BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
51398743	Nc1cc(ccn1)N1c2ccc(NC(=O)Nc3ccc(Cl)c(c3)C(F)(F)F)cc2Oc2ncccc2C1=O	InChI=1S/C25H16ClF3N6O3/c26-18-5-3-13(10-17(18)25(27,28)29)33-24(37)34-14-4-6-19-20(11-14)38-22-16(2-1-8-32-22)23(36)35(19)15-7-9-31-21(30)12-15/h1-12H,(H2,30,31)(H2,33,34,37)	VQVRSCPORIUCDA-UHFFFAOYSA-N	50565103	CHEMBL4777657	Cyclin-dependent kinase 8	Homo sapiens		>10000							ChEMBL	10.1016/j.ejmech.2020.112443	10.7270/Q2TF023Q	32599324			Martínez-González, S; García, AB; Albarrán, MI; Cebriá, A; Amezquita-Alves, A; García-Campos, FJ; Martínez-Gago, J; Martínez-Torrecuadrada, J; Muñoz, IG; Blanco-Aparicio, C; Pastor, J	9/1/2020	3/29/2022	Spanish National Cancer Research Centre (Cnio)	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565103	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3907&target=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565103&enzyme=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search			162644031	461685441							1	MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY	8TQC,8TQ2,6T41,6TPA,6Y0A,6R3S,5HVY,5CEI,5BNJ,4G6L,4F7S,4F7N,4F7L,4F7J,4F70,4F6W,4F6U,4F6S,4CRL,3RGF,6QTJ,6QTG,9H8S,9H8C,5XS2,5XQX,5IDP,5IDN,5I5Z,5HNB,5ICP,5HBJ,5HBH,5HBE,5FGK	Cyclin-dependent kinase 8	CDK8_HUMAN	P49336	Q5VUF3 Q6ISB5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51398744	O=C(Nc1ccccc1)Nc1ccc2N(c3ccncc3)C(=O)c3cccnc3Oc2c1	InChI=1S/C24H17N5O3/c30-23-19-7-4-12-26-22(19)32-21-15-17(28-24(31)27-16-5-2-1-3-6-16)8-9-20(21)29(23)18-10-13-25-14-11-18/h1-15H,(H2,27,28,31)	FKBZVMKCOKELFC-UHFFFAOYSA-N	50565104	CHEMBL4788035	Cyclin-dependent kinase 8	Homo sapiens		>10000							ChEMBL	10.1016/j.ejmech.2020.112443	10.7270/Q2TF023Q	32599324			Martínez-González, S; García, AB; Albarrán, MI; Cebriá, A; Amezquita-Alves, A; García-Campos, FJ; Martínez-Gago, J; Martínez-Torrecuadrada, J; Muñoz, IG; Blanco-Aparicio, C; Pastor, J	9/1/2020	3/29/2022	Spanish National Cancer Research Centre (Cnio)	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565104	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3907&target=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565104&enzyme=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search			162668723	461685442							1	MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY	8TQC,8TQ2,6T41,6TPA,6Y0A,6R3S,5HVY,5CEI,5BNJ,4G6L,4F7S,4F7N,4F7L,4F7J,4F70,4F6W,4F6U,4F6S,4CRL,3RGF,6QTJ,6QTG,9H8S,9H8C,5XS2,5XQX,5IDP,5IDN,5I5Z,5HNB,5ICP,5HBJ,5HBH,5HBE,5FGK	Cyclin-dependent kinase 8	CDK8_HUMAN	P49336	Q5VUF3 Q6ISB5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51398745	c1cc2c(nc1)Oc3cc(ccc3N(C2=O)c4ccncc4)NC(=O)Nc5ccc(c(c5)C(F)(F)F)Cl	InChI=1S/C25H15ClF3N5O3/c26-19-5-3-14(12-18(19)25(27,28)29)32-24(36)33-15-4-6-20-21(13-15)37-22-17(2-1-9-31-22)23(35)34(20)16-7-10-30-11-8-16/h1-13H,(H2,32,33,36)	NQHGDUGVQSAKOR-UHFFFAOYSA-N	50565105	CHEMBL4792974	Cyclin-dependent kinase 8	Homo sapiens		 1300							ChEMBL	10.1016/j.ejmech.2020.112443	10.7270/Q2TF023Q	32599324			Martínez-González, S; García, AB; Albarrán, MI; Cebriá, A; Amezquita-Alves, A; García-Campos, FJ; Martínez-Gago, J; Martínez-Torrecuadrada, J; Muñoz, IG; Blanco-Aparicio, C; Pastor, J	9/1/2020	3/29/2022	Spanish National Cancer Research Centre (Cnio)	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565105	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3907&target=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565105&enzyme=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search	NZ8	6TPA	154815588	461685443							1	MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY	8TQC,8TQ2,6T41,6TPA,6Y0A,6R3S,5HVY,5CEI,5BNJ,4G6L,4F7S,4F7N,4F7L,4F7J,4F70,4F6W,4F6U,4F6S,4CRL,3RGF,6QTJ,6QTG,9H8S,9H8C,5XS2,5XQX,5IDP,5IDN,5I5Z,5HNB,5ICP,5HBJ,5HBH,5HBE,5FGK	Cyclin-dependent kinase 8	CDK8_HUMAN	P49336	Q5VUF3 Q6ISB5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51398746	CNC(=O)c1cc(ccn1)Oc2ccc(cc2)NC(=O)Nc3ccc(c(c3)C(F)(F)F)Cl	InChI=1S/C21H16ClF3N4O3/c1-26-19(30)18-11-15(8-9-27-18)32-14-5-2-12(3-6-14)28-20(31)29-13-4-7-17(22)16(10-13)21(23,24)25/h2-11H,1H3,(H,26,30)(H2,28,29,31)	MLDQJTXFUGDVEO-UHFFFAOYSA-N	16673	BAY439006::CHEMBL1336::BAY 43-9006::4-[4-({[4-chloro-3-(trifluoromethyl)phenyl]carbamoyl}amino)phenoxy]-N-methylpyridine-2-carboxamide::4-[4-[[4-chloro-3-(trifluoromethyl)phenyl]carbamoylamino]phenoxy]-N-methyl-picolinamide;tosylic acid::Sorafenib, 4::Hit compound, 8::Sorafenib::Nexavar::cid_216239::BAY 439006::US9029401, Sorafenib::US9469639, Sorafenib::US10183928, Sorafenib::US10202365, Compound Sorafenib::US10227329, Compound Sorafenib::US9902709, Comparative example 1::US10584114, Compound Sorafenib::US10774070, Compound Sorafenib::US10980809, Example Sorafenib::US11505527, Compound Sorafenib::US11279688, Compound Sorafenib::US11912663, Compound Sorafenib::US20250129067, Compound Sorafenib	Cyclin-dependent kinase 8	Homo sapiens		>10000							ChEMBL	10.1016/j.ejmech.2020.112443	10.7270/Q2TF023Q	32599324			Martínez-González, S; García, AB; Albarrán, MI; Cebriá, A; Amezquita-Alves, A; García-Campos, FJ; Martínez-Gago, J; Martínez-Torrecuadrada, J; Muñoz, IG; Blanco-Aparicio, C; Pastor, J	9/1/2020	3/29/2022	Spanish National Cancer Research Centre (Cnio)	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=16673	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3907&target=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=16673&enzyme=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search	BAX	1UWH,1UWJ,3GCS,3HEG,3RGF,3WZE,4ASD,5HI2	216239	46516901		CHEMBL1336	DB00398				1	MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY	8TQC,8TQ2,6T41,6TPA,6Y0A,6R3S,5HVY,5CEI,5BNJ,4G6L,4F7S,4F7N,4F7L,4F7J,4F70,4F6W,4F6U,4F6S,4CRL,3RGF,6QTJ,6QTG,9H8S,9H8C,5XS2,5XQX,5IDP,5IDN,5I5Z,5HNB,5ICP,5HBJ,5HBH,5HBE,5FGK	Cyclin-dependent kinase 8	CDK8_HUMAN	P49336	Q5VUF3 Q6ISB5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51398747	CCCNC(=O)Nc1ccc2N(c3ccncc3)C(=O)c3cccnc3Oc2c1	InChI=1S/C21H19N5O3/c1-2-9-24-21(28)25-14-5-6-17-18(13-14)29-19-16(4-3-10-23-19)20(27)26(17)15-7-11-22-12-8-15/h3-8,10-13H,2,9H2,1H3,(H2,24,25,28)	UJBHDCQXVDDIJD-UHFFFAOYSA-N	50565106	CHEMBL4784034	Cyclin-dependent kinase 8	Homo sapiens		 5060							ChEMBL	10.1016/j.ejmech.2020.112443	10.7270/Q2TF023Q	32599324			Martínez-González, S; García, AB; Albarrán, MI; Cebriá, A; Amezquita-Alves, A; García-Campos, FJ; Martínez-Gago, J; Martínez-Torrecuadrada, J; Muñoz, IG; Blanco-Aparicio, C; Pastor, J	9/1/2020	3/29/2022	Spanish National Cancer Research Centre (Cnio)	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565106	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3907&target=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565106&enzyme=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search			162665348	461685444							1	MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY	8TQC,8TQ2,6T41,6TPA,6Y0A,6R3S,5HVY,5CEI,5BNJ,4G6L,4F7S,4F7N,4F7L,4F7J,4F70,4F6W,4F6U,4F6S,4CRL,3RGF,6QTJ,6QTG,9H8S,9H8C,5XS2,5XQX,5IDP,5IDN,5I5Z,5HNB,5ICP,5HBJ,5HBH,5HBE,5FGK	Cyclin-dependent kinase 8	CDK8_HUMAN	P49336	Q5VUF3 Q6ISB5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51398748	Fc1ccccc1CNC(=O)Nc1ccc2N(c3ccncc3)C(=O)c3cccnc3Oc2c1	InChI=1S/C25H18FN5O3/c26-20-6-2-1-4-16(20)15-29-25(33)30-17-7-8-21-22(14-17)34-23-19(5-3-11-28-23)24(32)31(21)18-9-12-27-13-10-18/h1-14H,15H2,(H2,29,30,33)	