BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 51428014 Nc1ncn(Cc2c(Cl)cccc2Cl)c2ncnc12 InChI=1S/C12H9Cl2N5/c13-8-2-1-3-9(14)7(8)4-19-6-18-11(15)10-12(19)17-5-16-10/h1-3,5-6H,4,15H2 OQNSRMIDLWWUGD-UHFFFAOYSA-N 50576919 CHEMBL4847980 Low molecular weight phosphotyrosine protein phosphatase Homo sapiens 239 ChEMBL 10.1021/acs.jmedchem.0c02126 10.7270/Q21G0R2R 33914534 Stanford, SM; Diaz, MA; Ardecky, RJ; Zou, J; Roosild, T; Holmes, ZJ; Nguyen, TP; Hedrick, MP; Rodiles, S; Guan, A; Grotegut, S; Santelli, E; Chung, TDY; Jackson, MR; Bottini, N; Pinkerton, AB 5/13/2021 8/24/2022 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50576919 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8398&target=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50576919&enzyme=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search 135604493 471053042 1 MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH 5KQP,5KQM,5KQL,5KQG,5JNS,5JNR,4Z9B,4Z9A,4Z99,7UW6,5PNT,3N8I,7KH8 Low molecular weight phosphotyrosine protein phosphatase PPAC_HUMAN P24666 A8K1L9 B5MCC7 P24667 Q16035 Q16036 Q16725 Q3KQX8 Q53RU0 51428015 Cc1nc2c(N)ncn(Cc3c(Cl)cccc3Cl)c2n1 InChI=1S/C13H11Cl2N5/c1-7-18-11-12(16)17-6-20(13(11)19-7)5-8-9(14)3-2-4-10(8)15/h2-4,6H,5,16H2,1H3 VJRDHLZWZNIPMP-UHFFFAOYSA-N 50576920 CHEMBL4852414 Low molecular weight phosphotyrosine protein phosphatase Homo sapiens 306 ChEMBL 10.1021/acs.jmedchem.0c02126 10.7270/Q21G0R2R 33914534 Stanford, SM; Diaz, MA; Ardecky, RJ; Zou, J; Roosild, T; Holmes, ZJ; Nguyen, TP; Hedrick, MP; Rodiles, S; Guan, A; Grotegut, S; Santelli, E; Chung, TDY; Jackson, MR; Bottini, N; Pinkerton, AB 5/13/2021 8/24/2022 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50576920 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8398&target=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50576920&enzyme=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search 138740655 471053043 1 MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH 5KQP,5KQM,5KQL,5KQG,5JNS,5JNR,4Z9B,4Z9A,4Z99,7UW6,5PNT,3N8I,7KH8 Low molecular weight phosphotyrosine protein phosphatase PPAC_HUMAN P24666 A8K1L9 B5MCC7 P24667 Q16035 Q16036 Q16725 Q3KQX8 Q53RU0 51428016 Nc1ncn(Cc2c(Cl)cccc2Cl)c2nc(nc12)-c1ccccc1 InChI=1S/C18H13Cl2N5/c19-13-7-4-8-14(20)12(13)9-25-10-22-16(21)15-18(25)24-17(23-15)11-5-2-1-3-6-11/h1-8,10H,9,21H2 AYROFGYMSYCDMI-UHFFFAOYSA-N 50576921 CHEMBL4874911 Low molecular weight phosphotyrosine protein phosphatase Homo sapiens 104 ChEMBL 10.1021/acs.jmedchem.0c02126 10.7270/Q21G0R2R 33914534 Stanford, SM; Diaz, MA; Ardecky, RJ; Zou, J; Roosild, T; Holmes, ZJ; Nguyen, TP; Hedrick, MP; Rodiles, S; Guan, A; Grotegut, S; Santelli, E; Chung, TDY; Jackson, MR; Bottini, N; Pinkerton, AB 5/13/2021 8/24/2022 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50576921 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8398&target=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50576921&enzyme=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search 138740751 471053044 1 MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH 5KQP,5KQM,5KQL,5KQG,5JNS,5JNR,4Z9B,4Z9A,4Z99,7UW6,5PNT,3N8I,7KH8 Low molecular weight phosphotyrosine protein phosphatase PPAC_HUMAN P24666 A8K1L9 B5MCC7 P24667 Q16035 Q16036 Q16725 