BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
51461518	CC(C)C[C@H](NC(=O)CNC(=O)[C@@H]1CCCN1)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(O)=O |r|	InChI=1S/C36H55N9O9S/c1-20(2)14-26(41-30(47)17-40-31(48)24-11-7-13-38-24)33(50)43-27(15-21-16-39-23-9-4-3-8-22(21)23)34(51)42-25(10-5-6-12-37)32(49)44-28(18-46)35(52)45-29(19-55)36(53)54/h3-4,8-9,16,20,24-29,38-39,46,55H,5-7,10-15,17-19,37H2,1-2H3,(H,40,48)(H,41,47)(H,42,51)(H,43,50)(H,44,49)(H,45,52)(H,53,54)	NPFAUGYEWVKESQ-UHFFFAOYSA-N	50589782	CHEMBL5195622	Glucose-induced degradation protein 4 homolog	Homo sapiens			 1900						ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50589782	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50589782&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search			168289257	482600634							1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51461519	CC1CN=C(Nc2cccc(F)c2)S1 |t:3|	InChI=1S/C10H11FN2S/c1-7-6-12-10(14-7)13-9-4-2-3-8(11)5-9/h2-5,7H,6H2,1H3,(H,12,13)	HACQCQBZFCWXOT-UHFFFAOYSA-N	50589783	CHEMBL1998455	Glucose-induced degradation protein 4 homolog	Homo sapiens		 264000							ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50589783	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50589783&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search			389119	482600635							1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51461520	C[C@H]1CN=C(S1)Nc2cccc(c2)O	InChI=1S/C10H12N2OS/c1-7-6-11-10(14-7)12-8-3-2-4-9(13)5-8/h2-5,7,13H,6H2,1H3,(H,11,12)	WAICHRCMCQSSEP-UHFFFAOYSA-N	50589784	CHEMBL5186109	Glucose-induced degradation protein 4 homolog	Homo sapiens		 148500							ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50589784	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50589784&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	L5X	7U3I	3515862	482600636							1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51461521	CC1CN=C(Nc2ccccc2)S1 |t:3|	InChI=1S/C10H12N2S/c1-8-7-11-10(13-8)12-9-5-3-2-4-6-9/h2-6,8H,7H2,1H3,(H,11,12)	QQURMDYWWNVZAF-UHFFFAOYSA-N	50589785	CHEMBL1600521	Glucose-induced degradation protein 4 homolog	Homo sapiens		 113200							ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50589785	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50589785&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search			383595	482600637							1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51461522	C1Cc2sccc2C(N1)c1ccccc1	InChI=1S/C13H13NS/c1-2-4-10(5-3-1)13-11-7-9-15-12(11)6-8-14-13/h1-5,7,9,13-14H,6,8H2	BKXOJOFWZSFANH-UHFFFAOYSA-N	50589786	CHEMBL2179396	Glucose-induced degradation protein 4 homolog	Homo sapiens		>250000							ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50589786	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50589786&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search			6485298	482600638							1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51461523	C1Cc2occc2C(N1)c1ccccc1	InChI=1S/C13H13NO/c1-2-4-10(5-3-1)13-11-7-9-15-12(11)6-8-14-13/h1-5,7,9,13-14H,6,8H2	QLIPDLZNNHFNKM-UHFFFAOYSA-N	50589787	CHEMBL5179037	Glucose-induced degradation protein 4 homolog	Homo sapiens		 90800							ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50589787	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50589787&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search			70431629	482600639							1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51461524	C1Cc2[nH]ccc2C(N1)c1ccccc1	InChI=1S/C13H14N2/c1-2-4-10(5-3-1)13-11-6-8-14-12(11)7-9-15-13/h1-6,8,13-15H,7,9H2	ZHLMHBOAXFQGHL-UHFFFAOYSA-N	50589788	CHEMBL5188512	Glucose-induced degradation protein 4 homolog	Homo sapiens		 108300							ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50589788	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50589788&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search			83637620	482600640							1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51461525	Nc1ccc(cc1)C1NCCc2sccc12	InChI=1S/C13H14N2S/c14-10-3-1-9(2-4-10)13-11-6-8-16-12(11)5-7-15-13/h1-4,6,8,13,15H,5,7,14H2	YZCMETAKLJEQBV-UHFFFAOYSA-N	50589789	CHEMBL5192951	Glucose-induced degradation protein 4 homolog	Homo sapiens		>250000							ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50589789	