JQWQKNQRHISWOP-UHFFFAOYSA-N	50565107	CHEMBL4800453	Cyclin-dependent kinase 8	Homo sapiens		 324							ChEMBL	10.1016/j.ejmech.2020.112443	10.7270/Q2TF023Q	32599324			Martínez-González, S; García, AB; Albarrán, MI; Cebriá, A; Amezquita-Alves, A; García-Campos, FJ; Martínez-Gago, J; Martínez-Torrecuadrada, J; Muñoz, IG; Blanco-Aparicio, C; Pastor, J	9/1/2020	3/29/2022	Spanish National Cancer Research Centre (Cnio)	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565107	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3907&target=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565107&enzyme=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search			162677265	461685445							1	MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY	8TQC,8TQ2,6T41,6TPA,6Y0A,6R3S,5HVY,5CEI,5BNJ,4G6L,4F7S,4F7N,4F7L,4F7J,4F70,4F6W,4F6U,4F6S,4CRL,3RGF,6QTJ,6QTG,9H8S,9H8C,5XS2,5XQX,5IDP,5IDN,5I5Z,5HNB,5ICP,5HBJ,5HBH,5HBE,5FGK	Cyclin-dependent kinase 8	CDK8_HUMAN	P49336	Q5VUF3 Q6ISB5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51398749	O=C(Nc1ccccc1)Nc1ccc2N(c3ccncc3)C(=O)c3cccnc3Oc2c1	InChI=1S/C24H17N5O3/c30-23-19-7-4-12-26-22(19)32-21-15-17(28-24(31)27-16-5-2-1-3-6-16)8-9-20(21)29(23)18-10-13-25-14-11-18/h1-15H,(H2,27,28,31)	FKBZVMKCOKELFC-UHFFFAOYSA-N	50565104	CHEMBL4788035	Cyclin-dependent kinase 8	Homo sapiens		 10.0							ChEMBL	10.1016/j.ejmech.2020.112443	10.7270/Q2TF023Q	32599324			Martínez-González, S; García, AB; Albarrán, MI; Cebriá, A; Amezquita-Alves, A; García-Campos, FJ; Martínez-Gago, J; Martínez-Torrecuadrada, J; Muñoz, IG; Blanco-Aparicio, C; Pastor, J	9/1/2020	3/29/2022	Spanish National Cancer Research Centre (Cnio)	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565104	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3907&target=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565104&enzyme=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search			162668723	461685442							1	MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY	8TQC,8TQ2,6T41,6TPA,6Y0A,6R3S,5HVY,5CEI,5BNJ,4G6L,4F7S,4F7N,4F7L,4F7J,4F70,4F6W,4F6U,4F6S,4CRL,3RGF,6QTJ,6QTG,9H8S,9H8C,5XS2,5XQX,5IDP,5IDN,5I5Z,5HNB,5ICP,5HBJ,5HBH,5HBE,5FGK	Cyclin-dependent kinase 8	CDK8_HUMAN	P49336	Q5VUF3 Q6ISB5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51398750	O=C(Nc1ccccc1)Nc1ccc2N(c3cccnc3)C(=O)c3cccnc3Oc2c1	InChI=1S/C24H17N5O3/c30-23-19-9-5-13-26-22(19)32-21-14-17(28-24(31)27-16-6-2-1-3-7-16)10-11-20(21)29(23)18-8-4-12-25-15-18/h1-15H,(H2,27,28,31)	MMXUSEWWJQJNTI-UHFFFAOYSA-N	50565108	CHEMBL4786534	Cyclin-dependent kinase 8	Homo sapiens		 4080							ChEMBL	10.1016/j.ejmech.2020.112443	10.7270/Q2TF023Q	32599324			Martínez-González, S; García, AB; Albarrán, MI; Cebriá, A; Amezquita-Alves, A; García-Campos, FJ; Martínez-Gago, J; Martínez-Torrecuadrada, J; Muñoz, IG; Blanco-Aparicio, C; Pastor, J	9/1/2020	3/29/2022	Spanish National Cancer Research Centre (Cnio)	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565108	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3907&target=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565108&enzyme=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search			162667786	461685446							1	MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY	8TQC,8TQ2,6T41,6TPA,6Y0A,6R3S,5HVY,5CEI,5BNJ,4G6L,4F7S,4F7N,4F7L,4F7J,4F70,4F6W,4F6U,4F6S,4CRL,3RGF,6QTJ,6QTG,9H8S,9H8C,5XS2,5XQX,5IDP,5IDN,5I5Z,5HNB,5ICP,5HBJ,5HBH,5HBE,5FGK	Cyclin-dependent kinase 8	CDK8_HUMAN	P49336	Q5VUF3 Q6ISB5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51398751	O=C(Nc1ccccc1)Nc1ccc2N(c3ccoc3)C(=O)c3cccnc3Oc2c1	