Q3KQX8 Q53RU0 51428017 Nc1ncn(Cc2c(Cl)cccc2Cl)c2nc(Br)nc12 InChI=1S/C12H8BrCl2N5/c13-12-18-9-10(16)17-5-20(11(9)19-12)4-6-7(14)2-1-3-8(6)15/h1-3,5H,4,16H2 OMLATXLEFZRFRL-UHFFFAOYSA-N 50576922 CHEMBL4865769 Low molecular weight phosphotyrosine protein phosphatase Homo sapiens 17600 ChEMBL 10.1021/acs.jmedchem.0c02126 10.7270/Q21G0R2R 33914534 Stanford, SM; Diaz, MA; Ardecky, RJ; Zou, J; Roosild, T; Holmes, ZJ; Nguyen, TP; Hedrick, MP; Rodiles, S; Guan, A; Grotegut, S; Santelli, E; Chung, TDY; Jackson, MR; Bottini, N; Pinkerton, AB 5/13/2021 8/24/2022 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50576922 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8398&target=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50576922&enzyme=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search 138740716 471053045 1 MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH 5KQP,5KQM,5KQL,5KQG,5JNS,5JNR,4Z9B,4Z9A,4Z99,7UW6,5PNT,3N8I,7KH8 Low molecular weight phosphotyrosine protein phosphatase PPAC_HUMAN P24666 A8K1L9 B5MCC7 P24667 Q16035 Q16036 Q16725 Q3KQX8 Q53RU0 51428018 Nc1ncn(Cc2c(Cl)cccc2Cl)c2nc(Cl)nc12 InChI=1S/C12H8Cl3N5/c13-7-2-1-3-8(14)6(7)4-20-5-17-10(16)9-11(20)19-12(15)18-9/h1-3,5H,4,16H2 HFDMXOIATJABMN-UHFFFAOYSA-N 50576923 CHEMBL4863777 Low molecular weight phosphotyrosine protein phosphatase Homo sapiens 27800 ChEMBL 10.1021/acs.jmedchem.0c02126 10.7270/Q21G0R2R 33914534 Stanford, SM; Diaz, MA; Ardecky, RJ; Zou, J; Roosild, T; Holmes, ZJ; Nguyen, TP; Hedrick, MP; Rodiles, S; Guan, A; Grotegut, S; Santelli, E; Chung, TDY; Jackson, MR; Bottini, N; Pinkerton, AB 5/13/2021 8/24/2022 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50576923 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8398&target=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50576923&enzyme=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search 138740642 471053046 1 MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH 5KQP,5KQM,5KQL,5KQG,5JNS,5JNR,4Z9B,4Z9A,4Z99,7UW6,5PNT,3N8I,7KH8 Low molecular weight phosphotyrosine protein phosphatase PPAC_HUMAN P24666 A8K1L9 B5MCC7 P24667 Q16035 Q16036 Q16725 Q3KQX8 Q53RU0 51428019 Nc1ncn(Cc2c(Cl)cccc2Cl)c2nc(nc12)-c1ccccc1Cl InChI=1S/C18H12Cl3N5/c19-12-5-2-1-4-10(12)17-24-15-16(22)23-9-26(18(15)25-17)8-11-13(20)6-3-7-14(11)21/h1-7,9H,8,22H2 OPEYZJPHGVXJBX-UHFFFAOYSA-N 50576924 CHEMBL4861843 Low molecular weight phosphotyrosine protein phosphatase Homo sapiens 171 ChEMBL 10.1021/acs.jmedchem.0c02126 10.7270/Q21G0R2R 33914534 Stanford, SM; Diaz, MA; Ardecky, RJ; Zou, J; Roosild, T; Holmes, ZJ; Nguyen, TP; Hedrick, MP; Rodiles, S; Guan, A; Grotegut, S; Santelli, E; Chung, TDY; Jackson, MR; Bottini, N; Pinkerton, AB 5/13/2021 8/24/2022 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50576924 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8398&target=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50576924&enzyme=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search 138740818 471053047 1 MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH 5KQP,5KQM,5KQL,5KQG,5JNS,5JNR,4Z9B,4Z9A,4Z99,7UW6,5PNT,3N8I,7KH8 Low molecular weight phosphotyrosine protein phosphatase PPAC_HUMAN P24666 A8K1L9 B5MCC7 P24667 Q16035 Q16036 Q16725 Q3KQX8 Q53RU0 51428020 