BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 51589527 Cc1ccc(C2CC(=O)C(=CNCCN3CCOCC3)C(=O)C2)cc1 InChI=1S/C20H26N2O3/c1-15-2-4-16(5-3-15)17-12-19(23)18(20(24)13-17)14-21-6-7-22-8-10-25-11-9-22/h2-5,14,17,21H,6-13H2,1H3 ISATZAKHZRYAQT-UHFFFAOYSA-N 50640056 CHEMBL5562185 Microtubule-associated proteins 1A/1B light chain 3B Human 1810 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640056 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640056&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 177380411 519665460 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589528 Cc1ccc(C2CC(=O)C(=CNCCN3CCNCC3)C(=O)C2)cc1 InChI=1S/C20H27N3O2/c1-15-2-4-16(5-3-15)17-12-19(24)18(20(25)13-17)14-22-8-11-23-9-6-21-7-10-23/h2-5,14,17,21-22H,6-13H2,1H3 SZWZTRVBYFUXEB-UHFFFAOYSA-N 50640057 CHEMBL5565533 Microtubule-associated proteins 1A/1B light chain 3B Human 6800 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640057 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640057&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 135403263 519665461 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589529 Cc1ccc(C2CC(=O)C(=CNCCN3CCCCC3)C(=O)C2)cc1 InChI=1S/C21H28N2O2/c1-16-5-7-17(8-6-16)18-13-20(24)19(21(25)14-18)15-22-9-12-23-10-3-2-4-11-23/h5-8,15,18,22H,2-4,9-14H2,1H3 RFZLIMJOHAXAKZ-UHFFFAOYSA-N 50640058 CHEMBL5560134 Microtubule-associated proteins 1A/1B light chain 3B Human 1210 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640058 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640058&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 177380412 519665462 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589530 Cc1ccc(C2CC(=O)C(=CNCCN(C)C)C(=O)C2)cc1 InChI=1S/C18H24N2O2/c1-13-4-6-14(7-5-13)15-10-17(21)16(18(22)11-15)12-19-8-9-20(2)3/h4-7,12,15,19H,8-11H2,1-3H3 GODUNICHOIPKIL-UHFFFAOYSA-N 50640059 CHEMBL5559211 Microtubule-associated proteins 1A/1B light chain 3B Human 1210 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640059 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640059&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 177380413 519665463 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589531 Cc1ccc(C2CC(=O)C(=CNCCCN(C)C)C(=O)C2)cc1 InChI=1S/C19H26N2O2/c1-14-5-7-15(8-6-14)16-11-18(22)17(19(23)12-16)13-20-9-4-10-21(2)3/h5-8,13,16,20H,4,9-12H2,1-3H3 HSXQHTOCZLBVLY-UHFFFAOYSA-N 50640060 CHEMBL5561990 Microtubule-associated proteins 1A/1B light chain 3B Human 7770 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640060 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640060&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 177380414 519665464 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589532 O=C1CC(c2cccc(Cl)c2Cl)CC(=O)C1=CNCCN1CCOCC1 InChI=1S/C19H22Cl2N2O3/c20-16-3-1-2-14(19(16)21)13-10-17(24)15(18(25)11-13)12-22-4-5-23-6-8-26-9-7-23/h1-3,12-13,22H,4-11H2 QWRGQCLNVZLPJO-UHFFFAOYSA-N 50640061 CHEMBL5563109 Microtubule-associated proteins 1A/1B light chain 3B Human 140 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640061 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640061&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 162641047 519665465 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589533 CN(C)CCNC=C1C(=O)CC(c2ccccc2)CC1=O InChI=1S/C17H22N2O2/c1-19(2)9-8-18-12-15-16(20)10-14(11-17(15)21)13-6-4-3-5-7-13/h3-7,12,14,18H,8-11H2,1-2H3 UPJVTLWTTOQLJE-UHFFFAOYSA-N 50640062 CHEMBL5542425 Microtubule-associated proteins 1A/1B light chain 3B Human 1260 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640062 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640062&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 146459603 519665466 