BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 51610550 O=C1/C(=C\Nc2ccccc2)Nc2ccccc21 InChI=1S/C15H12N2O/c18-15-12-8-4-5-9-13(12)17-14(15)10-16-11-6-2-1-3-7-11/h1-10,16-17H OHLGYRUJPFRSFV-UHFFFAOYSA-N 50649453 CHEMBL5619073 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 5360 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649453 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649453&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 135458915 519664855 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610551 O=C1/C(=C\Nc2ccc(Cl)cc2)Nc2ccccc21 InChI=1S/C15H11ClN2O/c16-10-5-7-11(8-6-10)17-9-14-15(19)12-3-1-2-4-13(12)18-14/h1-9,17-18H XXUUQUIZAQPYEW-UHFFFAOYSA-N 50649454 CHEMBL5619593 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 1850 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649454 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649454&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 751017 519664856 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610552 COc1ccc(N/C=C2/Nc3ccccc3C2=O)cc1 InChI=1S/C16H14N2O2/c1-20-12-8-6-11(7-9-12)17-10-15-16(19)13-4-2-3-5-14(13)18-15/h2-10,17-18H,1H3 NIVXBPCPAPKLCD-UHFFFAOYSA-N 50649455 CHEMBL5618987 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 3010 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649455 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649455&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 867421 519664857 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610553 O=C1/C(=C\NCc2ccccc2)Nc2ccccc21 InChI=1S/C16H14N2O/c19-16-13-8-4-5-9-14(13)18-15(16)11-17-10-12-6-2-1-3-7-12/h1-9,11,17-18H,10H2 PGIBPBJBVVNZPD-UHFFFAOYSA-N 50649456 CHEMBL5618665 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 12920 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649456 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649456&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 899977 519664858 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610554 COc1ccc(N/C=C2\C(=O)c3ccccc3N2C)cc1 InChI=1S/C17H16N2O2/c1-19-15-6-4-3-5-14(15)17(20)16(19)11-18-12-7-9-13(21-2)10-8-12/h3-11,18H,1-2H3 SFCHFOPOYDDPIA-UHFFFAOYSA-N 50649457 CHEMBL5619202 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 1000 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649457 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649457&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 136155756 519664859 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610555 CC(=O)N1/C(=C/Nc2ccccc2)C(=O)c2ccccc21 InChI=1S/C17H14N2O2/c1-12(20)19-15-10-6-5-9-14(15)17(21)16(19)11-18-13-7-3-2-4-8-13/h2-11,18H,1H3 PTWZHGXHESUHBG-UHFFFAOYSA-N 50649458 CHEMBL5619748 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 370 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649458 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649458&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 4294031 519664860 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610556 CC(=O)N1/C(=C/Nc2ccc(Cl)cc2)C(=O)c2ccccc21 InChI=1S/C17H13ClN2O2/c1-11(21)20-15-5-3-2-4-14(15)17(22)16(20)10-19-13-8-6-12(18)7-9-13/h2-10,19H,1H3 QRRFPMGNHWJZQB-UHFFFAOYSA-N 50649459 CHEMBL5619291 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 1390 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649459 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649459&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 540876 519664861 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610557 COc1ccc(N/C=C2\C(=O)c3ccccc3N2C(C)=O)cc1 InChI=1S/C18H16N2O3/c1-12(21)20-16-6-4-3-5-15(16)18(22)17(20)11-19-13-7-9-14(23-2)10-8-13/h3-11,19H,1-2H3 FGTHWBHTJLHRAX-UHFFFAOYSA-N 50649460 CHEMBL5618861 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 100 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649460 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649460&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 870605 519664862 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610558 CC(=O)N1/C(=C/Nc2ccc(F)cc2)C(=O)c2ccccc21 InChI=1S/C17H13FN2O2/c1-11(21)20-15-5-3-2-4-14(15)17(22)16(20)10-19-13-8-6-12(18)7-9-13/h2-10,19H,1H3 