BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 51482091 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2NC(=O)Nc2ccccc2)c(F)c1 InChI=1S/C18H17F2N3O3/c1-26-11-7-13(19)15(14(20)8-11)12-9-21-17(24)16(12)23-18(25)22-10-5-3-2-4-6-10/h2-8,12,16H,9H2,1H3,(H,21,24)(H2,22,23,25)/t12-,16-/m0/s1 FJZNNKJZHQFMCK-LRDDRELGSA-N 50559829 CHEMBL4784510 N-formyl peptide receptor 2 Homo sapiens 5.0 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50559829 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2200&target=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50559829&enzyme=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 122583088 461830221 1 METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM 6OMM,7T6S,7T6U,7T6V N-formyl peptide receptor 2 FPR2_HUMAN P25090 A8K3E2 51482092 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2Nc2nc3ccccc3[nH]2)c(F)c1 50597236 CHEMBL5186339 N-formyl peptide receptor 2 Homo sapiens 1300 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597236 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2200&target=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597236&enzyme=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 168282661 482608088 1 METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM 6OMM,7T6S,7T6U,7T6V N-formyl peptide receptor 2 FPR2_HUMAN P25090 A8K3E2 51482093 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2c2nc3ccccc3[nH]2)c(F)c1 50597237 CHEMBL5208504 N-formyl peptide receptor 2 Homo sapiens 680 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597237 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2200&target=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597237&enzyme=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 168297721 482608089 1 METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM 6OMM,7T6S,7T6U,7T6V N-formyl peptide receptor 2 FPR2_HUMAN P25090 A8K3E2 51482094 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2Nc2nnc(o2)-c2ccccc2)c(F)c1 InChI=1S/C19H16F2N4O3/c1-27-11-7-13(20)15(14(21)8-11)12-9-22-17(26)16(12)23-19-25-24-18(28-19)10-5-3-2-4-6-10/h2-8,12,16H,9H2,1H3,(H,22,26)(H,23,25)/t12-,16-/m0/s1 QFWADSLRJZHARC-LRDDRELGSA-N 50597238 CHEMBL5187399 N-formyl peptide receptor 2 Homo sapiens 250 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597238 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2200&target=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597238&enzyme=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 162425412 482608090 1 METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM 6OMM,7T6S,7T6U,7T6V N-formyl peptide receptor 2 FPR2_HUMAN P25090 A8K3E2 51482095 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2c2nc3cc(Cl)ccc3[nH]2)c(F)c1 50597239 CHEMBL5169641 N-formyl peptide receptor 2 Homo sapiens 110 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597239 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2200&target=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597239&enzyme=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 168270850 482608091 1 METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM 6OMM,7T6S,7T6U,7T6V N-formyl peptide receptor 2 FPR2_HUMAN P25090 A8K3E2 51482096 COc1ccc2[nH]c(nc2c1)[C@H]1[C@@H](CNC1=O)c1c(F)cc(OC)cc1F 50597240 CHEMBL5208024 N-formyl peptide receptor 2 Homo sapiens >5000 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597240 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2200&target=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597240&enzyme=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 168297040 482608092 1 METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM 6OMM,7T6S,7T6U,7T6V N-formyl peptide receptor 2 FPR2_HUMAN P25090 A8K3E2 51482097 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2c2nc3c(Cl)cccc3[nH]2)c(F)c1 50597241 CHEMBL5195406 N-formyl peptide receptor 2 Homo sapiens >10000 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597241 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2200&target=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597241&enzyme=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 168286682 482608093 1 METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM 6OMM,7T6S,7T6U,7T6V N-formyl peptide receptor 2 FPR2_HUMAN P25090 