InChI=1S/C23H16N4O4/c28-22-18-7-4-11-24-21(18)31-20-13-16(26-23(29)25-15-5-2-1-3-6-15)8-9-19(20)27(22)17-10-12-30-14-17/h1-14H,(H2,25,26,29)	WDAJBXDNCGOTFY-UHFFFAOYSA-N	50565109	CHEMBL4796082	Cyclin-dependent kinase 8	Homo sapiens		 593							ChEMBL	10.1016/j.ejmech.2020.112443	10.7270/Q2TF023Q	32599324			Martínez-González, S; García, AB; Albarrán, MI; Cebriá, A; Amezquita-Alves, A; García-Campos, FJ; Martínez-Gago, J; Martínez-Torrecuadrada, J; Muñoz, IG; Blanco-Aparicio, C; Pastor, J	9/1/2020	3/29/2022	Spanish National Cancer Research Centre (Cnio)	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565109	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3907&target=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565109&enzyme=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search			162673866	461685447							1	MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY	8TQC,8TQ2,6T41,6TPA,6Y0A,6R3S,5HVY,5CEI,5BNJ,4G6L,4F7S,4F7N,4F7L,4F7J,4F70,4F6W,4F6U,4F6S,4CRL,3RGF,6QTJ,6QTG,9H8S,9H8C,5XS2,5XQX,5IDP,5IDN,5I5Z,5HNB,5ICP,5HBJ,5HBH,5HBE,5FGK	Cyclin-dependent kinase 8	CDK8_HUMAN	P49336	Q5VUF3 Q6ISB5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51398752	O=C(Nc1ccccc1)Nc1ccc2N(Cc3ccncc3)C(=O)c3cccnc3Oc2c1	InChI=1S/C25H19N5O3/c31-24-20-7-4-12-27-23(20)33-22-15-19(29-25(32)28-18-5-2-1-3-6-18)8-9-21(22)30(24)16-17-10-13-26-14-11-17/h1-15H,16H2,(H2,28,29,32)	ADPBSLWBQNSPIO-UHFFFAOYSA-N	50565110	CHEMBL4784797	Cyclin-dependent kinase 8	Homo sapiens		 1780							ChEMBL	10.1016/j.ejmech.2020.112443	10.7270/Q2TF023Q	32599324			Martínez-González, S; García, AB; Albarrán, MI; Cebriá, A; Amezquita-Alves, A; García-Campos, FJ; Martínez-Gago, J; Martínez-Torrecuadrada, J; Muñoz, IG; Blanco-Aparicio, C; Pastor, J	9/1/2020	3/29/2022	Spanish National Cancer Research Centre (Cnio)	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565110	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3907&target=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565110&enzyme=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search			162665931	461685448							1	MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY	8TQC,8TQ2,6T41,6TPA,6Y0A,6R3S,5HVY,5CEI,5BNJ,4G6L,4F7S,4F7N,4F7L,4F7J,4F70,4F6W,4F6U,4F6S,4CRL,3RGF,6QTJ,6QTG,9H8S,9H8C,5XS2,5XQX,5IDP,5IDN,5I5Z,5HNB,5ICP,5HBJ,5HBH,5HBE,5FGK	Cyclin-dependent kinase 8	CDK8_HUMAN	P49336	Q5VUF3 Q6ISB5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51398753	O=C(Nc1ccccc1)Nc1ccc2N(c3ccncc3)C(=O)c3ccccc3Oc2c1	InChI=1S/C25H18N4O3/c30-24-20-8-4-5-9-22(20)32-23-16-18(28-25(31)27-17-6-2-1-3-7-17)10-11-21(23)29(24)19-12-14-26-15-13-19/h1-16H,(H2,27,28,31)	BUOFJYWXJHGQMM-UHFFFAOYSA-N	50565111	CHEMBL4791801	Cyclin-dependent kinase 8	Homo sapiens		 1150							ChEMBL	10.1016/j.ejmech.2020.112443	10.7270/Q2TF023Q	32599324			Martínez-González, S; García, AB; Albarrán, MI; Cebriá, A; Amezquita-Alves, A; García-Campos, FJ; Martínez-Gago, J; Martínez-Torrecuadrada, J; Muñoz, IG; Blanco-Aparicio, C; Pastor, J	9/1/2020	3/29/2022	Spanish National Cancer Research Centre (Cnio)	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565111	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3907&target=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565111&enzyme=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search			162670441	461685449							1	MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY	8TQC,8TQ2,6T41,6TPA,6Y0A,6R3S,5HVY,5CEI,5BNJ,4G6L,4F7S,4F7N,4F7L,4F7J,4F70,4F6W,4F6U,4F6S,4CRL,3RGF,6QTJ,6QTG,9H8S,9H8C,5XS2,5XQX,5IDP,5IDN,5I5Z,5HNB,5ICP,5HBJ,5HBH,5HBE,5FGK	Cyclin-dependent kinase 8	CDK8_HUMAN	P49336	Q5VUF3 Q6ISB5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51398754	