BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
51399318	CSCOC(=O)c1coc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12	InChI=1S/C28H25N3O5S/c1-37-17-35-28(33)22-16-34-25-9-8-19(14-20(22)25)36-26-10-11-29-15-21(26)27(32)31-13-12-30(18-6-7-18)23-4-2-3-5-24(23)31/h2-5,8-11,14-16,18H,6-7,12-13,17H2,1H3	HIJSDWDRAOLXDU-UHFFFAOYSA-N	50565245	CHEMBL4783037	G-protein coupled bile acid receptor 1	Homo sapiens				 7.0					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565245	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565245&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			156705091	461685583							1	MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN	9GYO,7XTQ,7CFN,7CFM,7BW0	G-protein coupled bile acid receptor 1	GPBAR_HUMAN	Q8TDU6	B3KV35																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51399319	FC(F)(F)COC(=O)c1coc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12	InChI=1S/C28H22F3N3O5/c29-28(30,31)16-38-27(36)21-15-37-24-8-7-18(13-19(21)24)39-25-9-10-32-14-20(25)26(35)34-12-11-33(17-5-6-17)22-3-1-2-4-23(22)34/h1-4,7-10,13-15,17H,5-6,11-12,16H2	PZTWZDKTWIIJNG-UHFFFAOYSA-N	50565246	CHEMBL4784355	G-protein coupled bile acid receptor 1	Homo sapiens				 23					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565246	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565246&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			162665892	461685584							1	MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN	9GYO,7XTQ,7CFN,7CFM,7BW0	G-protein coupled bile acid receptor 1	GPBAR_HUMAN	Q8TDU6	B3KV35																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51399320	ClCOC(=O)c1coc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12	InChI=1S/C27H22ClN3O5/c28-16-35-27(33)21-15-34-24-8-7-18(13-19(21)24)36-25-9-10-29-14-20(25)26(32)31-12-11-30(17-5-6-17)22-3-1-2-4-23(22)31/h1-4,7-10,13-15,17H,5-6,11-12,16H2	GPYVEGJAOLDDOP-UHFFFAOYSA-N	50565247	CHEMBL4778884	G-protein coupled bile acid receptor 1	Homo sapiens				 84					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565247	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565247&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			156705120	461685585							1	MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN	9GYO,7XTQ,7CFN,7CFM,7BW0	G-protein coupled bile acid receptor 1	GPBAR_HUMAN	Q8TDU6	B3KV35																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51399321	CCOC(=O)OCOC(=O)c1coc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12	InChI=1S/C30H27N3O8/c1-2-37-30(36)40-18-39-29(35)23-17-38-26-10-9-20(15-21(23)26)41-27-11-12-31-16-22(27)28(34)33-14-13-32(19-7-8-19)24-5-3-4-6-25(24)33/h3-6,9-12,15-17,19H,2,7-8,13-14,18H2,1H3	IYSIPEAXDMBPQP-UHFFFAOYSA-N	50565248	CHEMBL4794523	G-protein coupled bile acid receptor 1	Homo sapiens				 137					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565248	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565248&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			156705083	461685586							1	MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN	9GYO,7XTQ,7CFN,7CFM,7BW0	G-protein coupled bile acid receptor 1	GPBAR_HUMAN	Q8TDU6	B3KV35																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51399322	CC(=O)OCOC(=O)c1coc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12	InChI=1S/C29H25N3O7/c1-18(33)37-17-38-29(35)23-16-36-26-9-8-20(14-21(23)26)39-27-10-11-30-15-22(27)28(34)32-13-12-31(19-6-7-19)24-4-2-3-5-25(24)32/h2-5,8-11,14-16,19H,6-7,12-13,17H2,1H3	AEQZAQRSTOVCGZ-UHFFFAOYSA-N	50565249	CHEMBL4782069	G-protein coupled bile acid receptor 1	Homo sapiens				 145					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565249	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565249&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			156705115	461685587							1	MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN	9GYO,7XTQ,7CFN,7CFM,7BW0	