BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
50983339	NCC1(CCOCC1)c1cccc(c1)-c1ccc(N)c(c1)C#N	InChI=1S/C19H21N3O/c20-12-16-10-15(4-5-18(16)22)14-2-1-3-17(11-14)19(13-21)6-8-23-9-7-19/h1-5,10-11H,6-9,13,21-22H2	BUTIEFAPHPBHTK-UHFFFAOYSA-N	50405328	CHEMBL5278563	cAMP-dependent protein kinase catalytic subunit gamma	Homo sapiens	 390200								ChEMBL		10.7270/Q2TX3KK5	36069712			Müller, J; Klein, R; Tarkhanova, O; Gryniukova, A; Borysko, P; Merkl, S; Ruf, M; Neumann, A; Gastreich, M; Moroz, YS; Klebe, G; Glinca, S	12/8/2022	4/18/2024	Crystalsfirst	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50405328	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006643&target=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50405328&enzyme=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search			164890083	163354352		CHEMBL415511					1	MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF		cAMP-dependent protein kinase catalytic subunit gamma	KAPCG_HUMAN	P22612	O60850 Q5VZ02 Q86YI1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50983340	CN(C)Cc1ccc(F)c(c1)-c1ccc2c(C#N)c(N)[nH]c2c1	InChI=1S/C18H17FN4/c1-23(2)10-11-3-6-16(19)14(7-11)12-4-5-13-15(9-20)18(21)22-17(13)8-12/h3-8,22H,10,21H2,1-2H3	GRLWZOYXIMBFRU-UHFFFAOYSA-N	50405329	CHEMBL5279025	cAMP-dependent protein kinase catalytic subunit gamma	Homo sapiens	 174400								ChEMBL		10.7270/Q2TX3KK5	36069712			Müller, J; Klein, R; Tarkhanova, O; Gryniukova, A; Borysko, P; Merkl, S; Ruf, M; Neumann, A; Gastreich, M; Moroz, YS; Klebe, G; Glinca, S	12/8/2022	4/18/2024	Crystalsfirst	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50405329	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006643&target=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50405329&enzyme=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search			155969802	163354353		CHEMBL540096					1	MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF		cAMP-dependent protein kinase catalytic subunit gamma	KAPCG_HUMAN	P22612	O60850 Q5VZ02 Q86YI1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50983342	NCCC1CN(C(=O)c2ccc(cc2)C(N)=O)c2ccccc12	InChI=1S/C18H19N3O2/c19-10-9-14-11-21(16-4-2-1-3-15(14)16)18(23)13-7-5-12(6-8-13)17(20)22/h1-8,14H,9-11,19H2,(H2,20,22)	JWXCOQAUXNWDCL-UHFFFAOYSA-N	50405331	CHEMBL5276685	cAMP-dependent protein kinase catalytic subunit gamma	Homo sapiens	 5000000								ChEMBL		10.7270/Q2TX3KK5	36069712			Müller, J; Klein, R; Tarkhanova, O; Gryniukova, A; Borysko, P; Merkl, S; Ruf, M; Neumann, A; Gastreich, M; Moroz, YS; Klebe, G; Glinca, S	12/8/2022	4/18/2024	Crystalsfirst	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50405331	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006643&target=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50405331&enzyme=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search			166245160	163354355		CHEMBL356950					1	MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF		cAMP-dependent protein kinase catalytic subunit gamma	KAPCG_HUMAN	P22612	O60850 Q5VZ02 Q86YI1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50983733	NC1C=C(C=NC1=O)C(F)(F)F |c:2,4|	InChI=1S/C6H5F3N2O/c7-6(8,9)3-1-4(10)5(12)11-2-3/h1-2,4H,10H2	JIEILLLTPOZAEH-UHFFFAOYSA-N	50405332	CHEMBL5285449	cAMP-dependent protein kinase catalytic subunit gamma	Homo sapiens	 10000000								ChEMBL		10.7270/Q2TX3KK5	36069712			Müller, J; Klein, R; Tarkhanova, O; Gryniukova, A; Borysko, P; Merkl, S; Ruf, M; Neumann, A; Gastreich, M; Moroz, YS; Klebe, G; Glinca, S	12/8/2022	4/18/2024	Crystalsfirst	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50405332	