O=C(Nc1ccc2N(c3ccncc3)C(=O)c3cccnc3Oc2c1)c1ccccc1	InChI=1S/C24H16N4O3/c29-22(16-5-2-1-3-6-16)27-17-8-9-20-21(15-17)31-23-19(7-4-12-26-23)24(30)28(20)18-10-13-25-14-11-18/h1-15H,(H,27,29)	QPAYDVLAMWIBOW-UHFFFAOYSA-N	50565112	CHEMBL4781614	Cyclin-dependent kinase 8	Homo sapiens		 2400							ChEMBL	10.1016/j.ejmech.2020.112443	10.7270/Q2TF023Q	32599324			Martínez-González, S; García, AB; Albarrán, MI; Cebriá, A; Amezquita-Alves, A; García-Campos, FJ; Martínez-Gago, J; Martínez-Torrecuadrada, J; Muñoz, IG; Blanco-Aparicio, C; Pastor, J	9/1/2020	3/29/2022	Spanish National Cancer Research Centre (Cnio)	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565112	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3907&target=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565112&enzyme=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search			162664742	461685450							1	MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY	8TQC,8TQ2,6T41,6TPA,6Y0A,6R3S,5HVY,5CEI,5BNJ,4G6L,4F7S,4F7N,4F7L,4F7J,4F70,4F6W,4F6U,4F6S,4CRL,3RGF,6QTJ,6QTG,9H8S,9H8C,5XS2,5XQX,5IDP,5IDN,5I5Z,5HNB,5ICP,5HBJ,5HBH,5HBE,5FGK	Cyclin-dependent kinase 8	CDK8_HUMAN	P49336	Q5VUF3 Q6ISB5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51398755	O=C(Cc1ccccc1)Nc1ccc2N(c3ccncc3)C(=O)c3cccnc3Oc2c1	InChI=1S/C25H18N4O3/c30-23(15-17-5-2-1-3-6-17)28-18-8-9-21-22(16-18)32-24-20(7-4-12-27-24)25(31)29(21)19-10-13-26-14-11-19/h1-14,16H,15H2,(H,28,30)	TWCTVZBKDGYFCL-UHFFFAOYSA-N	50565113	CHEMBL4782031	Cyclin-dependent kinase 8	Homo sapiens		 2500							ChEMBL	10.1016/j.ejmech.2020.112443	10.7270/Q2TF023Q	32599324			Martínez-González, S; García, AB; Albarrán, MI; Cebriá, A; Amezquita-Alves, A; García-Campos, FJ; Martínez-Gago, J; Martínez-Torrecuadrada, J; Muñoz, IG; Blanco-Aparicio, C; Pastor, J	9/1/2020	3/29/2022	Spanish National Cancer Research Centre (Cnio)	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565113	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3907&target=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565113&enzyme=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search			162664332	461685451							1	MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY	8TQC,8TQ2,6T41,6TPA,6Y0A,6R3S,5HVY,5CEI,5BNJ,4G6L,4F7S,4F7N,4F7L,4F7J,4F70,4F6W,4F6U,4F6S,4CRL,3RGF,6QTJ,6QTG,9H8S,9H8C,5XS2,5XQX,5IDP,5IDN,5I5Z,5HNB,5ICP,5HBJ,5HBH,5HBE,5FGK	Cyclin-dependent kinase 8	CDK8_HUMAN	P49336	Q5VUF3 Q6ISB5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51398756	CC(O)(C(=O)Nc1ccc2N(c3ccncc3)C(=O)c3cccnc3Oc2c1)C(F)(F)F	InChI=1S/C21H15F3N4O4/c1-20(31,21(22,23)24)19(30)27-12-4-5-15-16(11-12)32-17-14(3-2-8-26-17)18(29)28(15)13-6-9-25-10-7-13/h2-11,31H,1H3,(H,27,30)	XACGKDHVTHRXLL-UHFFFAOYSA-N	50565114	CHEMBL4786883	Cyclin-dependent kinase 8	Homo sapiens		>10000							ChEMBL	10.1016/j.ejmech.2020.112443	10.7270/Q2TF023Q	32599324			Martínez-González, S; García, AB; Albarrán, MI; Cebriá, A; Amezquita-Alves, A; García-Campos, FJ; Martínez-Gago, J; Martínez-Torrecuadrada, J; Muñoz, IG; Blanco-Aparicio, C; Pastor, J	9/1/2020	3/29/2022	Spanish National Cancer Research Centre (Cnio)	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565114	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3907&target=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565114&enzyme=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search			162667138	461685452							1	MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY	8TQC,8TQ2,6T41,6TPA,6Y0A,6R3S,5HVY,5CEI,5BNJ,4G6L,4F7S,4F7N,4F7L,4F7J,4F70,4F6W,4F6U,4F6S,4CRL,3RGF,6QTJ,6QTG,9H8S,9H8C,5XS2,5XQX,5IDP,5IDN,5I5Z,5HNB,5ICP,5HBJ,5HBH,5HBE,5FGK	