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589534 Cc1ccccc1C1CC(=O)C(=CNCCN(C)C)C(=O)C1 InChI=1S/C18H24N2O2/c1-13-6-4-5-7-15(13)14-10-17(21)16(18(22)11-14)12-19-8-9-20(2)3/h4-7,12,14,19H,8-11H2,1-3H3 VDUCVPKFHBCGAY-UHFFFAOYSA-N 50640063 CHEMBL5566225 Microtubule-associated proteins 1A/1B light chain 3B Human 920 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640063 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640063&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 154938192 519665467 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589535 Cc1cccc(C2CC(=O)C(=CNCCN(C)C)C(=O)C2)c1 InChI=1S/C18H24N2O2/c1-13-5-4-6-14(9-13)15-10-17(21)16(18(22)11-15)12-19-7-8-20(2)3/h4-6,9,12,15,19H,7-8,10-11H2,1-3H3 XRFRRARYHSCLPW-UHFFFAOYSA-N 50640064 CHEMBL5561472 Microtubule-associated proteins 1A/1B light chain 3B Human 870 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640064 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640064&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 177380415 519665468 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589536 COc1ccccc1C1CC(=O)C(=CNCCN(C)C)C(=O)C1 InChI=1S/C18H24N2O3/c1-20(2)9-8-19-12-15-16(21)10-13(11-17(15)22)14-6-4-5-7-18(14)23-3/h4-7,12-13,19H,8-11H2,1-3H3 LTFMQHUUUFNBBB-UHFFFAOYSA-N 50640065 CHEMBL5561269 Microtubule-associated proteins 1A/1B light chain 3B Human 1660 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640065 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640065&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 146459438 519665469 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589537 COc1cccc(C2CC(=O)C(=CNCCN(C)C)C(=O)C2)c1 InChI=1S/C18H24N2O3/c1-20(2)8-7-19-12-16-17(21)10-14(11-18(16)22)13-5-4-6-15(9-13)23-3/h4-6,9,12,14,19H,7-8,10-11H2,1-3H3 KDFFOBDYWHNALR-UHFFFAOYSA-N 50640066 CHEMBL5561184 Microtubule-associated proteins 1A/1B light chain 3B Human 1270 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640066 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640066&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 146459656 519665470 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589538 COc1ccc(C2CC(=O)C(=CNCCN(C)C)C(=O)C2)cc1 InChI=1S/C18H24N2O3/c1-20(2)9-8-19-12-16-17(21)10-14(11-18(16)22)13-4-6-15(23-3)7-5-13/h4-7,12,14,19H,8-11H2,1-3H3 ZVVLPNLKFCWSSW-UHFFFAOYSA-N 50640067 CHEMBL5560249 Microtubule-associated proteins 1A/1B light chain 3B Human 1850 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640067 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640067&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 177380416 519665471 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589539 CN(C)CCNC=C1C(=O)CC(c2ccccc2F)CC1=O InChI=1S/C17H21FN2O2/c1-20(2)8-7-19-11-14-16(21)9-12(10-17(14)22)13-5-3-4-6-15(13)18/h3-6,11-12,19H,7-10H2,1-2H3 BASSHRJSNDWRAY-UHFFFAOYSA-N 50640068 CHEMBL5568388 Microtubule-associated proteins 1A/1B light chain 3B Human 440 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640068 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640068&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 146459544 519665472 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589540 CN(C)CCNC=C1C(=O)CC(c2cccc(F)c2)CC1=O InChI=1S/C17H21FN2O2/c1-20(2)7-6-19-11-15-16(21)9-13(10-17(15)22)12-4-3-5-14(18)8-12/h3-5,8,11,13,19H,6-7,9-10H2,1-2H3 LDXNGKXZWJHXLP-UHFFFAOYSA-N 50640069 CHEMBL5562227 Microtubule-associated proteins 1A/1B light chain 3B Human 610 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640069 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640069&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 146459601 519665473 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589541 