UCCIIXZCSVBLQS-UHFFFAOYSA-N 50649461 CHEMBL5619156 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 340 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649461 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649461&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177379975 519664863 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610559 CC(=O)N1/C(=C/Nc2cccc(F)c2)C(=O)c2ccccc21 InChI=1S/C17H13FN2O2/c1-11(21)20-15-8-3-2-7-14(15)17(22)16(20)10-19-13-6-4-5-12(18)9-13/h2-10,19H,1H3 YPCDSYOJEDJGFW-UHFFFAOYSA-N 50649462 CHEMBL5618727 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 30 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649462 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649462&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177379976 519664864 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610560 CC(=O)N1/C(=C/Nc2ccc(F)c(F)c2)C(=O)c2ccccc21 InChI=1S/C17H12F2N2O2/c1-10(22)21-15-5-3-2-4-12(15)17(23)16(21)9-20-11-6-7-13(18)14(19)8-11/h2-9,20H,1H3 XLHKUZCJUGBQEX-UHFFFAOYSA-N 50649463 CHEMBL5619531 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 470 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649463 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649463&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177379977 519664865 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610561 CCC(=O)N1/C(=C/Nc2ccc(OC)cc2)C(=O)c2ccccc21 InChI=1S/C19H18N2O3/c1-3-18(22)21-16-7-5-4-6-15(16)19(23)17(21)12-20-13-8-10-14(24-2)11-9-13/h4-12,20H,3H2,1-2H3 IVBHSPKBJRDMRN-UHFFFAOYSA-N 50649464 CHEMBL5619151 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 730 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649464 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649464&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177379978 519664866 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610562 CCC(=O)N1/C(=C/Nc2ccc(F)cc2)C(=O)c2ccccc21 InChI=1S/C18H15FN2O2/c1-2-17(22)21-15-6-4-3-5-14(15)18(23)16(21)11-20-13-9-7-12(19)8-10-13/h3-11,20H,2H2,1H3 TYEAAIATYPINLV-UHFFFAOYSA-N 50649465 CHEMBL5619139 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 430 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649465 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649465&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177379979 519664867 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610563 CCC(=O)N1/C(=C/Nc2cccc(F)c2)C(=O)c2ccccc21 InChI=1S/C18H15FN2O2/c1-2-17(22)21-15-9-4-3-8-14(15)18(23)16(21)11-20-13-7-5-6-12(19)10-13/h3-11,20H,2H2,1H3 NVTNIBMTCLLZGJ-UHFFFAOYSA-N 50649466 CHEMBL5619435 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 230 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649466 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649466&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177379980 519664868 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610564 CCC(=O)N1/C(=C/Nc2ccc(F)c(F)c2)C(=O)c2ccccc21 InChI=1S/C18H14F2N2O2/c1-2-17(23)22-15-6-4-3-5-12(15)18(24)16(22)10-21-11-7-8-13(19)14(20)9-11/h3-10,21H,2H2,1H3 MYMJDXVKUDNLBQ-UHFFFAOYSA-N 50649467 CHEMBL5619675 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 300 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649467 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649467&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177379981 519664869 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610565 CC(=O)N1/C(=C/Nc2cccc(F)c2F)C(=O)c2ccccc21 InChI=1S/C17H12F2N2O2/c1-10(22)21-14-8-3-2-5-11(14)17(23)15(21)9-20-13-7-4-6-12(18)16(13)19/h2-9,20H,1H3 VBUAJHGJLZDYFO-UHFFFAOYSA-N 50649468 CHEMBL5620013 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 950 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649468 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649468&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177379982 519664870 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610566 CC(=O)N1/C(=C/Nc2cc(F)cc(F)c2)C(=O)c2ccccc21 InChI=1S/C17H12F2N2O2/c1-10(22)21-15-5-3-2-4-14(15)17(23)16(21)9-20-13-7-11(18)6-12(19)8-13/h2-9,20H,1H3 