Cyclin-dependent kinase 8	CDK8_HUMAN	P49336	Q5VUF3 Q6ISB5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51398757	CC(C)(O)C(=O)Nc1ccc2N(c3ccncc3)C(=O)c3cccnc3Oc2c1	InChI=1S/C21H18N4O4/c1-21(2,28)20(27)24-13-5-6-16-17(12-13)29-18-15(4-3-9-23-18)19(26)25(16)14-7-10-22-11-8-14/h3-12,28H,1-2H3,(H,24,27)	HHYRYKRHQMXQKZ-UHFFFAOYSA-N	50565115	CHEMBL4794940	Cyclin-dependent kinase 8	Homo sapiens		 5100							ChEMBL	10.1016/j.ejmech.2020.112443	10.7270/Q2TF023Q	32599324			Martínez-González, S; García, AB; Albarrán, MI; Cebriá, A; Amezquita-Alves, A; García-Campos, FJ; Martínez-Gago, J; Martínez-Torrecuadrada, J; Muñoz, IG; Blanco-Aparicio, C; Pastor, J	9/1/2020	3/29/2022	Spanish National Cancer Research Centre (Cnio)	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565115	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3907&target=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565115&enzyme=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search			162674337	461685453							1	MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY	8TQC,8TQ2,6T41,6TPA,6Y0A,6R3S,5HVY,5CEI,5BNJ,4G6L,4F7S,4F7N,4F7L,4F7J,4F70,4F6W,4F6U,4F6S,4CRL,3RGF,6QTJ,6QTG,9H8S,9H8C,5XS2,5XQX,5IDP,5IDN,5I5Z,5HNB,5ICP,5HBJ,5HBH,5HBE,5FGK	Cyclin-dependent kinase 8	CDK8_HUMAN	P49336	Q5VUF3 Q6ISB5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51398758	O=C(Nc1ccc2N(c3ccncc3)C(=O)c3cccnc3Oc2c1)S(=O)(=O)c1ccccc1	InChI=1S/C24H16N4O5S/c29-23-19-7-4-12-26-22(19)33-21-15-16(8-9-20(21)28(23)17-10-13-25-14-11-17)27-24(30)34(31,32)18-5-2-1-3-6-18/h1-15H,(H,27,30)	IKRHGKYLAVJSOF-UHFFFAOYSA-N	50565116	CHEMBL4795034	Cyclin-dependent kinase 8	Homo sapiens		>10000							ChEMBL	10.1016/j.ejmech.2020.112443	10.7270/Q2TF023Q	32599324			Martínez-González, S; García, AB; Albarrán, MI; Cebriá, A; Amezquita-Alves, A; García-Campos, FJ; Martínez-Gago, J; Martínez-Torrecuadrada, J; Muñoz, IG; Blanco-Aparicio, C; Pastor, J	9/1/2020	3/29/2022	Spanish National Cancer Research Centre (Cnio)	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565116	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3907&target=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565116&enzyme=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search			162673582	461685454							1	MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY	8TQC,8TQ2,6T41,6TPA,6Y0A,6R3S,5HVY,5CEI,5BNJ,4G6L,4F7S,4F7N,4F7L,4F7J,4F70,4F6W,4F6U,4F6S,4CRL,3RGF,6QTJ,6QTG,9H8S,9H8C,5XS2,5XQX,5IDP,5IDN,5I5Z,5HNB,5ICP,5HBJ,5HBH,5HBE,5FGK	Cyclin-dependent kinase 8	CDK8_HUMAN	P49336	Q5VUF3 Q6ISB5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51398759	CNC(=O)c1cc(ccn1)N1c2ccc(NC(=O)Nc3ccc(Cl)c(c3)C(F)(F)F)cc2Oc2ncccc2C1=O	InChI=1S/C27H18ClF3N6O4/c1-32-23(38)20-13-16(8-10-33-20)37-21-7-5-15(12-22(21)41-24-17(25(37)39)3-2-9-34-24)36-26(40)35-14-4-6-19(28)18(11-14)27(29,30)31/h2-13H,1H3,(H,32,38)(H2,35,36,40)	JGLSUCDVLIJDRY-UHFFFAOYSA-N	50565117	CHEMBL4780260	Cyclin-dependent kinase 8	Homo sapiens		 361							ChEMBL	10.1016/j.ejmech.2020.112443	10.7270/Q2TF023Q	32599324			Martínez-González, S; García, AB; Albarrán, MI; Cebriá, A; Amezquita-Alves, A; García-Campos, FJ; Martínez-Gago, J; Martínez-Torrecuadrada, J; Muñoz, IG; Blanco-Aparicio, C; Pastor, J	9/1/2020	3/29/2022	Spanish National Cancer Research Centre (Cnio)	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565117	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3907&target=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565117&enzyme=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search			162662606	461685455							1	MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY	8TQC,8TQ2,6T41,6TPA,6Y0A,6R3S,5HVY,5CEI,5BNJ,4G6L,4F7S,4F7N,4F7L,4F7J,4F70,4F6W,4F6U,4F6S,4CRL,3RGF,6QTJ,6QTG,9H8S,9H8C,5XS2,5XQX,5IDP,5IDN,5I5Z,5HNB,5ICP,5HBJ,5HBH,5HBE,5FGK	Cyclin-dependent kinase 8	CDK8_HUMAN	P49336	Q5VUF3 Q6ISB5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51398760	c1cc2c(nc1)Oc3cc(ccc3N(C2=O)c4ccncc4)NC(=O)Nc5ccc(c(c5)C(F)(F)F)Cl	InChI=1S/C25H15ClF3N5O3/c26-19-5-3-14(12-18(19)25(27,28)29)32-24(36)33-15-4-6-20-21(13-15)37-22-17(2-1-9-31-22)23(35)34(20)16-7-10-30-11-8-16/h1-13H,(H2,32,33,36)	NQHGDUGVQSAKOR-UHFFFAOYSA-N	50565105	CHEMBL4792974	Cyclin-dependent kinase 8	Homo sapiens		 8.3							ChEMBL	10.1016/j.ejmech.2020.112443	10.7270/Q2TF023Q	32599324			Martínez-González, S; García, AB; Albarrán, MI; Cebriá, A; Amezquita-Alves, A; García-Campos, FJ; Martínez-Gago, J; Martínez-Torrecuadrada, J; Muñoz, IG; Blanco-Aparicio, C; Pastor, J	9/1/2020	3/29/2022	Spanish National Cancer Research Centre (Cnio)	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565105	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3907&target=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565105&enzyme=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search	NZ8	6TPA	154815588	461685443							1	MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY	8TQC,8TQ2,6T41,6TPA,6Y0A,6R3S,5HVY,5CEI,5BNJ,4G6L,4F7S,4F7N,4F7L,4F7J,4F70,4F6W,4F6U,4F6S,4CRL,3RGF,6QTJ,6QTG,9H8S,9H8C,5XS2,5XQX,5IDP,5IDN,5I5Z,5HNB,5ICP,5HBJ,5HBH,5HBE,5FGK	Cyclin-dependent kinase 8	CDK8_HUMAN	P49336	Q5VUF3 Q6ISB5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51398761	CNC(=O)c1cc(ccn1)Oc2ccc(cc2)NC(=O)Nc3ccc(c(c3)C(F)(F)F)Cl	InChI=1S/C21H16ClF3N4O3/c1-26-19(30)18-11-15(8-9-27-18)32-14-5-2-12(3-6-14)28-20(31)29-13-4-7-17(22)16(10-13)21(23,24)25/h2-11H,1H3,(H,26,30)(H2,28,29,31)	MLDQJTXFUGDVEO-UHFFFAOYSA-N	16673	BAY439006::CHEMBL1336::BAY 43-9006::4-[4-({[4-chloro-3-(trifluoromethyl)phenyl]carbamoyl}amino)phenoxy]-N-methylpyridine-2-carboxamide::4-[4-[[4-chloro-3-(trifluoromethyl)phenyl]carbamoylamino]phenoxy]-N-methyl-picolinamide;tosylic acid::Sorafenib, 4::Hit compound, 8::Sorafenib::Nexavar::cid_216239::BAY 439006::US9029401, Sorafenib::US9469639, Sorafenib::US10183928, Sorafenib::US10202365, Compound Sorafenib::US10227329, Compound Sorafenib::US9902709, Comparative example 1::US10584114, Compound Sorafenib::US10774070, Compound Sorafenib::US10980809, Example Sorafenib::US11505527, Compound Sorafenib::US11279688, Compound Sorafenib::US11912663, Compound Sorafenib::US20250129067, Compound Sorafenib	Cyclin-dependent kinase 8	Homo sapiens		 37							ChEMBL	10.1016/j.ejmech.2020.112443	10.7270/Q2TF023Q	32599324			Martínez-González, S; García, AB; Albarrán, MI; Cebriá, A; Amezquita-Alves, A; García-Campos, FJ; Martínez-Gago, J; Martínez-Torrecuadrada, J; Muñoz, IG; Blanco-Aparicio, C; Pastor, J	9/1/2020	3/29/2022	Spanish National Cancer Research Centre (Cnio)	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=16673	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3907&target=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=16673&enzyme=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search	BAX	1UWH,1UWJ,3GCS,3HEG,3RGF,3WZE,4ASD,5HI2	216239	46516901		CHEMBL1336	DB00398				1	MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY	8TQC,8TQ2,6T41,6TPA,6Y0A,6R3S,5HVY,5CEI,5BNJ,4G6L,4F7S,4F7N,4F7L,4F7J,4F70,4F6W,4F6U,4F6S,4CRL,3RGF,6QTJ,6QTG,9H8S,9H8C,5XS2,5XQX,5IDP,5IDN,5I5Z,5HNB,5ICP,5HBJ,5HBH,5HBE,5FGK	Cyclin-dependent kinase 8	CDK8_HUMAN	P49336	Q5VUF3 Q6ISB5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51398762	Nc1cc(ccn1)N1c2ccc(NC(=O)Nc3ccc(Cl)c(c3)C(F)(F)F)cc2Oc2ncccc2C1=O	