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006643&target=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50405332&enzyme=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search			171347210	163354356		CHEMBL357708					1	MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF		cAMP-dependent protein kinase catalytic subunit gamma	KAPCG_HUMAN	P22612	O60850 Q5VZ02 Q86YI1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50983734	NC1CCN(Cc2cccc(c2)-c2ccc3c(O)nccc3c2)C1	InChI=1S/C20H21N3O/c21-18-7-9-23(13-18)12-14-2-1-3-15(10-14)16-4-5-19-17(11-16)6-8-22-20(19)24/h1-6,8,10-11,18H,7,9,12-13,21H2,(H,22,24)	KJCKVXKGXLPESD-UHFFFAOYSA-N	50405333	CHEMBL5270570	cAMP-dependent protein kinase catalytic subunit gamma	Homo sapiens	 744								ChEMBL		10.7270/Q2TX3KK5	36069712			Müller, J; Klein, R; Tarkhanova, O; Gryniukova, A; Borysko, P; Merkl, S; Ruf, M; Neumann, A; Gastreich, M; Moroz, YS; Klebe, G; Glinca, S	12/8/2022	4/18/2024	Crystalsfirst	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50405333	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006643&target=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50405333&enzyme=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search			171344147	163354357		CHEMBL148957					1	MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF		cAMP-dependent protein kinase catalytic subunit gamma	KAPCG_HUMAN	P22612	O60850 Q5VZ02 Q86YI1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50983735	O=c1[nH]ccc2cc(ccc12)-c1cccc(Cn2cccn2)c1	InChI=1S/C19H15N3O/c23-19-18-6-5-16(12-17(18)7-9-20-19)15-4-1-3-14(11-15)13-22-10-2-8-21-22/h1-12H,13H2,(H,20,23)	MHEYMIAOFDXJPS-UHFFFAOYSA-N	50405334	CHEMBL5280829	cAMP-dependent protein kinase catalytic subunit gamma	Homo sapiens	 154700								ChEMBL		10.7270/Q2TX3KK5	36069712			Müller, J; Klein, R; Tarkhanova, O; Gryniukova, A; Borysko, P; Merkl, S; Ruf, M; Neumann, A; Gastreich, M; Moroz, YS; Klebe, G; Glinca, S	12/8/2022	4/18/2024	Crystalsfirst	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50405334	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006643&target=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50405334&enzyme=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search			155969785	163354358		CHEMBL543454					1	MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF		cAMP-dependent protein kinase catalytic subunit gamma	KAPCG_HUMAN	P22612	O60850 Q5VZ02 Q86YI1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50983736	Cc1cc(c(o1)C)C(=O)Nc2ccncc2	InChI=1S/C12H12N2O2/c1-8-7-11(9(2)16-8)12(15)14-10-3-5-13-6-4-10/h3-7H,1-2H3,(H,13,14,15)	LSWLYNGTJMNMRF-UHFFFAOYSA-N	50405335	CHEMBL2357735	cAMP-dependent protein kinase catalytic subunit gamma	Homo sapiens	 20000000								ChEMBL		10.7270/Q2TX3KK5	36069712			Müller, J; Klein, R; Tarkhanova, O; Gryniukova, A; Borysko, P; Merkl, S; Ruf, M; Neumann, A; Gastreich, M; Moroz, YS; Klebe, G; Glinca, S	12/8/2022	4/18/2024	Crystalsfirst	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50405335	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006643&target=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50405335&enzyme=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search	47V		17248960	163354359		CHEMBL151747					1	MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF		cAMP-dependent protein kinase catalytic subunit gamma	KAPCG_HUMAN	P22612	O60850 Q5VZ02 Q86YI1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50983737	I.COCC1CN=C(N1)N1CCN(CC1)c1ccncc1Cl |c:5|	