BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 51589195 CN1CCN(c2ccc(C(=O)Nc3ccccc3N)cc2)CC1 InChI=1S/C18H22N4O/c1-21-10-12-22(13-11-21)15-8-6-14(7-9-15)18(23)20-17-5-3-2-4-16(17)19/h2-9H,10-13,19H2,1H3,(H,20,23) CLLGKLVFOGJBIA-UHFFFAOYSA-N 50639870 CHEMBL5561678 Histone deacetylase 3 Human >4000 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639870 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1995&target=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639870&enzyme=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search 68407402 519660273 1 MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI 4A69 Histone deacetylase 3 HDAC3_HUMAN O15379 D3DQE1 O43268 Q9UEI5 Q9UEV0 51589196 Cc1ccc(NC(=O)c2ccc(N3CCN(C)CC3)cc2)c(N)c1 InChI=1S/C19H24N4O/c1-14-3-8-18(17(20)13-14)21-19(24)15-4-6-16(7-5-15)23-11-9-22(2)10-12-23/h3-8,13H,9-12,20H2,1-2H3,(H,21,24) UMOJAPMFIWQZOE-UHFFFAOYSA-N 50639871 CHEMBL5564022 Histone deacetylase 3 Human >4000 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639871 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1995&target=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639871&enzyme=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search 177376832 519660274 1 MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI 4A69 Histone deacetylase 3 HDAC3_HUMAN O15379 D3DQE1 O43268 Q9UEI5 Q9UEV0 51589197 CCc1ccc(NC(=O)c2ccc(N3CCN(C)CC3)cc2)c(N)c1 InChI=1S/C20H26N4O/c1-3-15-4-9-19(18(21)14-15)22-20(25)16-5-7-17(8-6-16)24-12-10-23(2)11-13-24/h4-9,14H,3,10-13,21H2,1-2H3,(H,22,25) WTHMCYOQLRXYML-UHFFFAOYSA-N 50639872 CHEMBL5559852 Histone deacetylase 3 Human >4000 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639872 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1995&target=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639872&enzyme=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search 177376833 519660275 1 MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI 4A69 Histone deacetylase 3 HDAC3_HUMAN O15379 D3DQE1 O43268 Q9UEI5 Q9UEV0 51589198 CN1CCN(c2ccc(C(=O)Nc3ccc(F)cc3N)cc2)CC1 InChI=1S/C18H21FN4O/c1-22-8-10-23(11-9-22)15-5-2-13(3-6-15)18(24)21-17-7-4-14(19)12-16(17)20/h2-7,12H,8-11,20H2,1H3,(H,21,24) SQQPTZCZKUQICW-UHFFFAOYSA-N 50639873 CHEMBL5561230 Histone deacetylase 3 Human 334 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639873 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1995&target=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639873&enzyme=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search 177376834 519660276 1 MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI 4A69 Histone deacetylase 3 HDAC3_HUMAN O15379 D3DQE1 O43268 Q9UEI5 Q9UEV0 51589199 CN1CCN(c2ccc(C(=O)Nc3ccccc3O)cc2)CC1 InChI=1S/C18H21N3O2/c1-20-10-12-21(13-11-20)15-8-6-14(7-9-15)18(23)19-16-4-2-3-5-17(16)22/h2-9,22H,10-13H2,1H3,(H,19,23) JLXNRYJYNANFLI-UHFFFAOYSA-N 50639874 CHEMBL5568420 Histone deacetylase 3 Human >4000 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639874 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1995&target=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639874&enzyme=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search 177376835 519660277 1 MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI 4A69 Histone deacetylase 3 HDAC3_HUMAN O15379 D3DQE1 O43268 Q9UEI5 Q9UEV0 51589200 CCNNC(=O)c1ccc(N2CCN(C)CC2)cc1 InChI=1S/C14H22N4O/c1-3-15-16-14(19)12-4-6-13(7-5-12)18-10-8-17(2)9-11-18/h4-7,15H,3,8-11H2,1-2H3,(H,16,19) USBRNSYEATYGJM-UHFFFAOYSA-N 50639875 CHEMBL5562387 Histone deacetylase 3 Human 271 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639875 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1995&target=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639875&enzyme=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search 177376836 519660278 1 MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI 4A69 Histone deacetylase 3 HDAC3_HUMAN O15379 D3DQE1 O43268 Q9UEI5 Q9UEV0 51589201 CCCNNC(=O)c1ccc(N2CCN(C)CC2)cc1 InChI=1S/C15H24N4O/c1-3-8-16-17-15(20)13-4-6-14(7-5-13)19-11-9-18(2)10-12-19/h4-7,16H,3,8-12H2,1-2H3,(H,17,20) KBNQDACHNKIYHV-UHFFFAOYSA-N 50639876 CHEMBL5566022 Histone deacetylase 3 Human 2.5 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639876 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1995&target=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639876&enzyme=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search 177376837 519660279 1 MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI 4A69 Histone deacetylase 3 HDAC3_HUMAN O15379 D3DQE1 O43268 Q9UEI5 Q9UEV0 51589202 CCCCNNC(=O)c1ccc(N2CCN(C)CC2)cc1 InChI=1S/C16H26N4O/c1-3-4-9-17-18-16(21)14-5-7-15(8-6-14)20-12-10-19(2)11-13-20/h5-8,17H,3-4,9-13H2,1-2H3,(H,18,21) JNJNPGMSRQFTBO-UHFFFAOYSA-N 50639877 CHEMBL5565875 Histone deacetylase 3 Human 4.1 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639877 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1995&target=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639877&enzyme=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search 177376838 519660280 1 MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI 4A69 Histone deacetylase 3 HDAC3_HUMAN O15379 D3DQE1 O43268 Q9UEI5 Q9UEV0 51589203 CCCCCNNC(=O)c1ccc(N2CCN(C)CC2)cc1 InChI=1S/C17H28N4O/c1-3-4-5-10-18-19-17(22)15-6-8-16(9-7-15)21-13-11-20(2)12-14-21/h6-9,18H,3-5,10-14H2,1-2H3,(H,19,22) QQELVNCCFIFFLD-UHFFFAOYSA-N 50639878 CHEMBL5566253 Histone deacetylase 3 Human 42 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639878 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1995&target=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639878&enzyme=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search 177376839 519660281 1 MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI 4A69 Histone deacetylase 3 HDAC3_HUMAN O15379 D3DQE1 O43268 Q9UEI5 Q9UEV0 51589204 CCCCCCNNC(=O)c1ccc(N2CCN(C)CC2)cc1 InChI=1S/C18H30N4O/c1-3-4-5-6-11-19-20-18(23)16-7-9-17(10-8-16)22-14-12-21(2)13-15-22/h7-10,19H,3-6,11-15H2,1-2H3,(H,20,23) JUEIFHACXBHLBJ-UHFFFAOYSA-N 50639879 CHEMBL5561268 Histone deacetylase 3 Human 512 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639879 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1995&target=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639879&enzyme=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search 172419142 519660282 1 MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI 4A69 Histone deacetylase 3 HDAC3_HUMAN O15379 D3DQE1 O43268 Q9UEI5 Q9UEV0 