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50589789&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search			141917453	482600641							1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51461526	Cc1ccc(cc1)C1NCCc2sccc12	InChI=1S/C14H15NS/c1-10-2-4-11(5-3-10)14-12-7-9-16-13(12)6-8-15-14/h2-5,7,9,14-15H,6,8H2,1H3	XWIVMJSKELKHKK-UHFFFAOYSA-N	50589790	CHEMBL5194502	Glucose-induced degradation protein 4 homolog	Homo sapiens		 55000							ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50589790	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50589790&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search			42773357	482600642							1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51461527	Clc1cccc(c1)C1NCCc2sccc12	InChI=1S/C13H12ClNS/c14-10-3-1-2-9(8-10)13-11-5-7-16-12(11)4-6-15-13/h1-3,5,7-8,13,15H,4,6H2	SGGRXQLNFXCZMO-UHFFFAOYSA-N	50589791	CHEMBL5179578	Glucose-induced degradation protein 4 homolog	Homo sapiens		 49300							ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50589791	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50589791&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search			82087323	482600643							1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51461528	Oc1cccc(c1)C1NCCc2sccc12	InChI=1S/C13H13NOS/c15-10-3-1-2-9(8-10)13-11-5-7-16-12(11)4-6-14-13/h1-3,5,7-8,13-15H,4,6H2	JEKRBOOLABEXKU-UHFFFAOYSA-N	50589792	CHEMBL5205965	Glucose-induced degradation protein 4 homolog	Homo sapiens		>250000							ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50589792	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50589792&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search			165477685	482600644							1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51461529	Nc1cccc(c1)C1NCCc2sccc12	InChI=1S/C13H14N2S/c14-10-3-1-2-9(8-10)13-11-5-7-16-12(11)4-6-15-13/h1-3,5,7-8,13,15H,4,6,14H2	MGAFBFIDMKVPQW-UHFFFAOYSA-N	50589793	CHEMBL5198959	Glucose-induced degradation protein 4 homolog	Homo sapiens		 235300							ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50589793	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50589793&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search			168286821	482600645							1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51461530	COc1cccc(c1)C1NCCc2sccc12	InChI=1S/C14H15NOS/c1-16-11-4-2-3-10(9-11)14-12-6-8-17-13(12)5-7-15-14/h2-4,6,8-9,14-15H,5,7H2,1H3	PINBQFFGXAFUKA-UHFFFAOYSA-N	50589794	CHEMBL5203207	Glucose-induced degradation protein 4 homolog	Homo sapiens		>250000							ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50589794	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50589794&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search			83722357	482600646							1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51461531	Fc1ccccc1C1NCCc2sccc12	InChI=1S/C13H12FNS/c14-11-4-2-1-3-9(11)13-10-6-8-16-12(10)5-7-15-13/h1-4,6,8,13,15H,5,7H2	BTMQBCBKHKAVDG-UHFFFAOYSA-N	50589795	CHEMBL5195783	Glucose-induced degradation protein 4 homolog	Homo sapiens		 149100							ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50589795	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50589795&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search			67357960	482600647							1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51461532	Brc1cccc2C(NCCc12)c1ccccc1	InChI=1S/C15H14BrN/c16-14-8-4-7-13-12(14)9-10-17-15(13)11-5-2-1-3-6-11/h1-8,15,17H,9-10H2	IOHCFGUKWDQVGK-UHFFFAOYSA-N	50589796	CHEMBL5193368	Glucose-induced degradation protein 4 homolog	Homo sapiens		 64800							ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50589796	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50589796&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search			168287417	482600648							1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51461533	c1ccc(cc1)[C@@H]2c3cccc(c3CCN2)N	InChI=1S/C15H16N2/c16-14-8-4-7-13-12(14)9-10-17-15(13)11-5-2-1-3-6-11/h1-8,15,17H,9-10,16H2	SJAZZYOCOXNSIX-UHFFFAOYSA-N	50589797	CHEMBL5189044	Glucose-induced degradation protein 4 homolog	Homo sapiens		 18900							ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50589797	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50589797&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	L6F	7U3G	165412818	482600649							