InChI=1S/C14H20ClN5O.HI/c1-21-10-11-8-17-14(18-11)20-6-4-19(5-7-20)13-2-3-16-9-12(13)15;/h2-3,9,11H,4-8,10H2,1H3,(H,17,18);1H	PAIRPSCJNOFAPE-UHFFFAOYSA-N	50405336	CHEMBL5277116	cAMP-dependent protein kinase catalytic subunit gamma	Homo sapiens	 139300								ChEMBL		10.7270/Q2TX3KK5	36069712			Müller, J; Klein, R; Tarkhanova, O; Gryniukova, A; Borysko, P; Merkl, S; Ruf, M; Neumann, A; Gastreich, M; Moroz, YS; Klebe, G; Glinca, S	12/8/2022	4/18/2024	Crystalsfirst	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50405336	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006643&target=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50405336&enzyme=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search			166326281	163354360		CHEMBL147344					1	MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF		cAMP-dependent protein kinase catalytic subunit gamma	KAPCG_HUMAN	P22612	O60850 Q5VZ02 Q86YI1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50983738	COC1(CNC(=O)N2CCN(CC2)c2ccncc2C)CCCS(=O)(=O)C1	InChI=1S/C18H28N4O4S/c1-15-12-19-6-4-16(15)21-7-9-22(10-8-21)17(23)20-13-18(26-2)5-3-11-27(24,25)14-18/h4,6,12H,3,5,7-11,13-14H2,1-2H3,(H,20,23)	NUIYYNJXJOJUSI-UHFFFAOYSA-N	50405337	CHEMBL5268186	cAMP-dependent protein kinase catalytic subunit gamma	Homo sapiens	 354300								ChEMBL		10.7270/Q2TX3KK5	36069712			Müller, J; Klein, R; Tarkhanova, O; Gryniukova, A; Borysko, P; Merkl, S; Ruf, M; Neumann, A; Gastreich, M; Moroz, YS; Klebe, G; Glinca, S	12/8/2022	4/18/2024	Crystalsfirst	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50405337	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006643&target=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50405337&enzyme=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search			171342945	163354361		CHEMBL542258					1	MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF		cAMP-dependent protein kinase catalytic subunit gamma	KAPCG_HUMAN	P22612	O60850 Q5VZ02 Q86YI1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50983739	C1CCN(C1)c2c(c([nH]n2)N)C#N	InChI=1S/C8H11N5/c9-5-6-7(10)11-12-8(6)13-3-1-2-4-13/h1-4H2,(H3,10,11,12)	RQDSNKYYHIZWJX-UHFFFAOYSA-N	50405338	CHEMBL2393369	cAMP-dependent protein kinase catalytic subunit gamma	Homo sapiens	 5000000								ChEMBL		10.7270/Q2TX3KK5	36069712			Müller, J; Klein, R; Tarkhanova, O; Gryniukova, A; Borysko, P; Merkl, S; Ruf, M; Neumann, A; Gastreich, M; Moroz, YS; Klebe, G; Glinca, S	12/8/2022	4/18/2024	Crystalsfirst	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50405338	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006643&target=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50405338&enzyme=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search	E9Q		4962701	163354362		CHEMBL150009					1	MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF		cAMP-dependent protein kinase catalytic subunit gamma	KAPCG_HUMAN	P22612	O60850 Q5VZ02 Q86YI1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50983740	COCC1CCC(CC1)NC(=O)c1ccc2C(=O)NCCc2c1 |(-7.31,-4.63,;-5.99,-3.86,;-5.99,-2.32,;-4.67,-1.55,;-3.34,-2.31,;-2.02,-1.54,;-2.02,0,;-3.35,.78,;-4.67,-.01,;-.69,.77,;.64,.01,;.64,-1.52,;1.97,.78,;1.97,2.32,;3.3,3.11,;4.63,2.32,;5.97,3.1,;5.97,4.63,;7.31,2.31,;7.31,.77,;5.96,0,;4.63,.78,;3.3,.01,)|	InChI=1S/C18H24N2O3/c1-23-11-12-2-5-15(6-3-12)20-17(21)14-4-7-16-13(10-14)8-9-19-18(16)22/h4,7,10,12,15H,2-3,5-6,8-9,11H2,1H3,(H,19,22)(H,20,21)	FGOLQLVGKOQINK-UHFFFAOYSA-N	50405339	CHEMBL5286003	cAMP-dependent protein kinase catalytic subunit gamma	Homo sapiens	 6219000								ChEMBL		10.7270/Q2TX3KK5	36069712			