G-protein coupled bile acid receptor 1	GPBAR_HUMAN	Q8TDU6	B3KV35																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51399323	CC[C@@H]1[C@@H]2C[C@@H](CC[C@@]2([C@H]3C[C@@H]([C@]4([C@H]([C@@H]3[C@@H]1O)CC[C@@H]4[C@H](C)C[C@H](C)C(=O)O)C)O)C)O	InChI=1S/C27H46O5/c1-6-17-20-12-16(28)9-10-26(20,4)21-13-22(29)27(5)18(14(2)11-15(3)25(31)32)7-8-19(27)23(21)24(17)30/h14-24,28-30H,6-13H2,1-5H3,(H,31,32)	NPBCMXATLRCCLF-UHFFFAOYSA-N	50300199	6alpha-ethyl-23(S)-methyl-cholic acid::CHEMBL567640	G-protein coupled bile acid receptor 1	Homo sapiens				 1004					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50300199	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50300199&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	FX0	7CFN	45483949	104154560		CHEMBL567640					1	MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN	9GYO,7XTQ,7CFN,7CFM,7BW0	G-protein coupled bile acid receptor 1	GPBAR_HUMAN	Q8TDU6	B3KV35																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51399324	OC(=O)c1coc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12	InChI=1S/C26H21N3O5/c30-25(29-12-11-28(16-5-6-16)21-3-1-2-4-22(21)29)19-14-27-10-9-24(19)34-17-7-8-23-18(13-17)20(15-33-23)26(31)32/h1-4,7-10,13-16H,5-6,11-12H2,(H,31,32)	RIKIRZNHNNUOQE-UHFFFAOYSA-N	50565250	CHEMBL4792593	G-protein coupled bile acid receptor 1	Homo sapiens				 2577					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565250	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565250&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			156705111	461685588							1	MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN	9GYO,7XTQ,7CFN,7CFM,7BW0	G-protein coupled bile acid receptor 1	GPBAR_HUMAN	Q8TDU6	B3KV35																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51399325	CCOC(=O)c1coc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12	InChI=1S/C28H25N3O5/c1-2-34-28(33)22-17-35-25-10-9-19(15-20(22)25)36-26-11-12-29-16-21(26)27(32)31-14-13-30(18-7-8-18)23-5-3-4-6-24(23)31/h3-6,9-12,15-18H,2,7-8,13-14H2,1H3	QPFPWOWOCNYRAG-UHFFFAOYSA-N	50565251	CHEMBL4791709	G-protein coupled bile acid receptor 1	Homo sapiens				 2.8					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565251	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565251&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			156705112	461685589							1	MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN	9GYO,7XTQ,7CFN,7CFM,7BW0	G-protein coupled bile acid receptor 1	GPBAR_HUMAN	Q8TDU6	B3KV35																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51399326	OC(=O)c1coc2cc(Cl)c(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12	InChI=1S/C26H20ClN3O5/c27-19-12-23-16(18(14-34-23)26(32)33)11-24(19)35-22-7-8-28-13-17(22)25(31)30-10-9-29(15-5-6-15)20-3-1-2-4-21(20)30/h1-4,7-8,11-15H,5-6,9-10H2,(H,32,33)	BDBNGUKQXJYWDD-UHFFFAOYSA-N	50565252	CHEMBL3290724	G-protein coupled bile acid receptor 1	Homo sapiens				 1673					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565252	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565252&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			77845060	461685590							1	MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN	9GYO,7XTQ,7CFN,7CFM,7BW0	G-protein coupled bile acid receptor 1	GPBAR_HUMAN	Q8TDU6	B3KV35																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51399327	COCCOCOC(=O)c1coc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12	InChI=1S/C30H29N3O7/c1-36-14-15-37-19-39-30(35)24-18-38-27-9-8-21(16-22(24)27)40-28-10-11-31-17-23(28)29(34)33-13-12-32(20-6-7-20)25-4-2-3-5-26(25)33/h2-5,8-11,16-18,20H,6-7,12-15,19H2,1H3	SGVIYGVVOOCNSC-UHFFFAOYSA-N	50565253	CHEMBL4793377	G-protein coupled bile acid receptor 1	Homo sapiens				 82					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565253	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565253&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			