1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51461534	COc1ccc2C(CCCc2c1)c1ccccc1	InChI=1S/C17H18O/c1-18-15-10-11-17-14(12-15)8-5-9-16(17)13-6-3-2-4-7-13/h2-4,6-7,10-12,16H,5,8-9H2,1H3	ZFOMLKXVQFNZPD-UHFFFAOYSA-N	50589798	CHEMBL5181147	Glucose-induced degradation protein 4 homolog	Homo sapiens		>250000							ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50589798	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50589798&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search			10977504	482600650							1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51461535	COc1cccc(c1)C1CCCc2ccccc12	InChI=1S/C17H18O/c1-18-15-9-4-8-14(12-15)17-11-5-7-13-6-2-3-10-16(13)17/h2-4,6,8-10,12,17H,5,7,11H2,1H3	NGEALMXPYCYLNO-UHFFFAOYSA-N	50589799	CHEMBL5175764	Glucose-induced degradation protein 4 homolog	Homo sapiens		 35500							ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50589799	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50589799&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search			138512234	482600651							1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51461536	COc1ccc(cc1)C1NCCc2ccccc12	InChI=1S/C16H17NO/c1-18-14-8-6-13(7-9-14)16-15-5-3-2-4-12(15)10-11-17-16/h2-9,16-17H,10-11H2,1H3	FSFZUYODRIULLG-UHFFFAOYSA-N	50017043	CHEMBL21484::1-(4-Methoxy-phenyl)-1,2,3,4-tetrahydro-isoquinoline	Glucose-induced degradation protein 4 homolog	Homo sapiens		 89800							ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50017043	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50017043&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search			12267903	103928371		CHEMBL21484					1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51461537	CC(C)C[C@H](NC(=O)CNC(=O)[C@@H]1CCCN1)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(O)=O |r|	InChI=1S/C24H33N5O5/c1-14(2)10-19(28-21(30)13-27-22(31)18-8-5-9-25-18)23(32)29-20(24(33)34)11-15-12-26-17-7-4-3-6-16(15)17/h3-4,6-7,12,14,18-20,25-26H,5,8-11,13H2,1-2H3,(H,27,31)(H,28,30)(H,29,32)(H,33,34)	FVXAFGNQOGEQLF-UHFFFAOYSA-N	50589800	CHEMBL5197897	Glucose-induced degradation protein 4 homolog	Homo sapiens		 21400							ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50589800	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50589800&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search			132451813	482600652							1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51461538	CNC(=O)[C@H](CCc1ccccc1)NC(=O)[C@@H](c2cccs2)NC(=O)CNCc3ccc(cc3OC)OC	InChI=1S/C28H34N4O5S/c1-29-27(34)22(14-11-19-8-5-4-6-9-19)31-28(35)26(24-10-7-15-38-24)32-25(33)18-30-17-20-12-13-21(36-2)16-23(20)37-3/h4-10,12-13,15-16,22,26,30H,11,14,17-18H2,1-3H3,(H,29,34)(H,31,35)(H,32,33)	TUQBDKJHGPFTTD-UHFFFAOYSA-N	50589801	CHEMBL5208789	Glucose-induced degradation protein 4 homolog	Homo sapiens		 5400							ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50589801	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50589801&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	L6U	7U3J	165180701	482600653							1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51461539	CCCCNCC(=O)N[C@H](Cc1ccc(cc1)C(C)(C)C)C(=O)N[C@@H](Cc2cccc(c2)OC)C(=O)NC	InChI=1S/C30H44N4O4/c1-7-8-16-32-20-27(35)33-26(18-21-12-14-23(15-13-21)30(2,3)4)29(37)34-25(28(36)31-5)19-22-10-9-11-24(17-22)38-6/h9-15,17,25-26,32H,7-8,16,18-20H2,1-6H3,(H,31,36)(H,33,35)(H,34,37)	VWEUUVZMTLGMMV-UHFFFAOYSA-N	50589802	CHEMBL5177515	Glucose-induced degradation protein 4 homolog	Homo sapiens		 4700							ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50589802	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50589802&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	L73	7U3K	165180702	482600654							1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51461540	CNC(=O)[C@H](CC1CCCCC1)NC(=O)[C@@H](NC(=O)[C@H]1NC[C@@H]1c1ccccc1)c1ccsc1 |r|	InChI=1S/C26H34N4O3S/c1-27-24(31)21(14-17-8-4-2-5-9-17)29-25(32)22(19-12-13-34-16-19)30-26(33)23-20(15-28-23)18-10-6-3-7-11-18/h3,6-7,10-13,16-17,20-23,28H,2,4-5,8-9,14-15H2,1H3,(H,27,31)(H,29,32)(H,30,33)	PDYQXJJDLFVHPA-UHFFFAOYSA-N	50589803	CHEMBL5208155	Glucose-induced degradation protein 4 homolog	Homo sapiens		 187500							ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50589803	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50589803&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search			