A8K3E2 51482098 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2c2nc3cc(Cl)cnc3[nH]2)c(F)c1 50597242 CHEMBL5185842 N-formyl peptide receptor 2 Homo sapiens 40 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597242 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2200&target=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597242&enzyme=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 168282219 482608094 1 METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM 6OMM,7T6S,7T6U,7T6V N-formyl peptide receptor 2 FPR2_HUMAN P25090 A8K3E2 51482099 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2c2nc3nc(Cl)ccc3[nH]2)c(F)c1 50597243 CHEMBL5204594 N-formyl peptide receptor 2 Homo sapiens 2300 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597243 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2200&target=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597243&enzyme=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 168295570 482608095 1 METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM 6OMM,7T6S,7T6U,7T6V N-formyl peptide receptor 2 FPR2_HUMAN P25090 A8K3E2 51482100 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2Nc2nnc(o2)-c2ccc(Cl)cc2)c(F)c1 InChI=1S/C19H15ClF2N4O3/c1-28-11-6-13(21)15(14(22)7-11)12-8-23-17(27)16(12)24-19-26-25-18(29-19)9-2-4-10(20)5-3-9/h2-7,12,16H,8H2,1H3,(H,23,27)(H,24,26)/t12-,16-/m0/s1 MPCOMZUFDSQYDC-LRDDRELGSA-N 50597244 CHEMBL5190385 N-formyl peptide receptor 2 Homo sapiens 32 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597244 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2200&target=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597244&enzyme=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 146597625 482608096 1 METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM 6OMM,7T6S,7T6U,7T6V N-formyl peptide receptor 2 FPR2_HUMAN P25090 A8K3E2 51482101 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2Nc2nnc(o2)-c2cccc(Cl)c2)c(F)c1 InChI=1S/C19H15ClF2N4O3/c1-28-11-6-13(21)15(14(22)7-11)12-8-23-17(27)16(12)24-19-26-25-18(29-19)9-3-2-4-10(20)5-9/h2-7,12,16H,8H2,1H3,(H,23,27)(H,24,26)/t12-,16-/m0/s1 YFGNLJYUHPOZBR-LRDDRELGSA-N 50597245 CHEMBL5207660 N-formyl peptide receptor 2 Homo sapiens >10000 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597245 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2200&target=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597245&enzyme=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 168296564 482608097 1 METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM 6OMM,7T6S,7T6U,7T6V N-formyl peptide receptor 2 FPR2_HUMAN P25090 A8K3E2 51482102 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2Nc2nnc(o2)-c2ccccc2Cl)c(F)c1 InChI=1S/C19H15ClF2N4O3/c1-28-9-6-13(21)15(14(22)7-9)11-8-23-17(27)16(11)24-19-26-25-18(29-19)10-4-2-3-5-12(10)20/h2-7,11,16H,8H2,1H3,(H,23,27)(H,24,26)/t11-,16-/m0/s1 XCXOFIAKVMFBMR-ZBEGNZNMSA-N 50597246 CHEMBL5180535 N-formyl peptide receptor 2 Homo sapiens >10000 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597246 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2200&target=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597246&enzyme=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 168272815 482608098 1 METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM 6OMM,7T6S,7T6U,7T6V N-formyl peptide receptor 2 FPR2_HUMAN P25090 A8K3E2 51482103 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2Nc2nnc(o2)-c2ccc(Cl)cc2F)c(F)c1 InChI=1S/C19H14ClF3N4O3/c1-29-9-5-13(22)15(14(23)6-9)11-7-24-17(28)16(11)25-19-27-26-18(30-19)10-3-2-8(20)4-12(10)21/h2-6,11,16H,7H2,1H3,(H,24,28)(H,25,27)/t11-,16-/m0/s1 DCBXLWBHLRKESD-ZBEGNZNMSA-N 50597247 CHEMBL5203364 N-formyl peptide receptor 2 Homo sapiens 840 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597247 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2200&target=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597247&enzyme=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 146648729 482608099 1 METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM 6OMM,7T6S,7T6U,7T6V N-formyl peptide receptor 2 FPR2_HUMAN P25090 A8K3E2 51482104 COc1ccc(cc1)-c1nnc(N[C@H]2[C@@H](CNC2=O)c2c(F)cc(OC)cc2F)o1 