51589205 CCCCCCCNNC(=O)c1ccc(N2CCN(C)CC2)cc1 InChI=1S/C19H32N4O/c1-3-4-5-6-7-12-20-21-19(24)17-8-10-18(11-9-17)23-15-13-22(2)14-16-23/h8-11,20H,3-7,12-16H2,1-2H3,(H,21,24) ZBMUUQXIFSVFNJ-UHFFFAOYSA-N 50639880 CHEMBL5568232 Histone deacetylase 3 Human 1354 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639880 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1995&target=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639880&enzyme=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search 177376840 519660283 1 MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI 4A69 Histone deacetylase 3 HDAC3_HUMAN O15379 D3DQE1 O43268 Q9UEI5 Q9UEV0 51589206 CN1CCN(c2ccc(C(=O)NNCC3CC3)cc2)CC1 InChI=1S/C16H24N4O/c1-19-8-10-20(11-9-19)15-6-4-14(5-7-15)16(21)18-17-12-13-2-3-13/h4-7,13,17H,2-3,8-12H2,1H3,(H,18,21) UGTDAKPEBJTLJD-UHFFFAOYSA-N 50639881 CHEMBL5560146 Histone deacetylase 3 Human 18 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639881 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1995&target=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639881&enzyme=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search 177376841 519660284 1 MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI 4A69 Histone deacetylase 3 HDAC3_HUMAN O15379 D3DQE1 O43268 Q9UEI5 Q9UEV0 51589207 CN1CCN(c2ccc(C(=O)NNCC3CCC3)cc2)CC1 InChI=1S/C17H26N4O/c1-20-9-11-21(12-10-20)16-7-5-15(6-8-16)17(22)19-18-13-14-3-2-4-14/h5-8,14,18H,2-4,9-13H2,1H3,(H,19,22) ZHRJIKCILCMAHO-UHFFFAOYSA-N 50639882 CHEMBL5564541 Histone deacetylase 3 Human 21 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639882 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1995&target=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639882&enzyme=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search 177376842 519660285 1 MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI 4A69 Histone deacetylase 3 HDAC3_HUMAN O15379 D3DQE1 O43268 Q9UEI5 Q9UEV0 51589208 CN1CCN(c2ccc(C(=O)NNCC3CCCC3)cc2)CC1 InChI=1S/C18H28N4O/c1-21-10-12-22(13-11-21)17-8-6-16(7-9-17)18(23)20-19-14-15-4-2-3-5-15/h6-9,15,19H,2-5,10-14H2,1H3,(H,20,23) AABLXNQNALWNDW-UHFFFAOYSA-N 50639883 CHEMBL5561378 Histone deacetylase 3 Human 141 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639883 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1995&target=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639883&enzyme=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search 177376843 519660286 1 MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI 4A69 Histone deacetylase 3 HDAC3_HUMAN O15379 D3DQE1 O43268 Q9UEI5 Q9UEV0 51589209 CC(C)CCNNC(=O)c1ccc(N2CCN(C)CC2)cc1 InChI=1S/C17H28N4O/c1-14(2)8-9-18-19-17(22)15-4-6-16(7-5-15)21-12-10-20(3)11-13-21/h4-7,14,18H,8-13H2,1-3H3,(H,19,22) DTFUUTUZOIUCPX-UHFFFAOYSA-N 50639884 CHEMBL5559210 Histone deacetylase 3 Human 200 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639884 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1995&target=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639884&enzyme=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search 177376844 519660287 1 MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI 4A69 Histone deacetylase 3 HDAC3_HUMAN O15379 D3DQE1 O43268 Q9UEI5 Q9UEV0 51589210 