CN(C)CCNC=C1C(=O)CC(c2ccc(F)cc2)CC1=O InChI=1S/C17H21FN2O2/c1-20(2)8-7-19-11-15-16(21)9-13(10-17(15)22)12-3-5-14(18)6-4-12/h3-6,11,13,19H,7-10H2,1-2H3 NDXHGKUTSVJRBM-UHFFFAOYSA-N 50640070 CHEMBL5556890 Microtubule-associated proteins 1A/1B light chain 3B Human 1260 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640070 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640070&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 177380417 519665474 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589542 CN(C)CCNC=C1C(=O)CC(c2ccccc2Cl)CC1=O InChI=1S/C17H21ClN2O2/c1-20(2)8-7-19-11-14-16(21)9-12(10-17(14)22)13-5-3-4-6-15(13)18/h3-6,11-12,19H,7-10H2,1-2H3 FGUCTQADVPUWKK-UHFFFAOYSA-N 50640071 CHEMBL5560611 Microtubule-associated proteins 1A/1B light chain 3B Human 290 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640071 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640071&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 146459517 519665475 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589543 CN(C)CCNC=C1C(=O)CC(c2cccc(Cl)c2)CC1=O InChI=1S/C17H21ClN2O2/c1-20(2)7-6-19-11-15-16(21)9-13(10-17(15)22)12-4-3-5-14(18)8-12/h3-5,8,11,13,19H,6-7,9-10H2,1-2H3 PYMLATLHUMYAQU-UHFFFAOYSA-N 50640072 CHEMBL5560736 Microtubule-associated proteins 1A/1B light chain 3B Human 370 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640072 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640072&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 146459426 519665476 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589544 CN(C)CCNC=C1C(=O)CC(c2ccc(Cl)cc2)CC1=O InChI=1S/C17H21ClN2O2/c1-20(2)8-7-19-11-15-16(21)9-13(10-17(15)22)12-3-5-14(18)6-4-12/h3-6,11,13,19H,7-10H2,1-2H3 QOZKYDMDHNRUNQ-UHFFFAOYSA-N 50640073 CHEMBL5564981 Microtubule-associated proteins 1A/1B light chain 3B Human 940 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640073 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640073&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 177380418 519665477 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589545 CN(C)CCNC=C1C(=O)CC(c2ccccc2Br)CC1=O InChI=1S/C17H21BrN2O2/c1-20(2)8-7-19-11-14-16(21)9-12(10-17(14)22)13-5-3-4-6-15(13)18/h3-6,11-12,19H,7-10H2,1-2H3 VBBJZBNPWSOFOE-UHFFFAOYSA-N 50640074 CHEMBL5557502 Microtubule-associated proteins 1A/1B light chain 3B Human 300 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640074 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640074&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 177380419 519665478 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589546 CN(C)CCNC=C1C(=O)CC(c2cccc(Br)c2)CC1=O InChI=1S/C17H21BrN2O2/c1-20(2)7-6-19-11-15-16(21)9-13(10-17(15)22)12-4-3-5-14(18)8-12/h3-5,8,11,13,19H,6-7,9-10H2,1-2H3 NJNCOJYFKQBKBX-UHFFFAOYSA-N 50640075 CHEMBL5562113 Microtubule-associated proteins 1A/1B light chain 3B Human 490 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640075 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640075&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 146459402 519665479 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589547 CN(C)CCNC=C1C(=O)CC(c2ccc(Br)cc2)CC1=O InChI=1S/C17H21BrN2O2/c1-20(2)8-7-19-11-15-16(21)9-13(10-17(15)22)12-3-5-14(18)6-4-12/h3-6,11,13,19H,7-10H2,1-2H3 KRACEWWJVZMMRR-UHFFFAOYSA-N 50640076 CHEMBL5568495 Microtubule-associated proteins 1A/1B light chain 3B Human 950 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640076 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640076&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 146459683 519665480 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589548 CN(C)CCNC=C1C(=O)CC(c2cccc(Cl)c2Cl)CC1=O