Nc1ncn(Cc2c(Cl)cccc2Cl)c2nc(nc12)-c1cccc(Cl)c1 InChI=1S/C18H12Cl3N5/c19-11-4-1-3-10(7-11)17-24-15-16(22)23-9-26(18(15)25-17)8-12-13(20)5-2-6-14(12)21/h1-7,9H,8,22H2 YBRAGOCJZWACFJ-UHFFFAOYSA-N 50576925 CHEMBL4846731 Low molecular weight phosphotyrosine protein phosphatase Homo sapiens 380 ChEMBL 10.1021/acs.jmedchem.0c02126 10.7270/Q21G0R2R 33914534 Stanford, SM; Diaz, MA; Ardecky, RJ; Zou, J; Roosild, T; Holmes, ZJ; Nguyen, TP; Hedrick, MP; Rodiles, S; Guan, A; Grotegut, S; Santelli, E; Chung, TDY; Jackson, MR; Bottini, N; Pinkerton, AB 5/13/2021 8/24/2022 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50576925 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8398&target=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50576925&enzyme=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search 138740903 471053048 1 MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH 5KQP,5KQM,5KQL,5KQG,5JNS,5JNR,4Z9B,4Z9A,4Z99,7UW6,5PNT,3N8I,7KH8 Low molecular weight phosphotyrosine protein phosphatase PPAC_HUMAN P24666 A8K1L9 B5MCC7 P24667 Q16035 Q16036 Q16725 Q3KQX8 Q53RU0 51428021 Nc1ncn(Cc2c(Cl)cccc2Cl)c2nc(nc12)-c1ccc(Cl)cc1 InChI=1S/C18H12Cl3N5/c19-11-6-4-10(5-7-11)17-24-15-16(22)23-9-26(18(15)25-17)8-12-13(20)2-1-3-14(12)21/h1-7,9H,8,22H2 NRDUGWROKUFEEA-UHFFFAOYSA-N 50576926 CHEMBL4857590 Low molecular weight phosphotyrosine protein phosphatase Homo sapiens 288 ChEMBL 10.1021/acs.jmedchem.0c02126 10.7270/Q21G0R2R 33914534 Stanford, SM; Diaz, MA; Ardecky, RJ; Zou, J; Roosild, T; Holmes, ZJ; Nguyen, TP; Hedrick, MP; Rodiles, S; Guan, A; Grotegut, S; Santelli, E; Chung, TDY; Jackson, MR; Bottini, N; Pinkerton, AB 5/13/2021 8/24/2022 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50576926 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8398&target=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50576926&enzyme=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search 138740697 471053049 1 MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH 5KQP,5KQM,5KQL,5KQG,5JNS,5JNR,4Z9B,4Z9A,4Z99,7UW6,5PNT,3N8I,7KH8 Low molecular weight phosphotyrosine protein phosphatase PPAC_HUMAN P24666 A8K1L9 B5MCC7 P24667 Q16035 Q16036 Q16725 Q3KQX8 Q53RU0 51428022 Cc1ccccc1-c1nc2c(N)ncn(Cc3c(Cl)cccc3Cl)c2n1 InChI=1S/C19H15Cl2N5/c1-11-5-2-3-6-12(11)18-24-16-17(22)23-10-26(19(16)25-18)9-13-14(20)7-4-8-15(13)21/h2-8,10H,9,22H2,1H3 OAGNWWLJSOJIFV-UHFFFAOYSA-N 50576927 CHEMBL4856707 Low molecular weight phosphotyrosine protein phosphatase Homo sapiens 20 ChEMBL 10.1021/acs.jmedchem.0c02126 10.7270/Q21G0R2R 33914534 Stanford, SM; Diaz, MA; Ardecky, RJ; Zou, J; Roosild, T; Holmes, ZJ; Nguyen, TP; Hedrick, MP; Rodiles, S; Guan, A; Grotegut, S; Santelli, E; Chung, TDY; Jackson, MR; Bottini, N; Pinkerton, AB 5/13/2021 8/24/2022 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50576927 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8398&target=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50576927&enzyme=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search 139308623 471053050 1 MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH 5KQP,5KQM,5KQL,5KQG,5JNS,5JNR,4Z9B,4Z9A,4Z99,7UW6,5PNT,3N8I,7KH8 Low molecular weight phosphotyrosine protein phosphatase PPAC_HUMAN P24666 A8K1L9 B5MCC7 P24667 Q16035 Q16036 