YIRMUXGUWIMNIQ-UHFFFAOYSA-N 50649469 CHEMBL5619307 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 530 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649469 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649469&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177379983 519664871 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610567 CC(=O)N1/C(=C/Nc2cc(F)c(F)c(F)c2)C(=O)c2ccccc21 InChI=1S/C17H11F3N2O2/c1-9(23)22-14-5-3-2-4-11(14)17(24)15(22)8-21-10-6-12(18)16(20)13(19)7-10/h2-8,21H,1H3 JZYNQYSYGTYBAP-UHFFFAOYSA-N 50649470 CHEMBL5619779 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 1000 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649470 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649470&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177379984 519664872 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610568 CC(=O)N1/C(=C/NCc2ccc(F)c(F)c2)C(=O)c2ccccc21 InChI=1S/C18H14F2N2O2/c1-11(23)22-16-5-3-2-4-13(16)18(24)17(22)10-21-9-12-6-7-14(19)15(20)8-12/h2-8,10,21H,9H2,1H3 VZTVLFDCEUEIBH-UHFFFAOYSA-N 50649471 CHEMBL5619943 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 11120 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649471 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649471&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177379985 519664873 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610569 COc1ccccc1N/C=C1\C(=O)c2ccccc2N1C(C)=O InChI=1S/C18H16N2O3/c1-12(21)20-15-9-5-3-7-13(15)18(22)16(20)11-19-14-8-4-6-10-17(14)23-2/h3-11,19H,1-2H3 OEBVZJHCCYCUKA-UHFFFAOYSA-N 50649472 CHEMBL5619881 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 1080 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649472 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649472&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177379986 519664874 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610570 COc1cccc(N/C=C2\C(=O)c3ccccc3N2C(C)=O)c1 InChI=1S/C18H16N2O3/c1-12(21)20-16-9-4-3-8-15(16)18(22)17(20)11-19-13-6-5-7-14(10-13)23-2/h3-11,19H,1-2H3 NQBJRAFZQQDFLA-UHFFFAOYSA-N 50649473 CHEMBL5618536 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 370 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649473 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649473&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177379987 519664875 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610571 COc1ccc(N/C=C2\C(=O)c3ccccc3N2C(C)=O)cc1OC InChI=1S/C19H18N2O4/c1-12(22)21-15-7-5-4-6-14(15)19(23)16(21)11-20-13-8-9-17(24-2)18(10-13)25-3/h4-11,20H,1-3H3 KUTXVQUOLOVJMM-UHFFFAOYSA-N 50649474 CHEMBL5619217 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 25220 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649474 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649474&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177379988 519664876 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610572 COc1ccc(OC)c(N/C=C2\C(=O)c3ccccc3N2C(C)=O)c1 InChI=1S/C19H18N2O4/c1-12(22)21-16-7-5-4-6-14(16)19(23)17(21)11-20-15-10-13(24-2)8-9-18(15)25-3/h4-11,20H,1-3H3 DDBUCNIDCJDVRD-UHFFFAOYSA-N 50649475 CHEMBL5618201 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 990 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649475 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649475&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177379989 519664877 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610573 COc1cc(N/C=C2\C(=O)c3ccccc3N2C(C)=O)cc(OC)c1OC InChI=1S/C20H20N2O5/c1-12(23)22-15-8-6-5-7-14(15)19(24)16(22)11-21-13-9-17(25-2)20(27-4)18(10-13)26-3/h5-11,21H,1-4H3 QPOCXKXJUCWFMJ-UHFFFAOYSA-N 50649476 CHEMBL5619407 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 2710 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649476 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649476&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177379990 519664878 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610574 CCOc1ccc(N/C=C2\C(=O)c3ccccc3N2C(C)=O)cc1 InChI=1S/C19H18N2O3/c1-3-24-15-10-8-14(9-11-15)20-12-18-19(23)16-6-4-5-7-17(16)21(18)13(2)22/h4-12,20H,3H2,1-2H3 