InChI=1S/C17H20Cl2N2O2/c1-21(2)7-6-20-10-13-15(22)8-11(9-16(13)23)12-4-3-5-14(18)17(12)19/h3-5,10-11,20H,6-9H2,1-2H3 BJVYRJQTNUFHBU-UHFFFAOYSA-N 50640077 CHEMBL5560804 Microtubule-associated proteins 1A/1B light chain 3B Human 100 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640077 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640077&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 146459620 519665481 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589549 CN(C)CCNC=C1C(=O)CC(c2cc(Cl)ccc2Cl)CC1=O InChI=1S/C17H20Cl2N2O2/c1-21(2)6-5-20-10-14-16(22)7-11(8-17(14)23)13-9-12(18)3-4-15(13)19/h3-4,9-11,20H,5-8H2,1-2H3 UZWWLSHYRYLEJS-UHFFFAOYSA-N 50640078 CHEMBL5561936 Microtubule-associated proteins 1A/1B light chain 3B Human 400 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640078 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640078&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 146459395 519665482 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589550 CN(C)CCNC=C1C(=O)CC(c2c(Cl)cccc2Cl)CC1=O InChI=1S/C17H20Cl2N2O2/c1-21(2)7-6-20-10-12-15(22)8-11(9-16(12)23)17-13(18)4-3-5-14(17)19/h3-5,10-11,20H,6-9H2,1-2H3 RAVZCHNYNOQUND-UHFFFAOYSA-N 50640079 CHEMBL5561502 Microtubule-associated proteins 1A/1B light chain 3B Human 200 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640079 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640079&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 146459583 519665483 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589551 CN(C)CCNC=C1C(=O)CC(c2ccc(Cl)cc2Cl)CC1=O InChI=1S/C17H20Cl2N2O2/c1-21(2)6-5-20-10-14-16(22)7-11(8-17(14)23)13-4-3-12(18)9-15(13)19/h3-4,9-11,20H,5-8H2,1-2H3 LKHLKKCDTOMDFK-UHFFFAOYSA-N 50640080 CHEMBL5532542 Microtubule-associated proteins 1A/1B light chain 3B Human 310 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640080 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640080&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 146459550 519665484 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589552 CN(C)CCNC=C1C(=O)CC(c2cc(Cl)cc(Cl)c2Cl)CC1=O InChI=1S/C17H19Cl3N2O2/c1-22(2)4-3-21-9-13-15(23)5-10(6-16(13)24)12-7-11(18)8-14(19)17(12)20/h7-10,21H,3-6H2,1-2H3 ZRGPEFREVHGPCD-UHFFFAOYSA-N 50640081 CHEMBL5565069 Microtubule-associated proteins 1A/1B light chain 3B Human 220 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640081 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640081&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 146459628 519665485 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589553 CN(C)CCNC=C1C(=O)CC(C2CCCCC2)CC1=O InChI=1S/C17H28N2O2/c1-19(2)9-8-18-12-15-16(20)10-14(11-17(15)21)13-6-4-3-5-7-13/h12-14,18H,3-11H2,1-2H3 AAKBJQIQVKHXJN-UHFFFAOYSA-N 50640082 CHEMBL5567305 Microtubule-associated proteins 1A/1B light chain 3B Human 8140 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640082 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640082&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 177380420 519665486 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589554 CN(C)CCNC=C1C(=O)CC(c2cccs2)CC1=O InChI=1S/C15H20N2O2S/c1-17(2)6-5-16-10-12-13(18)8-11(9-14(12)19)15-4-3-7-20-15/h3-4,7,10-11,16H,5-6,8-9H2,1-2H3 PNTAIVSJCZPWEL-UHFFFAOYSA-N 50640083 CHEMBL5568228 Microtubule-associated proteins 1A/1B light chain 3B Human 2320 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640083 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640083&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 177380421 519665487 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589555 CN(C)CCNC=C1C(=O)CC(c2cccc3[nH]ccc23)CC1=O InChI=1S/C19H23N3O2/c1-22(2)9-8-20-12-16-18(23)10-13(11-19(16)24)14-4-3-5-17-15(14)6-7-21-17/h3-7,12-13,20-21H,8-11H2,1-2H3 