Q16725 Q3KQX8 Q53RU0 51428023 Cc1cccc(c1)-c1nc2c(N)ncn(Cc3c(Cl)cccc3Cl)c2n1 InChI=1S/C19H15Cl2N5/c1-11-4-2-5-12(8-11)18-24-16-17(22)23-10-26(19(16)25-18)9-13-14(20)6-3-7-15(13)21/h2-8,10H,9,22H2,1H3 YOLJUJYCPXCAJS-UHFFFAOYSA-N 50576928 CHEMBL4855952 Low molecular weight phosphotyrosine protein phosphatase Homo sapiens 87 ChEMBL 10.1021/acs.jmedchem.0c02126 10.7270/Q21G0R2R 33914534 Stanford, SM; Diaz, MA; Ardecky, RJ; Zou, J; Roosild, T; Holmes, ZJ; Nguyen, TP; Hedrick, MP; Rodiles, S; Guan, A; Grotegut, S; Santelli, E; Chung, TDY; Jackson, MR; Bottini, N; Pinkerton, AB 5/13/2021 8/24/2022 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50576928 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8398&target=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50576928&enzyme=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search 155229655 471053051 1 MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH 5KQP,5KQM,5KQL,5KQG,5JNS,5JNR,4Z9B,4Z9A,4Z99,7UW6,5PNT,3N8I,7KH8 Low molecular weight phosphotyrosine protein phosphatase PPAC_HUMAN P24666 A8K1L9 B5MCC7 P24667 Q16035 Q16036 Q16725 Q3KQX8 Q53RU0 51428024 Cc1ccc(cc1)-c1nc2c(N)ncn(Cc3c(Cl)cccc3Cl)c2n1 InChI=1S/C19H15Cl2N5/c1-11-5-7-12(8-6-11)18-24-16-17(22)23-10-26(19(16)25-18)9-13-14(20)3-2-4-15(13)21/h2-8,10H,9,22H2,1H3 JWSZGUZSPRYQOD-UHFFFAOYSA-N 50576929 CHEMBL4859307 Low molecular weight phosphotyrosine protein phosphatase Homo sapiens 119 ChEMBL 10.1021/acs.jmedchem.0c02126 10.7270/Q21G0R2R 33914534 Stanford, SM; Diaz, MA; Ardecky, RJ; Zou, J; Roosild, T; Holmes, ZJ; Nguyen, TP; Hedrick, MP; Rodiles, S; Guan, A; Grotegut, S; Santelli, E; Chung, TDY; Jackson, MR; Bottini, N; Pinkerton, AB 5/13/2021 8/24/2022 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50576929 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8398&target=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50576929&enzyme=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search 155229661 471053052 1 MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH 5KQP,5KQM,5KQL,5KQG,5JNS,5JNR,4Z9B,4Z9A,4Z99,7UW6,5PNT,3N8I,7KH8 Low molecular weight phosphotyrosine protein phosphatase PPAC_HUMAN P24666 A8K1L9 B5MCC7 P24667 Q16035 Q16036 Q16725 Q3KQX8 Q53RU0 51428025 Nc1ncn(Cc2c(Cl)cccc2Cl)c2nc(nc12)-c1ccccc1F InChI=1S/C18H12Cl2FN5/c19-12-5-3-6-13(20)11(12)8-26-9-23-16(22)15-18(26)25-17(24-15)10-4-1-2-7-14(10)21/h1-7,9H,8,22H2 GAJJLMXPIZQXNG-UHFFFAOYSA-N 50576930 CHEMBL4858034 Low molecular weight phosphotyrosine protein phosphatase Homo sapiens 147 ChEMBL 10.1021/acs.jmedchem.0c02126 10.7270/Q21G0R2R 33914534 Stanford, SM; Diaz, MA; Ardecky, RJ; Zou, J; Roosild, T; Holmes, ZJ; Nguyen, TP; Hedrick, MP; Rodiles, S; Guan, A; Grotegut, S; Santelli, E; Chung, TDY; Jackson, MR; Bottini, N; Pinkerton, AB 5/13/2021 8/24/2022 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50576930 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8398&target=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50576930&enzyme=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search 139309009 471053053 1 MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH 5KQP,5KQM,5KQL,5KQG,5JNS,5JNR,4Z9B,4Z9A,4Z99,7UW6,5PNT,3N8I,7KH8 Low molecular weight phosphotyrosine protein phosphatase PPAC_HUMAN