DGSCHSZEDMPABR-UHFFFAOYSA-N 50649477 CHEMBL5618137 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 620 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649477 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649477&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177379991 519664879 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610575 CCCCOc1ccc(N/C=C2\C(=O)c3ccccc3N2C(C)=O)cc1 InChI=1S/C21H22N2O3/c1-3-4-13-26-17-11-9-16(10-12-17)22-14-20-21(25)18-7-5-6-8-19(18)23(20)15(2)24/h5-12,14,22H,3-4,13H2,1-2H3 JPCHHPFHAQWBCH-UHFFFAOYSA-N 50649478 CHEMBL5618755 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 420 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649478 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649478&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177379992 519664880 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610576 CC(=O)N1/C(=C/Nc2ccccc2C(F)(F)F)C(=O)c2ccccc21 InChI=1S/C18H13F3N2O2/c1-11(24)23-15-9-5-2-6-12(15)17(25)16(23)10-22-14-8-4-3-7-13(14)18(19,20)21/h2-10,22H,1H3 YOPPABQLPNLWCS-UHFFFAOYSA-N 50649479 CHEMBL5619713 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 580 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649479 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649479&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177379993 519664881 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610577 CC(=O)N1/C(=C/Nc2cccc(C(F)(F)F)c2)C(=O)c2ccccc21 InChI=1S/C18H13F3N2O2/c1-11(24)23-15-8-3-2-7-14(15)17(25)16(23)10-22-13-6-4-5-12(9-13)18(19,20)21/h2-10,22H,1H3 IUNBJFBKQALXEL-UHFFFAOYSA-N 50649480 CHEMBL5618360 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 960 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649480 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649480&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177379994 519664882 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610578 CC(=O)N1/C(=C/Nc2ccc(C(F)(F)F)cc2)C(=O)c2ccccc21 InChI=1S/C18H13F3N2O2/c1-11(24)23-15-5-3-2-4-14(15)17(25)16(23)10-22-13-8-6-12(7-9-13)18(19,20)21/h2-10,22H,1H3 AGNXEPWWLMIPEZ-UHFFFAOYSA-N 50649481 CHEMBL5619276 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 770 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649481 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649481&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177379995 519664883 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610579 CC(=O)N1/C(=C/Nc2cccc(OC(F)(F)F)c2)C(=O)c2ccccc21 InChI=1S/C18H13F3N2O3/c1-11(24)23-15-8-3-2-7-14(15)17(25)16(23)10-22-12-5-4-6-13(9-12)26-18(19,20)21/h2-10,22H,1H3 PIXZMGQWRSFVSP-UHFFFAOYSA-N 50649482 CHEMBL5620038 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 200 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649482 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649482&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177379996 519664884 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610580 CC(=O)N1/C(=C/Nc2ccc(OC(F)(F)F)cc2)C(=O)c2ccccc21 InChI=1S/C18H13F3N2O3/c1-11(24)23-15-5-3-2-4-14(15)17(25)16(23)10-22-12-6-8-13(9-7-12)26-18(19,20)21/h2-10,22H,1H3 YHVZNQQOSPXWDH-UHFFFAOYSA-N 50649483 CHEMBL5618221 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 5130 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649483 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649483&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177379997 519664885 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610581 CCOC(=O)c1cccc(N/C=C2\C(=O)c3ccccc3N2C(C)=O)c1 InChI=1S/C20H18N2O4/c1-3-26-20(25)14-7-6-8-15(11-14)21-12-18-19(24)16-9-4-5-10-17(16)22(18)13(2)23/h4-12,21H,3H2,1-2H3 NYNOKKNBILJBSU-UHFFFAOYSA-N 50649484 CHEMBL5619868 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 280 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649484 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649484&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177379998 519664886 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610582 CC(=O)N1/C(=C/Nc2cccc(S(N)(=O)=O)c2)C(=O)c2ccccc21 