MTWAYEABECQOJN-UHFFFAOYSA-N 50640084 CHEMBL5560956 Microtubule-associated proteins 1A/1B light chain 3B Human 440 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640084 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640084&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 177380422 519665488 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589556 CN(C)CCNC=C1C(=O)CC(c2c(Cl)c(Cl)cc3[nH]ccc23)CC1=O InChI=1S/C19H21Cl2N3O2/c1-24(2)6-5-22-10-13-16(25)7-11(8-17(13)26)18-12-3-4-23-15(12)9-14(20)19(18)21/h3-4,9-11,22-23H,5-8H2,1-2H3 PZZMLUYOSFDDHG-UHFFFAOYSA-N 50640085 CHEMBL5556385 Microtubule-associated proteins 1A/1B light chain 3B Human 80 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640085 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640085&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 172419030 519665489 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589557 CN(C)CCNC=C1C(=O)CC(c2cccc(Cl)c2Cl)CC1=O InChI=1S/C17H20Cl2N2O2/c1-21(2)7-6-20-10-13-15(22)8-11(9-16(13)23)12-4-3-5-14(18)17(12)19/h3-5,10-11,20H,6-9H2,1-2H3 BJVYRJQTNUFHBU-UHFFFAOYSA-N 50640077 CHEMBL5560804 Microtubule-associated proteins 1A/1B light chain 3B Human 34 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640077 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640077&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 146459620 519665481 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589558 CN(C)CCNC=C1C(=O)CC(c2c(Cl)c(Cl)cc3[nH]ccc23)CC1=O InChI=1S/C19H21Cl2N3O2/c1-24(2)6-5-22-10-13-16(25)7-11(8-17(13)26)18-12-3-4-23-15(12)9-14(20)19(18)21/h3-4,9-11,22-23H,5-8H2,1-2H3 PZZMLUYOSFDDHG-UHFFFAOYSA-N 50640085 CHEMBL5556385 Microtubule-associated proteins 1A/1B light chain 3B Human 7.6 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640085 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640085&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 172419030 519665489 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589559 O=C1CC(c2cccc(Cl)c2Cl)CC(=O)C1=CNCCN1CCOCC1 InChI=1S/C19H22Cl2N2O3/c20-16-3-1-2-14(19(16)21)13-10-17(24)15(18(25)11-13)12-22-4-5-23-6-8-26-9-7-23/h1-3,12-13,22H,4-11H2 QWRGQCLNVZLPJO-UHFFFAOYSA-N 50640061 CHEMBL5563109 Microtubule-associated proteins 1A/1B light chain 3B Human 52 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640061 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640061&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 162641047 519665465 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589560 CN(C)CCNC=C1C(=O)CC(c2cccc(Cl)c2Cl)CC1=O InChI=1S/C17H20Cl2N2O2/c1-21(2)7-6-20-10-13-15(22)8-11(9-16(13)23)12-4-3-5-14(18)17(12)19/h3-5,10-11,20H,6-9H2,1-2H3 BJVYRJQTNUFHBU-UHFFFAOYSA-N 50640077 CHEMBL5560804 Microtubule-associated proteins 1A/1B light chain 3B Human 72230 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640077 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640077&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 146459620 519665481 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589561 CN(C)CCNC=C1C(=O)CC(c2c(Cl)c(Cl)cc3[nH]ccc23)CC1=O InChI=1S/C19H21Cl2N3O2/c1-24(2)6-5-22-10-13-16(25)7-11(8-17(13)26)18-12-3-4-23-15(12)9-14(20)19(18)21/h3-4,9-11,22-23H,5-8H2,1-2H3 PZZMLUYOSFDDHG-UHFFFAOYSA-N 50640085 CHEMBL5556385 Microtubule-associated proteins 1A/1B light chain 3B Human 9070 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640085 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640085&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 172419030 519665489 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589562 O=C1CC(c2cccc(Cl)c2Cl)CC(=O)C1=CNCCN1CCOCC1 InChI=1S/C19H22Cl2N2O3/c20-16-3-1-2-14(19(16)21)13-10-17(24)15(18(25)11-13)12-22-4-5-23-6-8-26-9-7-23/h1-3,12-13,22H,4-11H2 