-23(18-29-15-16-33)17-27(32-28)34-3/h4-14,17,29,33H,15-16,18H2,1-3H3,(H,30,31,32) GGVGXWXFPBCMMP-UHFFFAOYSA-N 50656324 CHEMBL6103315 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 1420 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656324 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656324&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631374 COc1cc(CNCCO)nc(Nc2cccc(-c3ccc(-c4ccc5c(c4)OCCO5)cc3)c2C)n1 InChI=1S/C29H30N4O4/c1-19-24(21-8-6-20(7-9-21)22-10-11-26-27(16-22)37-15-14-36-26)4-3-5-25(19)32-29-31-23(18-30-12-13-34)17-28(33-29)35-2/h3-11,16-17,30,34H,12-15,18H2,1-2H3,(H,31,32,33) SQVJNCMFFABTGZ-UHFFFAOYSA-N 50656325 CHEMBL6102534 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 2980 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656325 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656325&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631375 COc1cc(CNCCO)nc(Nc2cccc(-c3ccc(-c4ccc5c(c4)OCCC5=O)cc3)c2C)n1 InChI=1S/C30H30N4O4/c1-19-24(4-3-5-26(19)33-30-32-23(18-31-13-14-35)17-29(34-30)37-2)21-8-6-20(7-9-21)22-10-11-25-27(36)12-15-38-28(25)16-22/h3-11,16-17,31,35H,12-15,18H2,1-2H3,(H,32,33,34) CTMACLVPFVGPNN-UHFFFAOYSA-N 50656326 CHEMBL6133280 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 2070 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656326 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656326&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631376 COc1cc(CN[C@@H](CO)C(=O)O)nc(Nc2cccc(-c3ccccc3)c2C)n1 InChI=1S/C22H24N4O4/c1-14-17(15-7-4-3-5-8-15)9-6-10-18(14)25-22-24-16(11-20(26-22)30-2)12-23-19(13-27)21(28)29/h3-11,19,23,27H,12-13H2,1-2H3,(H,28,29)(H,24,25,26) QSHNMTVUJAVARU-UHFFFAOYSA-N 50656315 CHEMBL6101892 V-type immunoglobulin domain-containing suppressor of T-cell activation Homo sapiens 272 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656315 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656315&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_HUMAN Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8 51631377 COc1cc(CN[C@@H](CO)C(=O)O)nc(Nc2cccc(-c3ccccc3)c2C)n1 InChI=1S/C22H24N4O4/c1-14-17(15-7-4-3-5-8-15)9-6-10-18(14)25-22-24-16(11-20(26-22)30-2)12-23-19(13-27)21(28)29/h3-11,19,23,27H,12-13H2,1-2H3,(H,28,29)(H,24,25,26) QSHNMTVUJAVARU-UHFFFAOYSA-N 50656315 CHEMBL6101892 V-type immunoglobulin domain-containing suppressor of T-cell activation 799 ChEMBL 10.7270/Q2QZ2GT3 39731560 Sun, C; Cheng, Y; Dong, J; Hu, L; Zhang, Y; Shen, H; Zhang, G; Jiang, B; Adam Youssouf, S; Min, W; Shen, Y; Wang, L; Deng, H; Xiao, Y; Yang, P //0 6/4/2026 China Pharmaceutical University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50656315 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001458&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50656315&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search 1 MGVPAVPEASSPRWGTLLLAIFLAASRGLVAAFKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAAALATGACIVGILCLPLILLLVYKQRQVASHRRAQELVRMDSNTQGIENPGFETTPPFQGMPEAKTRPPLSYVAQRQPSESGRYLLSDPSTPLSPPGPGDVFFPSLDPVPDSPNSEAI V-type immunoglobulin domain-containing suppressor of T-cell activation VISTA_MOUSE Q9D659 A3RLQ7 E9PUF5 Q6KAT9