InChI=1S/C17H15N3O4S/c1-11(21)20-15-8-3-2-7-14(15)17(22)16(20)10-19-12-5-4-6-13(9-12)25(18,23)24/h2-10,19H,1H3,(H2,18,23,24) VDFCXJAERPVHAS-UHFFFAOYSA-N 50649485 CHEMBL5619433 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 640 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649485 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649485&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177379999 519664887 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610583 CC(=O)N1/C(=C/Nc2ccccn2)C(=O)c2ccccc21 InChI=1S/C16H13N3O2/c1-11(20)19-13-7-3-2-6-12(13)16(21)14(19)10-18-15-8-4-5-9-17-15/h2-10H,1H3,(H,17,18) IAFPWTPVYTVQKA-UHFFFAOYSA-N 50649486 CHEMBL5618068 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 1190 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649486 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649486&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177380000 519664888 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610584 CC(=O)N1/C(=C/Nc2ccncc2)C(=O)c2ccccc21 InChI=1S/C16H13N3O2/c1-11(20)19-14-5-3-2-4-13(14)16(21)15(19)10-18-12-6-8-17-9-7-12/h2-10H,1H3,(H,17,18) JIXRYHZIXPJONO-UHFFFAOYSA-N 50649487 CHEMBL5618098 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 1080 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649487 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649487&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177380001 519664889 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610585 CC(=O)N1/C(=C/Nc2cccc(Cc3ccccc3)c2)C(=O)c2ccccc21 InChI=1S/C24H20N2O2/c1-17(27)26-22-13-6-5-12-21(22)24(28)23(26)16-25-20-11-7-10-19(15-20)14-18-8-3-2-4-9-18/h2-13,15-16,25H,14H2,1H3 UZTDRGCQDQAMHI-UHFFFAOYSA-N 50649488 CHEMBL5618681 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 200 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649488 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649488&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177380002 519664890 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610586 CC(=O)N1/C(=C/Nc2ccc(Cc3ccccc3)cc2)C(=O)c2ccccc21 InChI=1S/C24H20N2O2/c1-17(27)26-22-10-6-5-9-21(22)24(28)23(26)16-25-20-13-11-19(12-14-20)15-18-7-3-2-4-8-18/h2-14,16,25H,15H2,1H3 YRBUKPPKOLCZCL-UHFFFAOYSA-N 50649489 CHEMBL5618121 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 100 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649489 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649489&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177380003 519664891 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610587 CC(=O)N1/C(=C/Nc2cccc(Oc3ccccc3)c2)C(=O)c2ccccc21 InChI=1S/C23H18N2O3/c1-16(26)25-21-13-6-5-12-20(21)23(27)22(25)15-24-17-8-7-11-19(14-17)28-18-9-3-2-4-10-18/h2-15,24H,1H3 NJLKGZWXIGYFFH-UHFFFAOYSA-N 50649490 CHEMBL5618365 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 500 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649490 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649490&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177380004 519664892 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610588 CC(=O)N1/C(=C/Nc2ccc(Nc3ccccc3)cc2)C(=O)c2ccccc21 InChI=1S/C23H19N3O2/c1-16(27)26-21-10-6-5-9-20(21)23(28)22(26)15-24-17-11-13-19(14-12-17)25-18-7-3-2-4-8-18/h2-15,24-25H,1H3 IYESZCAEGXMWLZ-UHFFFAOYSA-N 50649491 CHEMBL5619485 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 760 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649491 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649491&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177380005 519664893 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610589 COc1ccc(N/C=C2\C(=O)c3cc(OC)ccc3N2C(C)=O)cc1 InChI=1S/C19H18N2O4/c1-12(22)21-17-9-8-15(25-3)10-16(17)19(23)18(21)11-20-13-4-6-14(24-2)7-5-13/h4-11,20H,1-3H3 JCEBNFBLYTZCAY-UHFFFAOYSA-N 50649492 CHEMBL5618925 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 1700 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649492 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649492&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177380006 519664894 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610590 