QWRGQCLNVZLPJO-UHFFFAOYSA-N 50640061 CHEMBL5563109 Microtubule-associated proteins 1A/1B light chain 3B Human 86280 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640061 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640061&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 162641047 519665465 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589563 CN(C)CCNC=C1C(=O)CC(c2c(Cl)c(Cl)cc3[nH]ccc23)CC1=O InChI=1S/C19H21Cl2N3O2/c1-24(2)6-5-22-10-13-16(25)7-11(8-17(13)26)18-12-3-4-23-15(12)9-14(20)19(18)21/h3-4,9-11,22-23H,5-8H2,1-2H3 PZZMLUYOSFDDHG-UHFFFAOYSA-N 50640085 CHEMBL5556385 Microtubule-associated proteins 1A/1B light chain 3B Human 17 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640085 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640085&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 172419030 519665489 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589564 CN(C)CCNC=C1C(=O)CC(c2c(Cl)c(Cl)cc3[nH]ccc23)CC1=O InChI=1S/C19H21Cl2N3O2/c1-24(2)6-5-22-10-13-16(25)7-11(8-17(13)26)18-12-3-4-23-15(12)9-14(20)19(18)21/h3-4,9-11,22-23H,5-8H2,1-2H3 PZZMLUYOSFDDHG-UHFFFAOYSA-N 50640085 CHEMBL5556385 Microtubule-associated proteins 1A/1B light chain 3B Human 56 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640085 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640085&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 172419030 519665489 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589565 CN(C)CCNC=C1C(=O)CC(c2c(Cl)c(Cl)cc3[nH]ccc23)CC1=O InChI=1S/C19H21Cl2N3O2/c1-24(2)6-5-22-10-13-16(25)7-11(8-17(13)26)18-12-3-4-23-15(12)9-14(20)19(18)21/h3-4,9-11,22-23H,5-8H2,1-2H3 PZZMLUYOSFDDHG-UHFFFAOYSA-N 50640085 CHEMBL5556385 Microtubule-associated proteins 1A/1B light chain 3A Human 33 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640085 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001083&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640085&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3A&column=ki&startPg=0&Increment=50&submit=Search 172419030 519665489 1 MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF 5CX3,3ECI,8T4T,8T36,8T35,8T2L,7RA0,7R9Z,7R9W,3WAN,5DPR,3WAL,4ZDV,6TBE Microtubule-associated protein 1 light chain 3 alpha MLP3A_HUMAN Q9H492 E1P5P4 E1P5P5 Q9BXW5 51589566 CN(C)CCNC=C1C(=O)CC(c2c(Cl)c(Cl)cc3[nH]ccc23)CC1=O InChI=1S/C19H21Cl2N3O2/c1-24(2)6-5-22-10-13-16(25)7-11(8-17(13)26)18-12-3-4-23-15(12)9-14(20)19(18)21/h3-4,9-11,22-23H,5-8H2,1-2H3 PZZMLUYOSFDDHG-UHFFFAOYSA-N 50640085 CHEMBL5556385 Microtubule-associated proteins 1A/1B light chain 3B Human 17 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640085 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1056&target=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640085&enzyme=Microtubule-associated+proteins+1A%2F1B+light+chain+3B&column=ki&startPg=0&Increment=50&submit=Search 172419030 519665489 1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV 8Q53,8YV6,8Q7K,5GMV,5D94,2ZJD,2N9X,1V49,7GAU,7GAS,7GAR,7GAQ,7GAP,7GAO,7GAN,7GAM,7GAL,7GAK,7GAJ,7GAI,7GAH,7GAG,7GAF,7GAE,7GAD,7GAC,7GAB,7GAA,7GA9,7GA8,6J04,5XAD,5XAC,5XAE,5MS2,5V4K,3VTW,3WAO,3X0W,3VTV,4WAA,5DCN,5MS6,5MS5,2LUE,5W9A Microtubule-associated protein 1 light chain 3 beta MLP3B_HUMAN Q9GZQ8 Q6NW02 51589567 CN(C)CCNC=C1C(=O)CC(c2c(Cl)c(Cl)cc3[nH]ccc23)CC1=O InChI=1S/C19H21Cl2N3O2/c1-24(2)6-5-22-10-13-16(25)7-11(8-17(13)26)18-12-3-4-23-15(12)9-14(20)19(18)21/h3-4,9-11,22-23H,5-8H2,1-2H3 PZZMLUYOSFDDHG-UHFFFAOYSA-N 50640085 CHEMBL5556385 Microtubule-associated protein 1 light chain 3 gamma Homo sapiens 4520 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640085 