CC(C)CNNC(=O)c1ccc(N2CCN(C)CC2)cc1 InChI=1S/C16H26N4O/c1-13(2)12-17-18-16(21)14-4-6-15(7-5-14)20-10-8-19(3)9-11-20/h4-7,13,17H,8-12H2,1-3H3,(H,18,21) XAISOELXZHHCPI-UHFFFAOYSA-N 50639885 CHEMBL5563613 Histone deacetylase 3 Human 107 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639885 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1995&target=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639885&enzyme=Histone+deacetylase+3&column=ki&startPg=0&Increment=50&submit=Search 177376845 519660288 1 MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI 4A69 Histone deacetylase 3 HDAC3_HUMAN O15379 D3DQE1 O43268 Q9UEI5 Q9UEV0 51589211 CN1CCN(c2ccc(C(=O)Nc3ccccc3N)cc2)CC1 InChI=1S/C18H22N4O/c1-21-10-12-22(13-11-21)15-8-6-14(7-9-15)18(23)20-17-5-3-2-4-16(17)19/h2-9H,10-13,19H2,1H3,(H,20,23) CLLGKLVFOGJBIA-UHFFFAOYSA-N 50639870 CHEMBL5561678 Histone deacetylase 8 Human >4000 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639870 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1996&target=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639870&enzyme=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search 68407402 519660273 1 MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVV 3SFH,3SFF,6ODC,6ODB,6ODA,5FCW,1W22,1VKG,1T69,1T67,1T64,3RQD,3MZ3,3F0R,3F07,5VI6 Histone deacetylase 8 HDAC8_HUMAN Q9BY41 A6ND12 A6ND61 A6NET3 A6NJR3 A8MQ62 B4DKN0 B4DV22 Q86VC8 Q9NP76 Q9NYH4 51589212 Cc1ccc(NC(=O)c2ccc(N3CCN(C)CC3)cc2)c(N)c1 InChI=1S/C19H24N4O/c1-14-3-8-18(17(20)13-14)21-19(24)15-4-6-16(7-5-15)23-11-9-22(2)10-12-23/h3-8,13H,9-12,20H2,1-2H3,(H,21,24) UMOJAPMFIWQZOE-UHFFFAOYSA-N 50639871 CHEMBL5564022 Histone deacetylase 8 Human >4000 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639871 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1996&target=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639871&enzyme=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search 177376832 519660274 1 MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVV 3SFH,3SFF,6ODC,6ODB,6ODA,5FCW,1W22,1VKG,1T69,1T67,1T64,3RQD,3MZ3,3F0R,3F07,5VI6 Histone deacetylase 8 HDAC8_HUMAN Q9BY41 A6ND12 A6ND61 A6NET3 A6NJR3 A8MQ62 B4DKN0 B4DV22 Q86VC8 Q9NP76 Q9NYH4 51589213 CCc1ccc(NC(=O)c2ccc(N3CCN(C)CC3)cc2)c(N)c1 InChI=1S/C20H26N4O/c1-3-15-4-9-19(18(21)14-15)22-20(25)16-5-7-17(8-6-16)24-12-10-23(2)11-13-24/h4-9,14H,3,10-13,21H2,1-2H3,(H,22,25) WTHMCYOQLRXYML-UHFFFAOYSA-N 50639872 CHEMBL5559852 Histone deacetylase 8 Human >4000 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639872 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1996&target=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639872&enzyme=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search 177376833 519660275 1 MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVV 3SFH,3SFF,6ODC,6ODB,6ODA,5FCW,1W22,1VKG,1T69,1T67,1T64,3RQD,3MZ3,3F0R,3F07,5VI6 Histone deacetylase 8 HDAC8_HUMAN Q9BY41 A6ND12 A6ND61 A6NET3 A6NJR3 A8MQ62 B4DKN0 B4DV22 Q86VC8 Q9NP76 Q9NYH4 51589214 CN1CCN(c2ccc(C(=O)Nc3ccc(F)cc3N)cc2)CC1 InChI=1S/C18H21FN4O/c1-22-8-10-23(11-9-22)15-5-2-13(3-6-15)18(24)21-17-7-4-14(19)12-16(17)20/h2-7,12H,8-11,20H2,1H3,(H,21,24) SQQPTZCZKUQICW-UHFFFAOYSA-N 50639873 CHEMBL5561230 Histone deacetylase 8 Human 830 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639873 