InChI=1S/C20H18F2N4O4/c1-28-11-5-3-10(4-6-11)19-25-26-20(30-19)24-17-13(9-23-18(17)27)16-14(21)7-12(29-2)8-15(16)22/h3-8,13,17H,9H2,1-2H3,(H,23,27)(H,24,26)/t13-,17-/m0/s1 FEQKQUWWXQCLHI-GUYCJALGSA-N 50597248 CHEMBL5203596 N-formyl peptide receptor 2 Homo sapiens 3700 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597248 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2200&target=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597248&enzyme=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 168293191 482608100 1 METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM 6OMM,7T6S,7T6U,7T6V N-formyl peptide receptor 2 FPR2_HUMAN P25090 A8K3E2 51482105 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2Nc2nnc(o2)-c2ccc(OC(F)(F)F)cc2)c(F)c1 InChI=1S/C20H15F5N4O4/c1-31-11-6-13(21)15(14(22)7-11)12-8-26-17(30)16(12)27-19-29-28-18(32-19)9-2-4-10(5-3-9)33-20(23,24)25/h2-7,12,16H,8H2,1H3,(H,26,30)(H,27,29)/t12-,16-/m0/s1 RUZUBSJPMWAWOJ-LRDDRELGSA-N 50597249 CHEMBL5197524 N-formyl peptide receptor 2 Homo sapiens 53 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597249 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2200&target=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597249&enzyme=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 146648736 482608101 1 METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM 6OMM,7T6S,7T6U,7T6V N-formyl peptide receptor 2 FPR2_HUMAN P25090 A8K3E2 51482106 COc1ccc([C@@H]2CNC(=O)[C@H]2Nc2nnc(o2)-c2ccc(Cl)cc2)c(F)c1 InChI=1S/C19H16ClFN4O3/c1-27-12-6-7-13(15(21)8-12)14-9-22-17(26)16(14)23-19-25-24-18(28-19)10-2-4-11(20)5-3-10/h2-8,14,16H,9H2,1H3,(H,22,26)(H,23,25)/t14-,16-/m0/s1 KRBHVHJQPGHZAH-HOCLYGCPSA-N 50597250 CHEMBL5181627 N-formyl peptide receptor 2 Homo sapiens 40 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597250 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2200&target=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597250&enzyme=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 168272852 482608102 1 METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM 6OMM,7T6S,7T6U,7T6V N-formyl peptide receptor 2 FPR2_HUMAN P25090 A8K3E2 51482107 COc1ccc(cc1)[C@@H]1CNC(=O)[C@H]1Nc1nnc(o1)-c1ccc(Cl)cc1 InChI=1S/C19H17ClN4O3/c1-26-14-8-4-11(5-9-14)15-10-21-17(25)16(15)22-19-24-23-18(27-19)12-2-6-13(20)7-3-12/h2-9,15-16H,10H2,1H3,(H,21,25)(H,22,24)/t15-,16-/m0/s1 UGLXXDFFURYRHA-HOTGVXAUSA-N 50597251 CHEMBL5204580 N-formyl peptide receptor 2 Homo sapiens 160 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597251 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2200&target=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597251&enzyme=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 168295559 482608103 1 METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM 6OMM,7T6S,7T6U,7T6V N-formyl peptide receptor 2 FPR2_HUMAN P25090 A8K3E2 51482108 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2Nc2noc(n2)-c2ccc(Cl)cc2)c(F)c1 InChI=1S/C19H15ClF2N4O3/c1-28-11-6-13(21)15(14(22)7-11)12-8-23-17(27)16(12)24-19-25-18(29-26-19)9-2-4-10(20)5-3-9/h2-7,12,16H,8H2,1H3,(H,23,27)(H,24,26)/t12-,16-/m0/s1 VDQXYNRFYAKLFH-LRDDRELGSA-N 50597252 CHEMBL5194850 N-formyl peptide receptor 2 Homo sapiens 2500 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597252 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2200&target=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597252&enzyme=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 168288891 482608104 1 METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM 6OMM,7T6S,7T6U,7T6V N-formyl peptide receptor 2 FPR2_HUMAN P25090 A8K3E2 51482109 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2Nc2nc(no2)-c2ccc(Cl)cc2)c(F)c1 InChI=1S/C19H15ClF2N4O3/c1-28-11-6-13(21)15(14(22)7-11)12-8-23-18(27)16(12)24-19-25-17(26-29-19)9-2-4-10(20)5-3-9/h2-7,12,16H,8H2,1H3,(H,23,27)(H,24,25,26)/t12-,16-/m0/s1 RTWLQIUWOKGNLV-LRDDRELGSA-N 50597253 CHEMBL5195336 N-formyl peptide receptor 2 Homo sapiens 3500 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597253 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2200&target=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597253&enzyme=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 168284711 482608105 1 METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM 6OMM,7T6S,7T6U,7T6V N-formyl peptide receptor 2 