168295743	482600655							1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51461541	Cc1ccc(cc1)C[C@@H](C(=O)NC)NC(=O)[C@@H](C/C=C/c2ccccc2)NC(=O)CNCc3ccccc3	InChI=1S/C31H36N4O3/c1-23-16-18-25(19-17-23)20-28(30(37)32-2)35-31(38)27(15-9-14-24-10-5-3-6-11-24)34-29(36)22-33-21-26-12-7-4-8-13-26/h3-14,16-19,27-28,33H,15,20-22H2,1-2H3,(H,32,37)(H,34,36)(H,35,38)	RVVSAVHSOSLVLN-UHFFFAOYSA-N	50589804	CHEMBL5191076	Glucose-induced degradation protein 4 homolog	Homo sapiens		 4800							ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50589804	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50589804&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	L4X	7U3L	165180703	482600656							1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51461542	CNC(=O)C1N(Cc2ccccc12)C(=O)[C@@H](Cc1c(C)[nH]c2ccccc12)NC(=O)CNCCOc1ccc(C)cc1 |r|	InChI=1S/C33H37N5O4/c1-21-12-14-24(15-13-21)42-17-16-35-19-30(39)37-29(18-27-22(2)36-28-11-7-6-10-26(27)28)33(41)38-20-23-8-4-5-9-25(23)31(38)32(40)34-3/h4-15,29,31,35-36H,16-20H2,1-3H3,(H,34,40)(H,37,39)	CMPSRIGANDKPDV-UHFFFAOYSA-N	50589805	CHEMBL5191415	Glucose-induced degradation protein 4 homolog	Homo sapiens		 187500							ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50589805	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50589805&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search			168286053	482600657							1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51461543	c1ccc2c(c1)cc([nH]2)CNCC(=O)NC3CCC(CC3)c4[nH]c5ccccc5n4	InChI=1S/C24H27N5O/c30-23(15-25-14-19-13-17-5-1-2-6-20(17)26-19)27-18-11-9-16(10-12-18)24-28-21-7-3-4-8-22(21)29-24/h1-8,13,16,18,25-26H,9-12,14-15H2,(H,27,30)(H,28,29)	HLHNFJNSQZZUNW-UHFFFAOYSA-N	50589806	CHEMBL5177469	Glucose-induced degradation protein 4 homolog	Homo sapiens		 4100							ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50589806	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50589806&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search			162396665	482600658							1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51461544	c1ccc(cc1)[C@@H]2c3cccc(c3CCN2)N	InChI=1S/C15H16N2/c16-14-8-4-7-13-12(14)9-10-17-15(13)11-5-2-1-3-6-11/h1-8,15,17H,9-10,16H2	SJAZZYOCOXNSIX-UHFFFAOYSA-N	50589797	CHEMBL5189044	Glucose-induced degradation protein 4 homolog	Homo sapiens			 17000						ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50589797	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50589797&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	L6F	7U3G	165412818	482600649							1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51461545	C[C@H]1CN=C(S1)Nc2cccc(c2)O	InChI=1S/C10H12N2OS/c1-7-6-11-10(14-7)12-8-3-2-4-9(13)5-8/h2-5,7,13H,6H2,1H3,(H,11,12)	WAICHRCMCQSSEP-UHFFFAOYSA-N	50589784	CHEMBL5186109	Glucose-induced degradation protein 4 homolog	Homo sapiens			 110000						ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50589784	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50589784&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	L5X	7U3I	3515862	482600636							1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51461546	c1ccc2c(c1)cc([nH]2)CNCC(=O)NC3CCC(CC3)c4[nH]c5ccccc5n4	InChI=1S/C24H27N5O/c30-23(15-25-14-19-13-17-5-1-2-6-20(17)26-19)27-18-11-9-16(10-12-18)24-28-21-7-3-4-8-22(21)29-24/h1-8,13,16,18,25-26H,9-12,14-15H2,(H,27,30)(H,28,29)	HLHNFJNSQZZUNW-UHFFFAOYSA-N	50589806	CHEMBL5177469	Glucose-induced degradation protein 4 homolog	Homo sapiens			 80						ChEMBL		10.7270/Q2JD51RW	36117290			Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F	10/13/2022	6/18/2023	Lunenfeld-Tanenbaum Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50589806	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001177&target=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50589806&enzyme=Glucose-induced+degradation+protein+4+homolog&column=ki&startPg=0&Increment=50&submit=Search			162396665	482600658							1	MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR	7NSC,7Q4Y,6CCU,6CCR,7Q50,8V1P,8X7H,8X7G,7U3L,7U3K,7U3J,7U3I,7U3H,7U3G,7U3F,7U3E,7SLZ,6WZZ,6WZX,6CDG,6CDC,6CD9,6CD8,6CCT	Glucose-induced degradation protein 4 homolog	GID4_HUMAN	Q8IVV7	Q8TEB5 Q9BW50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