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1996&target=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639873&enzyme=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search 177376834 519660276 1 MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVV 3SFH,3SFF,6ODC,6ODB,6ODA,5FCW,1W22,1VKG,1T69,1T67,1T64,3RQD,3MZ3,3F0R,3F07,5VI6 Histone deacetylase 8 HDAC8_HUMAN Q9BY41 A6ND12 A6ND61 A6NET3 A6NJR3 A8MQ62 B4DKN0 B4DV22 Q86VC8 Q9NP76 Q9NYH4 51589215 CN1CCN(c2ccc(C(=O)Nc3ccccc3O)cc2)CC1 InChI=1S/C18H21N3O2/c1-20-10-12-21(13-11-20)15-8-6-14(7-9-15)18(23)19-16-4-2-3-5-17(16)22/h2-9,22H,10-13H2,1H3,(H,19,23) JLXNRYJYNANFLI-UHFFFAOYSA-N 50639874 CHEMBL5568420 Histone deacetylase 8 Human >4000 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639874 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1996&target=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639874&enzyme=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search 177376835 519660277 1 MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVV 3SFH,3SFF,6ODC,6ODB,6ODA,5FCW,1W22,1VKG,1T69,1T67,1T64,3RQD,3MZ3,3F0R,3F07,5VI6 Histone deacetylase 8 HDAC8_HUMAN Q9BY41 A6ND12 A6ND61 A6NET3 A6NJR3 A8MQ62 B4DKN0 B4DV22 Q86VC8 Q9NP76 Q9NYH4 51589216 CCNNC(=O)c1ccc(N2CCN(C)CC2)cc1 InChI=1S/C14H22N4O/c1-3-15-16-14(19)12-4-6-13(7-5-12)18-10-8-17(2)9-11-18/h4-7,15H,3,8-11H2,1-2H3,(H,16,19) USBRNSYEATYGJM-UHFFFAOYSA-N 50639875 CHEMBL5562387 Histone deacetylase 8 Human 101 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639875 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1996&target=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639875&enzyme=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search 177376836 519660278 1 MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVV 3SFH,3SFF,6ODC,6ODB,6ODA,5FCW,1W22,1VKG,1T69,1T67,1T64,3RQD,3MZ3,3F0R,3F07,5VI6 Histone deacetylase 8 HDAC8_HUMAN Q9BY41 A6ND12 A6ND61 A6NET3 A6NJR3 A8MQ62 B4DKN0 B4DV22 Q86VC8 Q9NP76 Q9NYH4 51589217 CCCNNC(=O)c1ccc(N2CCN(C)CC2)cc1 InChI=1S/C15H24N4O/c1-3-8-16-17-15(20)13-4-6-14(7-5-13)19-11-9-18(2)10-12-19/h4-7,16H,3,8-12H2,1-2H3,(H,17,20) KBNQDACHNKIYHV-UHFFFAOYSA-N 50639876 CHEMBL5566022 Histone deacetylase 8 Human 93 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639876 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1996&target=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639876&enzyme=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search 177376837 519660279 1 MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVV 3SFH,3SFF,6ODC,6ODB,6ODA,5FCW,1W22,1VKG,1T69,1T67,1T64,3RQD,3MZ3,3F0R,3F07,5VI6 Histone deacetylase 8 HDAC8_HUMAN Q9BY41 A6ND12 A6ND61 A6NET3 A6NJR3 A8MQ62 B4DKN0 B4DV22 Q86VC8 Q9NP76 Q9NYH4 51589218 CCCCNNC(=O)c1ccc(N2CCN(C)CC2)cc1 InChI=1S/C16H26N4O/c1-3-4-9-17-18-16(21)14-5-7-15(8-6-14)20-12-10-19(2)11-13-20/h5-8,17H,3-4,9-13H2,1-2H3,(H,18,21) JNJNPGMSRQFTBO-UHFFFAOYSA-N 50639877 CHEMBL5565875 Histone deacetylase 8 Human 81 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639877 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1996&target=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639877&enzyme=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search 177376838 519660280 1 MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVV 3SFH,3SFF,6ODC,6ODB,6ODA,5FCW,1W22,1VKG,1T69,1T67,1T64,3RQD,3MZ3,3F0R,3F07,5VI6 Histone deacetylase 8 HDAC8_HUMAN Q9BY41 A6ND12 A6ND61 A6NET3 A6NJR3 A8MQ62 B4DKN0 B4DV22 Q86VC8 Q9NP76 Q9NYH4 51589219 CCCCCNNC(=O)c1ccc(N2CCN(C)CC2)cc1 InChI=1S/C17H28N4O/c1-3-4-5-10-18-19-17(22)15-6-8-16(9-7-15)21-13-11-20(2)12-14-21/h6-9,18H,3-5,10-14H2,1-2H3,(H,19,22) QQELVNCCFIFFLD-UHFFFAOYSA-N 50639878 CHEMBL5566253 Histone deacetylase 8 Human 16 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639878 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1996&target=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639878&enzyme=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search 177376839 519660281 1 MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVV 3SFH,3SFF,6ODC,6ODB,6ODA,5FCW,1W22,1VKG,1T69,1T67,1T64,3RQD,3MZ3,3F0R,3F07,5VI6 Histone deacetylase 8 HDAC8_HUMAN Q9BY41 A6ND12 A6ND61 A6NET3 A6NJR3 A8MQ62 B4DKN0 B4DV22 Q86VC8 Q9NP76 Q9NYH4 51589220 CCCCCCNNC(=O)c1ccc(N2CCN(C)CC2)cc1 InChI=1S/C18H30N4O/c1-3-4-5-6-11-19-20-18(23)16-7-9-17(10-8-16)22-14-12-21(2)13-15-22/h7-10,19H,3-6,11-15H2,1-2H3,(H,20,23) JUEIFHACXBHLBJ-UHFFFAOYSA-N 50639879 CHEMBL5561268 Histone deacetylase 8 Human 7.6 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639879 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1996&target=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639879&enzyme=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search 172419142 519660282 1 MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVV 3SFH,3SFF,6ODC,6ODB,6ODA,5FCW,1W22,1VKG,1T69,1T67,1T64,3RQD,3MZ3,3F0R,3F07,5VI6 Histone deacetylase 8 HDAC8_HUMAN Q9BY41 A6ND12 A6ND61 A6NET3 A6NJR3 A8MQ62 B4DKN0 B4DV22 Q86VC8 Q9NP76 Q9NYH4 51589221 CCCCCCCNNC(=O)c1ccc(N2CCN(C)CC2)cc1 InChI=1S/C19H32N4O/c1-3-4-5-6-7-12-20-21-19(24)17-8-10-18(11-9-17)23-15-13-22(2)14-16-23/h8-11,20H,3-7,12-16H2,1-2H3,(H,21,24) ZBMUUQXIFSVFNJ-UHFFFAOYSA-N 50639880 CHEMBL5568232 Histone deacetylase 8 Human 5.4 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639880 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1996&target=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639880&enzyme=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search 177376840 519660283 1 MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVV 3SFH,3SFF,6ODC,6ODB,6ODA,5FCW,1W22,1VKG,1T69,1T67,1T64,3RQD,3MZ3,3F0R,3F07,5VI6 Histone deacetylase 8 HDAC8_HUMAN Q9BY41 A6ND12 A6ND61 A6NET3 A6NJR3 A8MQ62 B4DKN0 B4DV22 Q86VC8 Q9NP76 Q9NYH4 51589222 CN1CCN(c2ccc(C(=O)NNCC3CC3)cc2)CC1 InChI=1S/C16H24N4O/c1-19-8-10-20(11-9-19)15-6-4-14(5-7-15)16(21)18-17-12-13-2-3-13/h4-7,13,17H,2-3,8-12H2,1H3,(H,18,21) UGTDAKPEBJTLJD-UHFFFAOYSA-N 50639881 CHEMBL5560146 Histone deacetylase 8 Human 96 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639881 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1996&target=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639881&enzyme=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search 177376841 519660284 1 MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVV 3SFH,3SFF,6ODC,6ODB,6ODA,5FCW,1W22,1VKG,1T69,1T67,1T64,3RQD,3MZ3,3F0R,3F07,5VI6 Histone deacetylase 8 HDAC8_HUMAN Q9BY41 A6ND12 A6ND61 A6NET3 A6NJR3 A8MQ62 B4DKN0 B4DV22 Q86VC8 Q9NP76 