156705085	461685591							1	MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN	9GYO,7XTQ,7CFN,7CFM,7BW0	G-protein coupled bile acid receptor 1	GPBAR_HUMAN	Q8TDU6	B3KV35																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51399328	CCOCOC(=O)c1coc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12	InChI=1S/C29H27N3O6/c1-2-35-18-37-29(34)23-17-36-26-10-9-20(15-21(23)26)38-27-11-12-30-16-22(27)28(33)32-14-13-31(19-7-8-19)24-5-3-4-6-25(24)32/h3-6,9-12,15-17,19H,2,7-8,13-14,18H2,1H3	WJLRTDVQPXBODJ-UHFFFAOYSA-N	50565254	CHEMBL4798091	G-protein coupled bile acid receptor 1	Homo sapiens				 16					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565254	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565254&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			156705098	461685592							1	MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN	9GYO,7XTQ,7CFN,7CFM,7BW0	G-protein coupled bile acid receptor 1	GPBAR_HUMAN	Q8TDU6	B3KV35																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51399329	COCOC(=O)c1coc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12	InChI=1S/C28H25N3O6/c1-34-17-36-28(33)22-16-35-25-9-8-19(14-20(22)25)37-26-10-11-29-15-21(26)27(32)31-13-12-30(18-6-7-18)23-4-2-3-5-24(23)31/h2-5,8-11,14-16,18H,6-7,12-13,17H2,1H3	RQJFPYJLJBDVLP-UHFFFAOYSA-N	50565255	CHEMBL4794753	G-protein coupled bile acid receptor 1	Homo sapiens				 4.7					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565255	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565255&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			156705119	461685593							1	MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN	9GYO,7XTQ,7CFN,7CFM,7BW0	G-protein coupled bile acid receptor 1	GPBAR_HUMAN	Q8TDU6	B3KV35																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51399330	Cc1oc(=O)oc1COC(=O)c1coc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12	InChI=1S/C31H25N3O8/c1-18-28(42-31(37)40-18)17-39-30(36)23-16-38-26-9-8-20(14-21(23)26)41-27-10-11-32-15-22(27)29(35)34-13-12-33(19-6-7-19)24-4-2-3-5-25(24)34/h2-5,8-11,14-16,19H,6-7,12-13,17H2,1H3	RYEAXQWKUKSZHX-UHFFFAOYSA-N	50565256	CHEMBL4783601	G-protein coupled bile acid receptor 1	Homo sapiens				 1287					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565256	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565256&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			156705100	461685594							1	MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN	9GYO,7XTQ,7CFN,7CFM,7BW0	G-protein coupled bile acid receptor 1	GPBAR_HUMAN	Q8TDU6	B3KV35																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51399331	CCCOC(=O)c1coc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12	InChI=1S/C29H27N3O5/c1-2-15-35-29(34)23-18-36-26-10-9-20(16-21(23)26)37-27-11-12-30-17-22(27)28(33)32-14-13-31(19-7-8-19)24-5-3-4-6-25(24)32/h3-6,9-12,16-19H,2,7-8,13-15H2,1H3	FIGCAHBOQZJJFZ-UHFFFAOYSA-N	50565257	CHEMBL4776876	G-protein coupled bile acid receptor 1	Homo sapiens				 2.1					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565257	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565257&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			156705090	461685595							1	MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN	9GYO,7XTQ,7CFN,7CFM,7BW0	G-protein coupled bile acid receptor 1	GPBAR_HUMAN	Q8TDU6	B3KV35																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51399332	COC(=O)c1coc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12	InChI=1S/C27H23N3O5/c1-33-27(32)21-16-34-24-9-8-18(14-19(21)24)35-25-10-11-28-15-20(25)26(31)30-13-12-29(17-6-7-17)22-4-2-3-5-23(22)30/h2-5,8-11,14-17H,6-7,12-13H2,1H3	IRSLHVSOSFYKNS-UHFFFAOYSA-N	50565258	CHEMBL4779084	G-protein coupled bile acid receptor 1	Homo sapiens				 0.900000					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565258	