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001828&target=Microtubule-associated+protein+1+light+chain+3+gamma&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640085&enzyme=Microtubule-associated+protein+1+light+chain+3+gamma&column=ki&startPg=0&Increment=50&submit=Search 172419030 519665489 1 MPPPQKIPSVRPFKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFLPPLDKTKFLVPQELTMTQFLSIIRSRMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYKDEDGFVYMTYASQETFGCLESAAPRDGSSLEDRPCNPL 2NCN,3VVW,3WAP,3WAM,5DPW Microtubule-associated protein 1 light chain 3 gamma MLP3C_HUMAN Q9BXW4 A0PJY8 A2RUP0 51589568 CN(C)CCNC=C1C(=O)CC(c2c(Cl)c(Cl)cc3[nH]ccc23)CC1=O InChI=1S/C19H21Cl2N3O2/c1-24(2)6-5-22-10-13-16(25)7-11(8-17(13)26)18-12-3-4-23-15(12)9-14(20)19(18)21/h3-4,9-11,22-23H,5-8H2,1-2H3 PZZMLUYOSFDDHG-UHFFFAOYSA-N 50640085 CHEMBL5556385 GABA(A) receptor-associated protein Pig 4440 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640085 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000570&target=GABA%28A%29+receptor-associated+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640085&enzyme=GABA%28A%29+receptor-associated+protein&column=ki&startPg=0&Increment=50&submit=Search 172419030 519665489 1 MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL 1KJT,9L9I,7AA8,6YOP,7LSW,9HGD,8T33,8T32,8T31,8T2N,7ZL7,7ZKR,3DOW,3D32,1KOT,8W6A,7FB5,7EA7,7BV4,6A9X,5YIR,3WIM,1KM7,1KLV,1GNU,7LT6,8S1M,8T2M,6HYO,6HYM,6HYL,6HYN,9E8P,7VEC,5DPS,8AFI,6HOJ,6HOK,6HOG,6HOH,8X8A,9HGC,7AA9,7AA7,6YOO,6HOL,6HOI,5LXI,5LXH,9JF2,7JHX,7CDB,5YIP GABA type A receptor-associated protein D7RA28_PIG D7RA28 A0A4X1V1R7 A0A5K1V7B2 I3L8B5 51589569 CN(C)CCNC=C1C(=O)CC(c2c(Cl)c(Cl)cc3[nH]ccc23)CC1=O InChI=1S/C19H21Cl2N3O2/c1-24(2)6-5-22-10-13-16(25)7-11(8-17(13)26)18-12-3-4-23-15(12)9-14(20)19(18)21/h3-4,9-11,22-23H,5-8H2,1-2H3 PZZMLUYOSFDDHG-UHFFFAOYSA-N 50640085 CHEMBL5556385 Gamma-aminobutyric acid receptor-associated protein-like 1 Homo sapiens 3430 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640085 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001832&target=Gamma-aminobutyric+acid+receptor-associated+protein-like+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640085&enzyme=Gamma-aminobutyric+acid+receptor-associated+protein-like+1&column=ki&startPg=0&Increment=50&submit=Search 172419030 519665489 1 MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK 9HGC,8X8A,7AA9,7AA7,6YOO,6HOL,6HOI,5LXI,5LXH,7JHX,9JF2,7CDB,5YIP,5DPT,2R2Q,1KJT,9L9I,7LSW,6YOP,9E8P,9HGD,8T33,8T32,8T31,8T2N,7ZL7,7ZKR,3DOW,3D32,1KOT,8W6A,7FB5,7EA7,7BV4,6A9X,5YIR,3WIM,1KM7,1KLV,1GNU,7AA8,7LT6,7VEC,8T2M,8S1M,6HYM,6HYL,6HYO,6HYN Gamma-aminobutyric acid receptor-associated protein-like 1 GBRL1_HUMAN Q9H0R8 B4E0Y7 Q6FIE6 51589570 CN(C)CCNC=C1C(=O)CC(c2c(Cl)c(Cl)cc3[nH]ccc23)CC1=O InChI=1S/C19H21Cl2N3O2/c1-24(2)6-5-22-10-13-16(25)7-11(8-17(13)26)18-12-3-4-23-15(12)9-14(20)19(18)21/h3-4,9-11,22-23H,5-8H2,1-2H3 PZZMLUYOSFDDHG-UHFFFAOYSA-N 50640085 CHEMBL5556385 Gamma-aminobutyric acid receptor-associated protein-like 2 Homo sapiens 860 ChEMBL 10.7270/Q2JH3RS9 39010658 Zhou, Z; Huang, S; Fan, S; Li, X; Wang, C; Yu, W; Du, D; Zhang, Y; Chen, K; Fu, W; Luo, C //0 10/11/2025 Fudan University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50640085 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001833&target=Gamma-aminobutyric+acid+receptor-associated+protein-like+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50640085&enzyme=Gamma-aminobutyric+acid+receptor-associated+protein-like+2&column=ki&startPg=0&Increment=50&submit=Search 172419030 519665489 1 MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF 7LK3,4CO7,8Q6Q,1EO6 Gamma-aminobutyric acid receptor-associated protein-like 2 GBRL2_HUMAN P60520 O08765 Q6FG91 Q9DCP8 Q9UQF7