CCOC(=O)c1cccc(N/C=C2\C(=O)c3cc(OC)ccc3N2C(C)=O)c1 InChI=1S/C21H20N2O5/c1-4-28-21(26)14-6-5-7-15(10-14)22-12-19-20(25)17-11-16(27-3)8-9-18(17)23(19)13(2)24/h5-12,22H,4H2,1-3H3 LWWYCFAGYIGQSW-UHFFFAOYSA-N 50649493 CHEMBL5619508 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 1330 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649493 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649493&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177380007 519664895 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610591 COc1ccc(N/C=C2\C(=O)c3cc(Cl)ccc3N2C(C)=O)cc1 InChI=1S/C18H15ClN2O3/c1-11(22)21-16-8-3-12(19)9-15(16)18(23)17(21)10-20-13-4-6-14(24-2)7-5-13/h3-10,20H,1-2H3 AFUDVIDYBDXTME-UHFFFAOYSA-N 50649494 CHEMBL5619846 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 5430 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649494 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649494&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177380008 519664896 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610592 CCOC(=O)c1cccc(N/C=C2\C(=O)c3cc(Cl)ccc3N2C(C)=O)c1 InChI=1S/C20H17ClN2O4/c1-3-27-20(26)13-5-4-6-15(9-13)22-11-18-19(25)16-10-14(21)7-8-17(16)23(18)12(2)24/h4-11,22H,3H2,1-2H3 ZIHDKHHIQCOAOW-UHFFFAOYSA-N 50649495 CHEMBL5619165 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 2030 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649495 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649495&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177380009 519664897 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610593 COc1ccc(N/C=C2\C(=O)c3cccnc3N2C(C)=O)cc1 InChI=1S/C17H15N3O3/c1-11(21)20-15(16(22)14-4-3-9-18-17(14)20)10-19-12-5-7-13(23-2)8-6-12/h3-10,19H,1-2H3 NTDUOFXTGBWQEK-UHFFFAOYSA-N 50649496 CHEMBL5620062 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 2000 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649496 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649496&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177380010 519664898 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610594 CCOC(=O)c1cccc(N/C=C2\C(=O)c3cccnc3N2C(C)=O)c1 InChI=1S/C19H17N3O4/c1-3-26-19(25)13-6-4-7-14(10-13)21-11-16-17(24)15-8-5-9-20-18(15)22(16)12(2)23/h4-11,21H,3H2,1-2H3 BXAFOMFGFRHGAL-UHFFFAOYSA-N 50649497 CHEMBL5619837 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 9840 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649497 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649497&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177380011 519664899 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610595 CC(=O)N1/C(=C/Nc2cccc(F)c2)C(=O)c2cccnc21 InChI=1S/C16H12FN3O2/c1-10(21)20-14(9-19-12-5-2-4-11(17)8-12)15(22)13-6-3-7-18-16(13)20/h2-9,19H,1H3 DSWKKVJQKFEFQT-UHFFFAOYSA-N 50649498 CHEMBL5619743 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 1420 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649498 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649498&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177380012 519664900 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4 51610596 CC(=O)N1/C(=C/Nc2cccc(Oc3ccccc3)c2)C(=O)c2cccnc21 InChI=1S/C22H17N3O3/c1-15(26)25-20(21(27)19-11-6-12-23-22(19)25)14-24-16-7-5-10-18(13-16)28-17-8-3-2-4-9-17/h2-14,24H,1H3 JNVXAZDGTGDYOR-UHFFFAOYSA-N 50649499 CHEMBL5619698 Neuraminidase Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) 150 ChEMBL 10.7270/Q2NS10MW 39163780 Tsedilin, A; Schmidtke, M; Monakhova, N; Leneva, I; Falynskova, I; Khrenova, M; Lane, TR; Ekins, S; Makarov, V //0 10/13/2025 Federal Research Centre "Fundamentals of Biotechnology" of the Russian Academy of Sciences (Research Centre of Biotechnology RAS) http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50649499 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=753&target=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50649499&enzyme=Neuraminidase&column=ki&startPg=0&Increment=50&submit=Search 177380013 519664901 1 MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK 9GQT,9GQQ Neuraminidase NRAM_I34A1 P03468 A4GXH6 Q20N35 Q84043 Q8JUU4