Müller, J; Klein, R; Tarkhanova, O; Gryniukova, A; Borysko, P; Merkl, S; Ruf, M; Neumann, A; Gastreich, M; Moroz, YS; Klebe, G; Glinca, S	12/8/2022	4/18/2024	Crystalsfirst	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50405339	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006643&target=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50405339&enzyme=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search			155956326	163354363		CHEMBL149156					1	MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF		cAMP-dependent protein kinase catalytic subunit gamma	KAPCG_HUMAN	P22612	O60850 Q5VZ02 Q86YI1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50983741	Nc1ccc(cc1C#N)-c1cccc(c1)C1COCCN1	InChI=1S/C17H17N3O/c18-10-15-9-13(4-5-16(15)19)12-2-1-3-14(8-12)17-11-21-7-6-20-17/h1-5,8-9,17,20H,6-7,11,19H2	RZHAJCGWKKXEGM-UHFFFAOYSA-N	50405340	CHEMBL5276693	cAMP-dependent protein kinase catalytic subunit gamma	Homo sapiens	 955000								ChEMBL		10.7270/Q2TX3KK5	36069712			Müller, J; Klein, R; Tarkhanova, O; Gryniukova, A; Borysko, P; Merkl, S; Ruf, M; Neumann, A; Gastreich, M; Moroz, YS; Klebe, G; Glinca, S	12/8/2022	4/18/2024	Crystalsfirst	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50405340	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006643&target=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50405340&enzyme=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search			166326283	163354364		CHEMBL146905					1	MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF		cAMP-dependent protein kinase catalytic subunit gamma	KAPCG_HUMAN	P22612	O60850 Q5VZ02 Q86YI1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50983742	NC(CC1CC1)Cc1cccc(c1)-c1ccc(N)c(c1)C#N	InChI=1S/C19H21N3/c20-12-17-11-16(6-7-19(17)22)15-3-1-2-14(8-15)10-18(21)9-13-4-5-13/h1-3,6-8,11,13,18H,4-5,9-10,21-22H2	ICUIGUOVLVHLHV-UHFFFAOYSA-N	50405341	CHEMBL5287370	cAMP-dependent protein kinase catalytic subunit gamma	Homo sapiens	 540000								ChEMBL		10.7270/Q2TX3KK5	36069712			Müller, J; Klein, R; Tarkhanova, O; Gryniukova, A; Borysko, P; Merkl, S; Ruf, M; Neumann, A; Gastreich, M; Moroz, YS; Klebe, G; Glinca, S	12/8/2022	4/18/2024	Crystalsfirst	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50405341	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006643&target=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50405341&enzyme=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search			166312406	163354365		CHEMBL148731					1	MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF		cAMP-dependent protein kinase catalytic subunit gamma	KAPCG_HUMAN	P22612	O60850 Q5VZ02 Q86YI1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50983743	Nc1ccc(cc1C#N)-c1cccc(c1)C1CNCCO1	InChI=1S/C17H17N3O/c18-10-15-9-13(4-5-16(15)19)12-2-1-3-14(8-12)17-11-20-6-7-21-17/h1-5,8-9,17,20H,6-7,11,19H2	RKLBLNPSMVENJK-UHFFFAOYSA-N	50405342	CHEMBL5273882	cAMP-dependent protein kinase catalytic subunit gamma	Homo sapiens	 2101000								ChEMBL		10.7270/Q2TX3KK5	36069712			Müller, J; Klein, R; Tarkhanova, O; Gryniukova, A; Borysko, P; Merkl, S; Ruf, M; Neumann, A; Gastreich, M; Moroz, YS; Klebe, G; Glinca, S	12/8/2022	4/18/2024	Crystalsfirst	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50405342	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006643&target=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50405342&enzyme=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search			171356144	163354366		CHEMBL149135					1	MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF		cAMP-dependent protein kinase catalytic subunit gamma	KAPCG_HUMAN	