Q9NYH4 51589223 CN1CCN(c2ccc(C(=O)NNCC3CCC3)cc2)CC1 InChI=1S/C17H26N4O/c1-20-9-11-21(12-10-20)16-7-5-15(6-8-16)17(22)19-18-13-14-3-2-4-14/h5-8,14,18H,2-4,9-13H2,1H3,(H,19,22) ZHRJIKCILCMAHO-UHFFFAOYSA-N 50639882 CHEMBL5564541 Histone deacetylase 8 Human 192 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639882 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1996&target=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639882&enzyme=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search 177376842 519660285 1 MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVV 3SFH,3SFF,6ODC,6ODB,6ODA,5FCW,1W22,1VKG,1T69,1T67,1T64,3RQD,3MZ3,3F0R,3F07,5VI6 Histone deacetylase 8 HDAC8_HUMAN Q9BY41 A6ND12 A6ND61 A6NET3 A6NJR3 A8MQ62 B4DKN0 B4DV22 Q86VC8 Q9NP76 Q9NYH4 51589224 CN1CCN(c2ccc(C(=O)NNCC3CCCC3)cc2)CC1 InChI=1S/C18H28N4O/c1-21-10-12-22(13-11-21)17-8-6-16(7-9-17)18(23)20-19-14-15-4-2-3-5-15/h6-9,15,19H,2-5,10-14H2,1H3,(H,20,23) AABLXNQNALWNDW-UHFFFAOYSA-N 50639883 CHEMBL5561378 Histone deacetylase 8 Human 179 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639883 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1996&target=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639883&enzyme=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search 177376843 519660286 1 MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVV 3SFH,3SFF,6ODC,6ODB,6ODA,5FCW,1W22,1VKG,1T69,1T67,1T64,3RQD,3MZ3,3F0R,3F07,5VI6 Histone deacetylase 8 HDAC8_HUMAN Q9BY41 A6ND12 A6ND61 A6NET3 A6NJR3 A8MQ62 B4DKN0 B4DV22 Q86VC8 Q9NP76 Q9NYH4 51589225 CC(C)CCNNC(=O)c1ccc(N2CCN(C)CC2)cc1 InChI=1S/C17H28N4O/c1-14(2)8-9-18-19-17(22)15-4-6-16(7-5-15)21-12-10-20(3)11-13-21/h4-7,14,18H,8-13H2,1-3H3,(H,19,22) DTFUUTUZOIUCPX-UHFFFAOYSA-N 50639884 CHEMBL5559210 Histone deacetylase 8 Human 141 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639884 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1996&target=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639884&enzyme=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search 177376844 519660287 1 MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVV 3SFH,3SFF,6ODC,6ODB,6ODA,5FCW,1W22,1VKG,1T69,1T67,1T64,3RQD,3MZ3,3F0R,3F07,5VI6 Histone deacetylase 8 HDAC8_HUMAN Q9BY41 A6ND12 A6ND61 A6NET3 A6NJR3 A8MQ62 B4DKN0 B4DV22 Q86VC8 Q9NP76 Q9NYH4 51589226 CC(C)CNNC(=O)c1ccc(N2CCN(C)CC2)cc1 InChI=1S/C16H26N4O/c1-13(2)12-17-18-16(21)14-4-6-15(7-5-14)20-10-8-19(3)9-11-20/h4-7,13,17H,8-12H2,1-3H3,(H,18,21) XAISOELXZHHCPI-UHFFFAOYSA-N 50639885 CHEMBL5563613 Histone deacetylase 8 Human 43 ChEMBL 10.7270/Q2Q81JQ9 38949959 Xiao, Y; Awasthee, N; Liu, Y; Meng, C; He, MY; Hale, S; Karki, R; Lin, Z; Mosterio, M; Garcia, BA; Kridel, R; Liao, D; Zheng, G //0 10/11/2025 University of Florida http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639885 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1996&target=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639885&enzyme=Histone+deacetylase+8&column=ki&startPg=0&Increment=50&submit=Search 177376845 519660288 1 MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVV 3SFH,3SFF,6ODC,6ODB,6ODA,5FCW,1W22,1VKG,1T69,1T67,1T64,3RQD,3MZ3,3F0R,3F07,5VI6 Histone deacetylase 8 HDAC8_HUMAN Q9BY41 A6ND12 A6ND61 A6NET3 A6NJR3 A8MQ62 B4DKN0 B4DV22 Q86VC8 Q9NP76 Q9NYH4