P24666 A8K1L9 B5MCC7 P24667 Q16035 Q16036 Q16725 Q3KQX8 Q53RU0 51428026 Nc1ncn(Cc2c(Cl)cccc2Cl)c2nc(nc12)-c1cccc(F)c1 InChI=1S/C18H12Cl2FN5/c19-13-5-2-6-14(20)12(13)8-26-9-23-16(22)15-18(26)25-17(24-15)10-3-1-4-11(21)7-10/h1-7,9H,8,22H2 FNPSYRRSCBLLFV-UHFFFAOYSA-N 50576931 CHEMBL4870698 Low molecular weight phosphotyrosine protein phosphatase Homo sapiens 239 ChEMBL 10.1021/acs.jmedchem.0c02126 10.7270/Q21G0R2R 33914534 Stanford, SM; Diaz, MA; Ardecky, RJ; Zou, J; Roosild, T; Holmes, ZJ; Nguyen, TP; Hedrick, MP; Rodiles, S; Guan, A; Grotegut, S; Santelli, E; Chung, TDY; Jackson, MR; Bottini, N; Pinkerton, AB 5/13/2021 8/24/2022 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50576931 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8398&target=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50576931&enzyme=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search 139309008 471053054 1 MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH 5KQP,5KQM,5KQL,5KQG,5JNS,5JNR,4Z9B,4Z9A,4Z99,7UW6,5PNT,3N8I,7KH8 Low molecular weight phosphotyrosine protein phosphatase PPAC_HUMAN P24666 A8K1L9 B5MCC7 P24667 Q16035 Q16036 Q16725 Q3KQX8 Q53RU0 51428027 Nc1ncn(Cc2c(Cl)cccc2Cl)c2nc(nc12)-c1ccc(F)cc1 InChI=1S/C18H12Cl2FN5/c19-13-2-1-3-14(20)12(13)8-26-9-23-16(22)15-18(26)25-17(24-15)10-4-6-11(21)7-5-10/h1-7,9H,8,22H2 BWQDLJGFWAFTDK-UHFFFAOYSA-N 50576932 CHEMBL4873827 Low molecular weight phosphotyrosine protein phosphatase Homo sapiens 117 ChEMBL 10.1021/acs.jmedchem.0c02126 10.7270/Q21G0R2R 33914534 Stanford, SM; Diaz, MA; Ardecky, RJ; Zou, J; Roosild, T; Holmes, ZJ; Nguyen, TP; Hedrick, MP; Rodiles, S; Guan, A; Grotegut, S; Santelli, E; Chung, TDY; Jackson, MR; Bottini, N; Pinkerton, AB 5/13/2021 8/24/2022 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50576932 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8398&target=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50576932&enzyme=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search 138740710 471053055 1 MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH 5KQP,5KQM,5KQL,5KQG,5JNS,5JNR,4Z9B,4Z9A,4Z99,7UW6,5PNT,3N8I,7KH8 Low molecular weight phosphotyrosine protein phosphatase PPAC_HUMAN P24666 A8K1L9 B5MCC7 P24667 Q16035 Q16036 Q16725 Q3KQX8 Q53RU0 51428028 COc1ccccc1-c1nc2c(N)ncn(Cc3c(Cl)cccc3Cl)c2n1 InChI=1S/C19H15Cl2N5O/c1-27-15-8-3-2-5-11(15)18-24-16-17(22)23-10-26(19(16)25-18)9-12-13(20)6-4-7-14(12)21/h2-8,10H,9,22H2,1H3 XSAAHUULPZQWOY-UHFFFAOYSA-N 50576933 CHEMBL4848127 Low molecular weight phosphotyrosine protein phosphatase Homo sapiens 106 ChEMBL 10.1021/acs.jmedchem.0c02126 10.7270/Q21G0R2R 33914534 Stanford, SM; Diaz, MA; Ardecky, RJ; Zou, J; Roosild, T; Holmes, ZJ; Nguyen, TP; Hedrick, MP; Rodiles, S; Guan, A; Grotegut, S; Santelli, E; Chung, TDY; Jackson, MR; Bottini, N; Pinkerton, AB 5/13/2021 8/24/2022 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50576933 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8398&target=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50576933&enzyme=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search 155229643 471053056 1 MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH 5KQP,5KQM,5KQL,5KQG,5JNS,5JNR,4Z9B,4Z9A,4Z99,7UW6,5PNT,3N8I,7KH8 Low molecular weight