FPR2_HUMAN P25090 A8K3E2 51482110 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2Nc2nnc(s2)-c2ccc(Cl)cc2)c(F)c1 InChI=1S/C19H15ClF2N4O2S/c1-28-11-6-13(21)15(14(22)7-11)12-8-23-17(27)16(12)24-19-26-25-18(29-19)9-2-4-10(20)5-3-9/h2-7,12,16H,8H2,1H3,(H,23,27)(H,24,26)/t12-,16-/m0/s1 ZOEUPAGSWHQKAA-LRDDRELGSA-N 50597254 CHEMBL5201495 N-formyl peptide receptor 2 Homo sapiens 37 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597254 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2200&target=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597254&enzyme=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 146649326 482608106 1 METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM 6OMM,7T6S,7T6U,7T6V N-formyl peptide receptor 2 FPR2_HUMAN P25090 A8K3E2 51482111 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2Nc2ncc(o2)-c2ccc(Cl)cc2)c(F)c1 InChI=1S/C20H16ClF2N3O3/c1-28-12-6-14(22)17(15(23)7-12)13-8-24-19(27)18(13)26-20-25-9-16(29-20)10-2-4-11(21)5-3-10/h2-7,9,13,18H,8H2,1H3,(H,24,27)(H,25,26)/t13-,18-/m0/s1 HSQAFHDNXKNONB-UGSOOPFHSA-N 50597255 CHEMBL5201015 N-formyl peptide receptor 2 Homo sapiens 250 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597255 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2200&target=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597255&enzyme=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 146597617 482608107 1 METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM 6OMM,7T6S,7T6U,7T6V N-formyl peptide receptor 2 FPR2_HUMAN P25090 A8K3E2 51482112 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2Nc2cc(on2)-c2ccc(Cl)cc2)c(F)c1 InChI=1S/C20H16ClF2N3O3/c1-28-12-6-14(22)18(15(23)7-12)13-9-24-20(27)19(13)25-17-8-16(29-26-17)10-2-4-11(21)5-3-10/h2-8,13,19H,9H2,1H3,(H,24,27)(H,25,26)/t13-,19-/m0/s1 DSRNQXXNCQBFOK-DJJJIMSYSA-N 50597256 CHEMBL5191583 N-formyl peptide receptor 2 Homo sapiens 10.0 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597256 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2200&target=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597256&enzyme=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 146597621 482608108 1 METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM 6OMM,7T6S,7T6U,7T6V N-formyl peptide receptor 2 FPR2_HUMAN P25090 A8K3E2 51482113 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2Nc2cc(no2)-c2ccc(Cl)cc2)c(F)c1 InChI=1S/C20H16ClF2N3O3/c1-28-12-6-14(22)18(15(23)7-12)13-9-24-20(27)19(13)25-17-8-16(26-29-17)10-2-4-11(21)5-3-10/h2-8,13,19,25H,9H2,1H3,(H,24,27)/t13-,19-/m0/s1 ZBQIOUGPINNZBH-DJJJIMSYSA-N 50597257 CHEMBL5197701 N-formyl peptide receptor 2 Homo sapiens 2200 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597257 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2200&target=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597257&enzyme=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 168288195 482608109 1 METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM 6OMM,7T6S,7T6U,7T6V N-formyl peptide receptor 2 FPR2_HUMAN P25090 A8K3E2 51482114 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2Nc2cc([nH]n2)-c2ccc(Cl)cc2)c(F)c1 50597258 CHEMBL5174501 N-formyl peptide receptor 2 Homo sapiens >10000 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597258 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2200&target=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597258&enzyme=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 168273566 482608110 1 METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM 6OMM,7T6S,7T6U,7T6V N-formyl peptide receptor 2 FPR2_HUMAN P25090 A8K3E2 51482115 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2Nc2cc(-c3ccc(Cl)cc3)n(C)n2)c(F)c1 InChI=1S/C21H19ClF2N4O2/c1-28-17(11-3-5-12(22)6-4-11)9-18(27-28)26-20-14(10-25-21(20)29)19-15(23)7-13(30-2)8-16(19)24/h3-9,14,20H,10H2,1-2H3,(H,25,29)(H,26,27)/t14-,20-/m0/s1 YYDXVEMRMGWTGZ-XOBRGWDASA-N 50597259 CHEMBL5192360 N-formyl peptide receptor 2 Homo sapiens >10000 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597259 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2200&target=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597259&enzyme=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 168284580 482608111 1 METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM 6OMM,7T6S,7T6U,7T6V N-formyl peptide receptor 2 FPR2_HUMAN P25090 A8K3E2 51482116 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2NC(=O)Nc2ccccc2)c(F)c1 InChI=1S/C18H17F2N3O3/c1-26-11-7-13(19)15(14(20)8-11)12-9-21-17(24)16(12)23-18(25)22-10-5-3-2-4-6-10/h2-8,12,16H,9H2,1H3,(H,21,24)(H2,22,23,25)/t12-,16-/m0/s1 FJZNNKJZHQFMCK-LRDDRELGSA-N 50559829 CHEMBL4784510 fMet-Leu-Phe receptor Homo sapiens 400 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50559829 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4556&target=fMet-Leu-Phe+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50559829&enzyme=fMet-Leu-Phe+receptor&column=ki&startPg=0&Increment=50&submit=Search 122583088 461830221 1 METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVTTISYLNLAVADFCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIALDRCVCVLHPVWTQNHRTVSLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIATKIHKQGLIKSSRPLRVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPMLYVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK 7EUO,7T6T,7VFX fMet-Leu-Phe receptor FPR1_HUMAN P21462 Q14939 Q7Z6A4 Q86U52 Q9NS48 51482117 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2Nc2nc3ccccc3[nH]2)c(F)c1 50597236 CHEMBL5186339 fMet-Leu-Phe receptor Homo sapiens >10000 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597236 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4556&target=fMet-Leu-Phe+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597236&enzyme=fMet-Leu-Phe+receptor&column=ki&startPg=0&Increment=50&submit=Search 168282661 482608088 1 METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVTTISYLNLAVADFCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIALDRCVCVLHPVWTQNHRTVSLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIATKIHKQGLIKSSRPLRVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPMLYVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK 7EUO,7T6T,7VFX fMet-Leu-Phe receptor FPR1_HUMAN P21462 Q14939 Q7Z6A4 Q86U52 Q9NS48 51482118 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2c2nc3ccccc3[nH]2)c(F)c1 50597237 CHEMBL5208504 fMet-Leu-Phe receptor Homo sapiens >10000 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597237 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4556&target=fMet-Leu-Phe+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597237&enzyme=fMet-Leu-Phe+receptor&column=ki&startPg=0&Increment=50&submit=Search 168297721 482608089 1 METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVTTISYLNLAVADFCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIALDRCVCVLHPVWTQNHRTVSLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIATKIHKQGLIKSSRPLRVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPMLYVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK 7EUO,7T6T,7VFX fMet-Leu-Phe receptor FPR1_HUMAN P21462 Q14939 Q7Z6A4 Q86U52 Q9NS48 51482119 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2Nc2nnc(o2)-c2ccccc2)c(F)c1 InChI=1S/C19H16F2N4O3/c1-27-11-7-13(20)15(14(21)8-11)12-9-22-17(26)16(12)23-19-25-24-18(28-19)10-5-3-2-4-6-10/h2-8,12,16H,9H2,1H3,(H,22,26)(H,23,25)/t12-,16-/m0/s1 QFWADSLRJZHARC-LRDDRELGSA-N 50597238 CHEMBL5187399 fMet-Leu-Phe receptor Homo sapiens 5500 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597238 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4556&target=fMet-Leu-Phe+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597238&enzyme=fMet-Leu-Phe+receptor&column=ki&startPg=0&Increment=50&submit=Search 162425412 482608090 1 METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVTTISYLNLAVADFCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIALDRCVCVLHPVWTQNHRTVSLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIATKIHKQGLIKSSRPLRVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPMLYVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK 7EUO,7T6T,7VFX fMet-Leu-Phe receptor FPR1_HUMAN P21462 Q14939 Q7Z6A4 Q86U52 Q9NS48 51482120 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2Nc2nnc(o2)-c2ccc(Cl)cc2)c(F)c1 InChI=1S/C19H15ClF2N4O3/c1-28-11-6-13(21)15(14(22)7-11)12-8-23-17(27)16(12)24-19-26-25-18(29-19)9-2-4-10(20)5-3-9/h2-7,12,16H,8H2,1H3,(H,23,27)(H,24,26)/t12-,16-/m0/s1 MPCOMZUFDSQYDC-LRDDRELGSA-N 50597244 CHEMBL5190385 fMet-Leu-Phe receptor Homo sapiens 1400 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597244 