P22612	O60850 Q5VZ02 Q86YI1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50983744	COc1cc(NCCNc2ccnc(N)c2C#N)cc(OC)c1	InChI=1S/C16H19N5O2/c1-22-12-7-11(8-13(9-12)23-2)19-5-6-20-15-3-4-21-16(18)14(15)10-17/h3-4,7-9,19H,5-6H2,1-2H3,(H3,18,20,21)	VMVLCQRGDMPLOD-UHFFFAOYSA-N	50405343	CHEMBL5279009	cAMP-dependent protein kinase catalytic subunit gamma	Homo sapiens	 588000								ChEMBL		10.7270/Q2TX3KK5	36069712			Müller, J; Klein, R; Tarkhanova, O; Gryniukova, A; Borysko, P; Merkl, S; Ruf, M; Neumann, A; Gastreich, M; Moroz, YS; Klebe, G; Glinca, S	12/8/2022	4/18/2024	Crystalsfirst	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50405343	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006643&target=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50405343&enzyme=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search			155969783	163354367		CHEMBL545564					1	MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF		cAMP-dependent protein kinase catalytic subunit gamma	KAPCG_HUMAN	P22612	O60850 Q5VZ02 Q86YI1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50983745	CC1(CS(=O)(=O)N2CCc3c(C2)sc(N)c3C#N)CC1(F)F	InChI=1S/C13H15F2N3O2S2/c1-12(6-13(12,14)15)7-22(19,20)18-3-2-8-9(4-16)11(17)21-10(8)5-18/h2-3,5-7,17H2,1H3	UXKAXHBHVUJXPZ-UHFFFAOYSA-N	50405344	CHEMBL5278260	cAMP-dependent protein kinase catalytic subunit gamma	Homo sapiens	 4743000								ChEMBL		10.7270/Q2TX3KK5	36069712			Müller, J; Klein, R; Tarkhanova, O; Gryniukova, A; Borysko, P; Merkl, S; Ruf, M; Neumann, A; Gastreich, M; Moroz, YS; Klebe, G; Glinca, S	12/8/2022	4/18/2024	Crystalsfirst	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50405344	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006643&target=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50405344&enzyme=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search			155957690	163354368		CHEMBL357455					1	MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF		cAMP-dependent protein kinase catalytic subunit gamma	KAPCG_HUMAN	P22612	O60850 Q5VZ02 Q86YI1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50983746	[#7]-c1ccnc(\[#6]=[#6]-2\[#6]-[#6]-[#7]-[#6]-[#6]-2)c1C#N	InChI=1S/C12H2N4/c13-8-10-11(14)3-6-16-12(10)7-9-1-4-15-5-2-9/h3,6H	DNQIIWXUWNKWMP-UHFFFAOYSA-N	50405345	CHEMBL5273503	cAMP-dependent protein kinase catalytic subunit gamma	Homo sapiens	 6379000								ChEMBL		10.7270/Q2TX3KK5	36069712			Müller, J; Klein, R; Tarkhanova, O; Gryniukova, A; Borysko, P; Merkl, S; Ruf, M; Neumann, A; Gastreich, M; Moroz, YS; Klebe, G; Glinca, S	12/8/2022	4/18/2024	Crystalsfirst	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50405345	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006643&target=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50405345&enzyme=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search			171344890	163354369		CHEMBL149157					1	MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF		cAMP-dependent protein kinase catalytic subunit gamma	KAPCG_HUMAN	P22612	O60850 Q5VZ02 Q86YI1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50983747	Nc1ccc(\C=C2\CCCNC2)c(Cl)c1C#N	InChI=1S/C13H14ClN3/c14-13-10(3-4-12(16)11(13)7-15)6-9-2-1-5-17-8-9/h3-4,6,17H,1-2,5,8,16H2	YOLYWAXWUJIFMT-UHFFFAOYSA-N	50405346	CHEMBL5266306	cAMP-dependent protein kinase catalytic subunit gamma	Homo sapiens	 85000								ChEMBL		10.7270/Q2TX3KK5	36069712			Müller, J; Klein, R; Tarkhanova, O; Gryniukova, A; Borysko, P; Merkl, S; Ruf, M; Neumann, A; Gastreich, M; Moroz, YS; Klebe, G; Glinca, S	12/8/2022	4/18/2024	Crystalsfirst	