phosphotyrosine protein phosphatase PPAC_HUMAN P24666 A8K1L9 B5MCC7 P24667 Q16035 Q16036 Q16725 Q3KQX8 Q53RU0 51428029 Nc1ncn(Cc2c(Cl)cccc2Cl)c2nc(nc12)-c1ccccc1C#N InChI=1S/C19H12Cl2N6/c20-14-6-3-7-15(21)13(14)9-27-10-24-17(23)16-19(27)26-18(25-16)12-5-2-1-4-11(12)8-22/h1-7,10H,9,23H2 LDBGUNZLEDWMQJ-UHFFFAOYSA-N 50576934 CHEMBL4868378 Low molecular weight phosphotyrosine protein phosphatase Homo sapiens 245 ChEMBL 10.1021/acs.jmedchem.0c02126 10.7270/Q21G0R2R 33914534 Stanford, SM; Diaz, MA; Ardecky, RJ; Zou, J; Roosild, T; Holmes, ZJ; Nguyen, TP; Hedrick, MP; Rodiles, S; Guan, A; Grotegut, S; Santelli, E; Chung, TDY; Jackson, MR; Bottini, N; Pinkerton, AB 5/13/2021 8/24/2022 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50576934 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8398&target=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50576934&enzyme=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search 155229653 471053057 1 MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH 5KQP,5KQM,5KQL,5KQG,5JNS,5JNR,4Z9B,4Z9A,4Z99,7UW6,5PNT,3N8I,7KH8 Low molecular weight phosphotyrosine protein phosphatase PPAC_HUMAN P24666 A8K1L9 B5MCC7 P24667 Q16035 Q16036 Q16725 Q3KQX8 Q53RU0 51428030 Nc1ncn(Cc2ccccc2)c2ncnc12 InChI=1S/C12H11N5/c13-11-10-12(15-7-14-10)17(8-16-11)6-9-4-2-1-3-5-9/h1-5,7-8H,6,13H2 ZRRXJVVXTVXDII-UHFFFAOYSA-N 50488844 3-BENZYLADENINE Low molecular weight phosphotyrosine protein phosphatase Homo sapiens 13600 ChEMBL 10.1021/acs.jmedchem.0c02126 10.7270/Q21G0R2R 33914534 Stanford, SM; Diaz, MA; Ardecky, RJ; Zou, J; Roosild, T; Holmes, ZJ; Nguyen, TP; Hedrick, MP; Rodiles, S; Guan, A; Grotegut, S; Santelli, E; Chung, TDY; Jackson, MR; Bottini, N; Pinkerton, AB 5/13/2021 8/24/2022 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50488844 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8398&target=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50488844&enzyme=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search 135404233 433956109 1 MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH 5KQP,5KQM,5KQL,5KQG,5JNS,5JNR,4Z9B,4Z9A,4Z99,7UW6,5PNT,3N8I,7KH8 Low molecular weight phosphotyrosine protein phosphatase PPAC_HUMAN P24666 A8K1L9 B5MCC7 P24667 Q16035 Q16036 Q16725 Q3KQX8 Q53RU0 51428031 Nc1ncn(Cc2ccccc2Cl)c2ncnc12 InChI=1S/C12H10ClN5/c13-9-4-2-1-3-8(9)5-18-7-17-11(14)10-12(18)16-6-15-10/h1-4,6-7H,5,14H2 NBDNHXTXPJPKDM-UHFFFAOYSA-N 50576935 CHEMBL3228662 Low molecular weight phosphotyrosine protein phosphatase Homo sapiens 1930 ChEMBL 10.1021/acs.jmedchem.0c02126 10.7270/Q21G0R2R 33914534 Stanford, SM; Diaz, MA; Ardecky, RJ; Zou, J; Roosild, T; Holmes, ZJ; Nguyen, TP; Hedrick, MP; Rodiles, S; Guan, A; Grotegut, S; Santelli, E; Chung, TDY; Jackson, MR; Bottini, N; Pinkerton, AB 5/13/2021 8/24/2022 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50576935 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8398&target=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50576935&enzyme=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search 135435025 471053058 1 MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH 5KQP,5KQM,5KQL,5KQG,5JNS,5JNR,4Z9B,4Z9A,4Z99,7UW6,5PNT,3N8I,7KH8 Low molecular weight phosphotyrosine protein phosphatase PPAC_HUMAN P24666 