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4556&target=fMet-Leu-Phe+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597244&enzyme=fMet-Leu-Phe+receptor&column=ki&startPg=0&Increment=50&submit=Search 146597625 482608096 1 METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVTTISYLNLAVADFCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIALDRCVCVLHPVWTQNHRTVSLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIATKIHKQGLIKSSRPLRVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPMLYVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK 7EUO,7T6T,7VFX fMet-Leu-Phe receptor FPR1_HUMAN P21462 Q14939 Q7Z6A4 Q86U52 Q9NS48 51482121 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2Nc2cc(on2)-c2ccc(Cl)cc2)c(F)c1 InChI=1S/C20H16ClF2N3O3/c1-28-12-6-14(22)18(15(23)7-12)13-9-24-20(27)19(13)25-17-8-16(29-26-17)10-2-4-11(21)5-3-10/h2-8,13,19H,9H2,1H3,(H,24,27)(H,25,26)/t13-,19-/m0/s1 DSRNQXXNCQBFOK-DJJJIMSYSA-N 50597256 CHEMBL5191583 fMet-Leu-Phe receptor Homo sapiens 470 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597256 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4556&target=fMet-Leu-Phe+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597256&enzyme=fMet-Leu-Phe+receptor&column=ki&startPg=0&Increment=50&submit=Search 146597621 482608108 1 METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVTTISYLNLAVADFCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIALDRCVCVLHPVWTQNHRTVSLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIATKIHKQGLIKSSRPLRVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPMLYVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK 7EUO,7T6T,7VFX fMet-Leu-Phe receptor FPR1_HUMAN P21462 Q14939 Q7Z6A4 Q86U52 Q9NS48 51482122 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2NC(=O)Nc2ccccc2)c(F)c1 InChI=1S/C18H17F2N3O3/c1-26-11-7-13(19)15(14(20)8-11)12-9-21-17(24)16(12)23-18(25)22-10-5-3-2-4-6-10/h2-8,12,16H,9H2,1H3,(H,21,24)(H2,22,23,25)/t12-,16-/m0/s1 FJZNNKJZHQFMCK-LRDDRELGSA-N 50559829 CHEMBL4784510 N-formyl peptide receptor 2 Homo sapiens 7.5 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50559829 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2200&target=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50559829&enzyme=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 122583088 461830221 1 METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM 6OMM,7T6S,7T6U,7T6V N-formyl peptide receptor 2 FPR2_HUMAN P25090 A8K3E2 51482123 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2Nc2nnc(o2)-c2ccc(Cl)cc2)c(F)c1 InChI=1S/C19H15ClF2N4O3/c1-28-11-6-13(21)15(14(22)7-11)12-8-23-17(27)16(12)24-19-26-25-18(29-19)9-2-4-10(20)5-3-9/h2-7,12,16H,8H2,1H3,(H,23,27)(H,24,26)/t12-,16-/m0/s1 MPCOMZUFDSQYDC-LRDDRELGSA-N 50597244 CHEMBL5190385 N-formyl peptide receptor 2 Homo sapiens 28 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597244 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2200&target=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597244&enzyme=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 146597625 482608096 1 METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM 6OMM,7T6S,7T6U,7T6V N-formyl peptide receptor 2 FPR2_HUMAN P25090 A8K3E2 51482124 COc1cc(F)c([C@@H]2CNC(=O)[C@H]2Nc2cc(on2)-c2ccc(Cl)cc2)c(F)c1 InChI=1S/C20H16ClF2N3O3/c1-28-12-6-14(22)18(15(23)7-12)13-9-24-20(27)19(13)25-17-8-16(29-26-17)10-2-4-11(21)5-3-10/h2-8,13,19H,9H2,1H3,(H,24,27)(H,25,26)/t13-,19-/m0/s1 DSRNQXXNCQBFOK-DJJJIMSYSA-N 50597256 CHEMBL5191583 N-formyl peptide receptor 2 Homo sapiens 19 ChEMBL 10.7270/Q2377DRF 35707160 Wurtz, NR; Johnson, JA; Viet, A; Shirude, PS; Baligar, V; Madduri, S; Cheney, DL; Park, H; Lupisella, JA; Hsu, MY; Abousleiman, M; Galella, MA; Aulakh, D; Dierks, EA; Garcia, RA; Ostrowski, J; Kick, EK; Wexler, RR 6/9/2022 6/22/2023 Bristol Myers Squibb Research and Development http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50597256 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2200&target=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50597256&enzyme=N-formyl+peptide+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 146597621 482608108 1 METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM 6OMM,7T6S,7T6U,7T6V N-formyl peptide receptor 2 FPR2_HUMAN P25090 A8K3E2