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565258&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			156705093	461685596							1	MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN	9GYO,7XTQ,7CFN,7CFM,7BW0	G-protein coupled bile acid receptor 1	GPBAR_HUMAN	Q8TDU6	B3KV35																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51399333	OC(=O)c1coc2cc(Cl)c(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12	InChI=1S/C26H20ClN3O5/c27-19-12-23-16(18(14-34-23)26(32)33)11-24(19)35-22-7-8-28-13-17(22)25(31)30-10-9-29(15-5-6-15)20-3-1-2-4-21(20)30/h1-4,7-8,11-15H,5-6,9-10H2,(H,32,33)	BDBNGUKQXJYWDD-UHFFFAOYSA-N	50565252	CHEMBL3290724	G-protein coupled bile acid receptor 1	Mus musculus				 215					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565252	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565252&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			77845060	461685590							1	MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN		G-protein coupled bile acid receptor 1	GPBAR_MOUSE	Q80SS6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51399334	CCOC(=O)c1coc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12	InChI=1S/C28H25N3O5/c1-2-34-28(33)22-17-35-25-10-9-19(15-20(22)25)36-26-11-12-29-16-21(26)27(32)31-14-13-30(18-7-8-18)23-5-3-4-6-24(23)31/h3-6,9-12,15-18H,2,7-8,13-14H2,1H3	QPFPWOWOCNYRAG-UHFFFAOYSA-N	50565251	CHEMBL4791709	G-protein coupled bile acid receptor 1	Mus musculus				 44					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565251	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565251&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			156705112	461685589							1	MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN		G-protein coupled bile acid receptor 1	GPBAR_MOUSE	Q80SS6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51399335	OC(=O)c1coc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12	InChI=1S/C26H21N3O5/c30-25(29-12-11-28(16-5-6-16)21-3-1-2-4-22(21)29)19-14-27-10-9-24(19)34-17-7-8-23-18(13-17)20(15-33-23)26(31)32/h1-4,7-10,13-16H,5-6,11-12H2,(H,31,32)	RIKIRZNHNNUOQE-UHFFFAOYSA-N	50565250	CHEMBL4792593	G-protein coupled bile acid receptor 1	Mus musculus				 6052					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565250	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565250&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			156705111	461685588							1	MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN		G-protein coupled bile acid receptor 1	GPBAR_MOUSE	Q80SS6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51399336	CC[C@@H]1[C@@H]2C[C@@H](CC[C@@]2([C@H]3C[C@@H]([C@]4([C@H]([C@@H]3[C@@H]1O)CC[C@@H]4[C@H](C)C[C@H](C)C(=O)O)C)O)C)O	InChI=1S/C27H46O5/c1-6-17-20-12-16(28)9-10-26(20,4)21-13-22(29)27(5)18(14(2)11-15(3)25(31)32)7-8-19(27)23(21)24(17)30/h14-24,28-30H,6-13H2,1-5H3,(H,31,32)	NPBCMXATLRCCLF-UHFFFAOYSA-N	50300199	6alpha-ethyl-23(S)-methyl-cholic acid::CHEMBL567640	G-protein coupled bile acid receptor 1	Mus musculus				 251					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50300199	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50300199&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	FX0		45483949	104154560		CHEMBL567640					1	MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN		G-protein coupled bile acid receptor 1	GPBAR_MOUSE	Q80SS6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51399337	COC(=O)c1coc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12	InChI=1S/C27H23N3O5/c1-33-27(32)21-16-34-24-9-8-18(14-19(21)24)35-25-10-11-28-15-20(25)26(31)30-13-12-29(17-6-7-17)22-4-2-3-5-23(22)30/h2-5,8-11,14-17H,6-7,12-13H2,1H3	IRSLHVSOSFYKNS-UHFFFAOYSA-N	50565258	CHEMBL4779084	G-protein coupled bile acid receptor 1	Mus musculus				 23					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565258	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565258&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			156705093	461685596							1	MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN		G-protein coupled bile acid receptor 1	GPBAR_MOUSE	Q80SS6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51399338	CCCOC(=O)c1coc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12	InChI=1S/C29H27N3O5/c1-2-15-35-29(34)23-18-36-26-10-9-20(16-21(23)26)37-27-11-12-30-17-22(27)28(33)32-14-13-31(19-7-8-19)24-5-3-4-6-25(24)32/h3-6,9-12,16-19H,2,7-8,13-15H2,1H3	FIGCAHBOQZJJFZ-UHFFFAOYSA-N	50565257	CHEMBL4776876	G-protein coupled bile acid receptor 1	Mus musculus				 115					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565257	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565257&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			156705090	461685595							1	MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN		G-protein coupled bile acid receptor 1	GPBAR_MOUSE	Q80SS6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51399339	CC(=O)OCOC(=O)c1coc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12	InChI=1S/C29H25N3O7/c1-18(33)37-17-38-29(35)23-16-36-26-9-8-20(14-21(23)26)39-27-10-11-30-15-22(27)28(34)32-13-12-31(19-6-7-19)24-4-2-3-5-25(24)32/h2-5,8-11,14-16,19H,6-7,12-13,17H2,1H3	AEQZAQRSTOVCGZ-UHFFFAOYSA-N	50565249	CHEMBL4782069	G-protein coupled bile acid receptor 1	Mus musculus				 561					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565249	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565249&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			156705115	461685587							1	MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN		G-protein coupled bile acid receptor 1	GPBAR_MOUSE	Q80SS6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51399340	Cc1oc(=O)oc1COC(=O)c1coc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12	InChI=1S/C31H25N3O8/c1-18-28(42-31(37)40-18)17-39-30(36)23-16-38-26-9-8-20(14-21(23)26)41-27-10-11-32-15-22(27)29(35)34-13-12-33(19-6-7-19)24-4-2-3-5-25(24)34/h2-5,8-11,14-16,19H,6-7,12-13,17H2,1H3	RYEAXQWKUKSZHX-UHFFFAOYSA-N	50565256	CHEMBL4783601	G-protein coupled bile acid receptor 1	Mus musculus				 5953					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565256	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565256&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			156705100	461685594							1	MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN		G-protein coupled bile acid receptor 1	GPBAR_MOUSE	Q80SS6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51399341	CCOC(=O)OCOC(=O)c1coc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12	InChI=1S/C30H27N3O8/c1-2-37-30(36)40-18-39-29(35)23-17-38-26-10-9-20(15-21(23)26)41-27-11-12-31-16-22(27)28(34)33-14-13-32(19-7-8-19)24-5-3-4-6-25(24)33/h3-6,9-12,15-17,19H,2,7-8,13-14,18H2,1H3	IYSIPEAXDMBPQP-UHFFFAOYSA-N	50565248	CHEMBL4794523	G-protein coupled bile acid receptor 1	Mus musculus				 1372					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565248	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565248&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			156705083	461685586							1	MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN		G-protein coupled bile acid receptor 1	GPBAR_MOUSE	Q80SS6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51399342	ClCOC(=O)c1coc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12	InChI=1S/C27H22ClN3O5/c28-16-35-27(33)21-15-34-24-8-7-18(13-19(21)24)36-25-9-10-29-14-20(25)26(32)31-12-11-30(17-5-6-17)22-3-1-2-4-23(22)31/h1-4,7-10,13-15,17H,5-6,11-12,16H2	GPYVEGJAOLDDOP-UHFFFAOYSA-N	50565247	CHEMBL4778884	G-protein coupled bile acid receptor 1	Mus musculus				 3468					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565247	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565247&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			156705120	461685585							1	MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN		G-protein coupled bile acid receptor 1	GPBAR_MOUSE	Q80SS6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51399343	