A8K1L9 B5MCC7 P24667 Q16035 Q16036 Q16725 Q3KQX8 Q53RU0 51428032 Nc1ncn(Cc2ccc(Cl)cc2Cl)c2ncnc12 InChI=1S/C12H9Cl2N5/c13-8-2-1-7(9(14)3-8)4-19-6-18-11(15)10-12(19)17-5-16-10/h1-3,5-6H,4,15H2 RPYYFWGOHHYUHZ-UHFFFAOYSA-N 50576936 CHEMBL3228665 Low molecular weight phosphotyrosine protein phosphatase Homo sapiens 1020 ChEMBL 10.1021/acs.jmedchem.0c02126 10.7270/Q21G0R2R 33914534 Stanford, SM; Diaz, MA; Ardecky, RJ; Zou, J; Roosild, T; Holmes, ZJ; Nguyen, TP; Hedrick, MP; Rodiles, S; Guan, A; Grotegut, S; Santelli, E; Chung, TDY; Jackson, MR; Bottini, N; Pinkerton, AB 5/13/2021 8/24/2022 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50576936 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8398&target=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50576936&enzyme=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search 135435059 471053059 1 MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH 5KQP,5KQM,5KQL,5KQG,5JNS,5JNR,4Z9B,4Z9A,4Z99,7UW6,5PNT,3N8I,7KH8 Low molecular weight phosphotyrosine protein phosphatase PPAC_HUMAN P24666 A8K1L9 B5MCC7 P24667 Q16035 Q16036 Q16725 Q3KQX8 Q53RU0 51428033 Nc1ncn(Cc2cccc(Cl)c2)c2ncnc12 InChI=1S/C12H10ClN5/c13-9-3-1-2-8(4-9)5-18-7-17-11(14)10-12(18)16-6-15-10/h1-4,6-7H,5,14H2 KCIXDRHBFJHHHV-UHFFFAOYSA-N 50576937 CHEMBL3228663 Low molecular weight phosphotyrosine protein phosphatase Homo sapiens 18500 ChEMBL 10.1021/acs.jmedchem.0c02126 10.7270/Q21G0R2R 33914534 Stanford, SM; Diaz, MA; Ardecky, RJ; Zou, J; Roosild, T; Holmes, ZJ; Nguyen, TP; Hedrick, MP; Rodiles, S; Guan, A; Grotegut, S; Santelli, E; Chung, TDY; Jackson, MR; Bottini, N; Pinkerton, AB 5/13/2021 8/24/2022 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50576937 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8398&target=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50576937&enzyme=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search 135418518 471053060 1 MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH 5KQP,5KQM,5KQL,5KQG,5JNS,5JNR,4Z9B,4Z9A,4Z99,7UW6,5PNT,3N8I,7KH8 Low molecular weight phosphotyrosine protein phosphatase PPAC_HUMAN P24666 A8K1L9 B5MCC7 P24667 Q16035 Q16036 Q16725 Q3KQX8 Q53RU0 51428034 Nc1ncn(Cc2ccc(Cl)cc2)c2ncnc12 InChI=1S/C12H10ClN5/c13-9-3-1-8(2-4-9)5-18-7-17-11(14)10-12(18)16-6-15-10/h1-4,6-7H,5,14H2 KGWAEWVHBHIJKP-UHFFFAOYSA-N 50576938 CHEMBL3228664 Low molecular weight phosphotyrosine protein phosphatase Homo sapiens 19400 ChEMBL 10.1021/acs.jmedchem.0c02126 10.7270/Q21G0R2R 33914534 Stanford, SM; Diaz, MA; Ardecky, RJ; Zou, J; Roosild, T; Holmes, ZJ; Nguyen, TP; Hedrick, MP; Rodiles, S; Guan, A; Grotegut, S; Santelli, E; Chung, TDY; Jackson, MR; Bottini, N; Pinkerton, AB 5/13/2021 8/24/2022 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50576938 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8398&target=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50576938&enzyme=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search 135435024 471053061 1 MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH 5KQP,5KQM,5KQL,5KQG,5JNS,5JNR,4Z9B,4Z9A,4Z99,7UW6,5PNT,3N8I,7KH8 Low molecular weight phosphotyrosine protein phosphatase PPAC_HUMAN P24666 A8K1L9 B5MCC7 P24667 Q16035 Q16036 Q16725 Q3KQX8 Q53RU0 51428035 Cc1cccc(C)c1Cn1cnc(N)c2ncnc12 