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50405346	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006643&target=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50405346&enzyme=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search			164890084	163354370		CHEMBL440176					1	MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF		cAMP-dependent protein kinase catalytic subunit gamma	KAPCG_HUMAN	P22612	O60850 Q5VZ02 Q86YI1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50983748	CCn1cc(cn1)-c1csc2c1cc[nH]c2=O	InChI=1S/C12H11N3OS/c1-2-15-6-8(5-14-15)10-7-17-11-9(10)3-4-13-12(11)16/h3-7H,2H2,1H3,(H,13,16)	OKBMUQCANAJSRW-UHFFFAOYSA-N	50405347	CHEMBL5281989	cAMP-dependent protein kinase catalytic subunit gamma	Homo sapiens	 1423000								ChEMBL		10.7270/Q2TX3KK5	36069712			Müller, J; Klein, R; Tarkhanova, O; Gryniukova, A; Borysko, P; Merkl, S; Ruf, M; Neumann, A; Gastreich, M; Moroz, YS; Klebe, G; Glinca, S	12/8/2022	4/18/2024	Crystalsfirst	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50405347	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006643&target=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50405347&enzyme=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search			155969788	163354371		CHEMBL539058					1	MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF		cAMP-dependent protein kinase catalytic subunit gamma	KAPCG_HUMAN	P22612	O60850 Q5VZ02 Q86YI1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50983749	N[C@@H]1CCN(Cc2cccc(c2)-c2ccc3c(O)nccc3c2)C1 |r|	InChI=1S/C20H21N3O/c21-18-7-9-23(13-18)12-14-2-1-3-15(10-14)16-4-5-19-17(11-16)6-8-22-20(19)24/h1-6,8,10-11,18H,7,9,12-13,21H2,(H,22,24)	KJCKVXKGXLPESD-UHFFFAOYSA-N	50405348	CHEMBL5280643	cAMP-dependent protein kinase catalytic subunit gamma	Homo sapiens	 3000								ChEMBL		10.7270/Q2TX3KK5	36069712			Müller, J; Klein, R; Tarkhanova, O; Gryniukova, A; Borysko, P; Merkl, S; Ruf, M; Neumann, A; Gastreich, M; Moroz, YS; Klebe, G; Glinca, S	12/8/2022	4/18/2024	Crystalsfirst	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50405348	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006643&target=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50405348&enzyme=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search			164890085	163354372		CHEMBL358868					1	MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF		cAMP-dependent protein kinase catalytic subunit gamma	KAPCG_HUMAN	P22612	O60850 Q5VZ02 Q86YI1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50983750	N[C@H]1CCN(Cc2cccc(c2)-c2ccc3c(O)nccc3c2)C1 |r|	InChI=1S/C20H21N3O/c21-18-7-9-23(13-18)12-14-2-1-3-15(10-14)16-4-5-19-17(11-16)6-8-22-20(19)24/h1-6,8,10-11,18H,7,9,12-13,21H2,(H,22,24)	KJCKVXKGXLPESD-UHFFFAOYSA-N	50405349	CHEMBL5271837	cAMP-dependent protein kinase catalytic subunit gamma	Homo sapiens	 740								ChEMBL		10.7270/Q2TX3KK5	36069712			Müller, J; Klein, R; Tarkhanova, O; Gryniukova, A; Borysko, P; Merkl, S; Ruf, M; Neumann, A; Gastreich, M; Moroz, YS; Klebe, G; Glinca, S	12/8/2022	4/18/2024	Crystalsfirst	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50405349	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006643&target=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50405349&enzyme=cAMP-dependent+protein+kinase+catalytic+subunit+gamma&column=ki&startPg=0&Increment=50&submit=Search			166423104	163354373		CHEMBL148833					1	MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF		cAMP-dependent protein kinase catalytic subunit gamma	KAPCG_HUMAN	P22612	O60850 Q5VZ02 Q86YI1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