FC(F)(F)COC(=O)c1coc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12	InChI=1S/C28H22F3N3O5/c29-28(30,31)16-38-27(36)21-15-37-24-8-7-18(13-19(21)24)39-25-9-10-32-14-20(25)26(35)34-12-11-33(17-5-6-17)22-3-1-2-4-23(22)34/h1-4,7-10,13-15,17H,5-6,11-12,16H2	PZTWZDKTWIIJNG-UHFFFAOYSA-N	50565246	CHEMBL4784355	G-protein coupled bile acid receptor 1	Mus musculus				 388					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565246	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565246&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			162665892	461685584							1	MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN		G-protein coupled bile acid receptor 1	GPBAR_MOUSE	Q80SS6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51399344	CSCOC(=O)c1coc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12	InChI=1S/C28H25N3O5S/c1-37-17-35-28(33)22-16-34-25-9-8-19(14-20(22)25)36-26-10-11-29-15-21(26)27(32)31-13-12-30(18-6-7-18)23-4-2-3-5-24(23)31/h2-5,8-11,14-16,18H,6-7,12-13,17H2,1H3	HIJSDWDRAOLXDU-UHFFFAOYSA-N	50565245	CHEMBL4783037	G-protein coupled bile acid receptor 1	Mus musculus				 143					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565245	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565245&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			156705091	461685583							1	MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN		G-protein coupled bile acid receptor 1	GPBAR_MOUSE	Q80SS6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51399345	COCOC(=O)c1coc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12	InChI=1S/C28H25N3O6/c1-34-17-36-28(33)22-16-35-25-9-8-19(14-20(22)25)37-26-10-11-29-15-21(26)27(32)31-13-12-30(18-6-7-18)23-4-2-3-5-24(23)31/h2-5,8-11,14-16,18H,6-7,12-13,17H2,1H3	RQJFPYJLJBDVLP-UHFFFAOYSA-N	50565255	CHEMBL4794753	G-protein coupled bile acid receptor 1	Mus musculus				 137					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565255	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565255&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			156705119	461685593							1	MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN		G-protein coupled bile acid receptor 1	GPBAR_MOUSE	Q80SS6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51399346	CCOCOC(=O)c1coc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12	InChI=1S/C29H27N3O6/c1-2-35-18-37-29(34)23-17-36-26-10-9-20(15-21(23)26)38-27-11-12-30-16-22(27)28(33)32-14-13-31(19-7-8-19)24-5-3-4-6-25(24)32/h3-6,9-12,15-17,19H,2,7-8,13-14,18H2,1H3	WJLRTDVQPXBODJ-UHFFFAOYSA-N	50565254	CHEMBL4798091	G-protein coupled bile acid receptor 1	Mus musculus				 209					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565254	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565254&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			156705098	461685592							1	MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN		G-protein coupled bile acid receptor 1	GPBAR_MOUSE	Q80SS6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51399347	COCCOCOC(=O)c1coc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12	InChI=1S/C30H29N3O7/c1-36-14-15-37-19-39-30(35)24-18-38-27-9-8-21(16-22(24)27)40-28-10-11-31-17-23(28)29(34)33-13-12-32(20-6-7-20)25-4-2-3-5-26(25)33/h2-5,8-11,16-18,20H,6-7,12-15,19H2,1H3	SGVIYGVVOOCNSC-UHFFFAOYSA-N	50565253	CHEMBL4793377	G-protein coupled bile acid receptor 1	Mus musculus				 211					ChEMBL	10.1016/j.ejmech.2020.112619	10.7270/Q28G8QFG	32682201			Han, F; Ning, M; Cao, H; Ye, Y; Feng, Y; Leng, Y; Shen, J	10/1/2020	3/30/2022	Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565253	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565253&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			156705085	461685591							1	MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN		G-protein coupled bile acid receptor 1	GPBAR_MOUSE	Q80SS6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