InChI=1S/C14H15N5/c1-9-4-3-5-10(2)11(9)6-19-8-18-13(15)12-14(19)17-7-16-12/h3-5,7-8H,6,15H2,1-2H3 FPBAYXAGJQQVGG-UHFFFAOYSA-N 50576939 CHEMBL4851570 Low molecular weight phosphotyrosine protein phosphatase Homo sapiens 3430 ChEMBL 10.1021/acs.jmedchem.0c02126 10.7270/Q21G0R2R 33914534 Stanford, SM; Diaz, MA; Ardecky, RJ; Zou, J; Roosild, T; Holmes, ZJ; Nguyen, TP; Hedrick, MP; Rodiles, S; Guan, A; Grotegut, S; Santelli, E; Chung, TDY; Jackson, MR; Bottini, N; Pinkerton, AB 5/13/2021 8/24/2022 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50576939 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8398&target=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50576939&enzyme=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search 138740771 471053062 1 MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH 5KQP,5KQM,5KQL,5KQG,5JNS,5JNR,4Z9B,4Z9A,4Z99,7UW6,5PNT,3N8I,7KH8 Low molecular weight phosphotyrosine protein phosphatase PPAC_HUMAN P24666 A8K1L9 B5MCC7 P24667 Q16035 Q16036 Q16725 Q3KQX8 Q53RU0 51428036 Nc1ncn(Cc2c(Cl)cncc2Cl)c2ncnc12 InChI=1S/C11H8Cl2N6/c12-7-1-15-2-8(13)6(7)3-19-5-18-10(14)9-11(19)17-4-16-9/h1-2,4-5H,3,14H2 KMNIIJGMSOSTDR-UHFFFAOYSA-N 50576940 CHEMBL4857535 Low molecular weight phosphotyrosine protein phosphatase Homo sapiens 83 ChEMBL 10.1021/acs.jmedchem.0c02126 10.7270/Q21G0R2R 33914534 Stanford, SM; Diaz, MA; Ardecky, RJ; Zou, J; Roosild, T; Holmes, ZJ; Nguyen, TP; Hedrick, MP; Rodiles, S; Guan, A; Grotegut, S; Santelli, E; Chung, TDY; Jackson, MR; Bottini, N; Pinkerton, AB 5/13/2021 8/24/2022 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50576940 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8398&target=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50576940&enzyme=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search 139309077 471053063 1 MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH 5KQP,5KQM,5KQL,5KQG,5JNS,5JNR,4Z9B,4Z9A,4Z99,7UW6,5PNT,3N8I,7KH8 Low molecular weight phosphotyrosine protein phosphatase PPAC_HUMAN P24666 A8K1L9 B5MCC7 P24667 Q16035 Q16036 Q16725 Q3KQX8 Q53RU0 51428037 Cc1ccccc1-c1nc2c(N)ncn(Cc3c(Cl)cncc3Cl)c2n1 InChI=1S/C18H14Cl2N6/c1-10-4-2-3-5-11(10)17-24-15-16(21)23-9-26(18(15)25-17)8-12-13(19)6-22-7-14(12)20/h2-7,9H,8,21H2,1H3 UVQGPPRBCFJWSO-UHFFFAOYSA-N 50576941 CHEMBL4875137 Low molecular weight phosphotyrosine protein phosphatase Homo sapiens 6.0 ChEMBL 10.1021/acs.jmedchem.0c02126 10.7270/Q21G0R2R 33914534 Stanford, SM; Diaz, MA; Ardecky, RJ; Zou, J; Roosild, T; Holmes, ZJ; Nguyen, TP; Hedrick, MP; Rodiles, S; Guan, A; Grotegut, S; Santelli, E; Chung, TDY; Jackson, MR; Bottini, N; Pinkerton, AB 5/13/2021 8/24/2022 University of California http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50576941 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8398&target=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50576941&enzyme=Low+molecular+weight+phosphotyrosine+protein+phosphatase&column=ki&startPg=0&Increment=50&submit=Search 155572475 471053064 1 MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH 5KQP,5KQM,5KQL,5KQG,5JNS,5JNR,4Z9B,4Z9A,4Z99,7UW6,5PNT,3N8I,7KH8 Low molecular weight phosphotyrosine protein phosphatase PPAC_HUMAN P24666 A8K1L9 B5MCC7 P24667 Q16035 Q16036 Q16725 Q3KQX8 Q53RU0