InChI=1S/C25H16ClF3N6O3/c26-18-5-3-13(10-17(18)25(27,28)29)33-24(37)34-14-4-6-19-20(11-14)38-22-16(2-1-8-32-22)23(36)35(19)15-7-9-31-21(30)12-15/h1-12H,(H2,30,31)(H2,33,34,37)	VQVRSCPORIUCDA-UHFFFAOYSA-N	50565103	CHEMBL4777657	Cyclin-dependent kinase 8	Homo sapiens		 58							ChEMBL	10.1016/j.ejmech.2020.112443	10.7270/Q2TF023Q	32599324			Martínez-González, S; García, AB; Albarrán, MI; Cebriá, A; Amezquita-Alves, A; García-Campos, FJ; Martínez-Gago, J; Martínez-Torrecuadrada, J; Muñoz, IG; Blanco-Aparicio, C; Pastor, J	9/1/2020	3/29/2022	Spanish National Cancer Research Centre (Cnio)	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565103	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3907&target=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565103&enzyme=Cyclin-dependent+kinase+8&column=ki&startPg=0&Increment=50&submit=Search			162644031	461685441							1	MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY	8TQC,8TQ2,6T41,6TPA,6Y0A,6R3S,5HVY,5CEI,5BNJ,4G6L,4F7S,4F7N,4F7L,4F7J,4F70,4F6W,4F6U,4F6S,4CRL,3RGF,6QTJ,6QTG,9H8S,9H8C,5XS2,5XQX,5IDP,5IDN,5I5Z,5HNB,5ICP,5HBJ,5HBH,5HBE,5FGK	Cyclin-dependent kinase 8	CDK8_HUMAN	P49336	Q5VUF3 Q6ISB5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51398763	c1cc2c(nc1)Oc3cc(ccc3N(C2=O)c4ccncc4)NC(=O)Nc5ccc(c(c5)C(F)(F)F)Cl	InChI=1S/C25H15ClF3N5O3/c26-19-5-3-14(12-18(19)25(27,28)29)32-24(36)33-15-4-6-20-21(13-15)37-22-17(2-1-9-31-22)23(35)34(20)16-7-10-30-11-8-16/h1-13H,(H2,32,33,36)	NQHGDUGVQSAKOR-UHFFFAOYSA-N	50565105	CHEMBL4792974	Cyclin-dependent kinase 19	Homo sapiens		 29							ChEMBL	10.1016/j.ejmech.2020.112443	10.7270/Q2TF023Q	32599324			Martínez-González, S; García, AB; Albarrán, MI; Cebriá, A; Amezquita-Alves, A; García-Campos, FJ; Martínez-Gago, J; Martínez-Torrecuadrada, J; Muñoz, IG; Blanco-Aparicio, C; Pastor, J	9/1/2020	3/29/2022	Spanish National Cancer Research Centre (Cnio)	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565105	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3735&target=Cyclin-dependent+kinase+19&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565105&enzyme=Cyclin-dependent+kinase+19&column=ki&startPg=0&Increment=50&submit=Search	NZ8	6TPA	154815588	461685443							1	MDYDFKAKLAAERERVEDLFEYEGCKVGRGTYGHVYKARRKDGKDEKEYALKQIEGTGISMSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKHKVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQIPYPKREFLNEDDPEEKGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGTGAGLQHSQDSSLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSSVQGSSQSQSTLGYSSSSQQSSQYHPSHQAHRY	5IDP,5IDN	Cyclin-dependent kinase 19	CDK19_HUMAN	Q9BWU1	Q5JQZ7 Q5JR00 Q8TC78 Q9UPX2																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51398764	c1cc2c(nc1)Oc3cc(ccc3N(C2=O)c4ccncc4)NC(=O)Nc5ccc(c(c5)C(F)(F)F)Cl	InChI=1S/C25H15ClF3N5O3/c26-19-5-3-14(12-18(19)25(27,28)29)32-24(36)33-15-4-6-20-21(13-15)37-22-17(2-1-9-31-22)23(35)34(20)16-7-10-30-11-8-16/h1-13H,(H2,32,33,36)	NQHGDUGVQSAKOR-UHFFFAOYSA-N	50565105	CHEMBL4792974	Cyclin-dependent kinase 7	Homo sapiens		>10000							ChEMBL	10.1016/j.ejmech.2020.112443	10.7270/Q2TF023Q	32599324			Martínez-González, S; García, AB; Albarrán, MI; Cebriá, A; Amezquita-Alves, A; García-Campos, FJ; Martínez-Gago, J; Martínez-Torrecuadrada, J; Muñoz, IG; Blanco-Aparicio, C; Pastor, J	9/1/2020	3/29/2022	Spanish National Cancer Research Centre (Cnio)	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565105	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=995&target=Cyclin-dependent+kinase+7&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565105&enzyme=Cyclin-dependent+kinase+7&column=ki&startPg=0&Increment=50&submit=Search	NZ8	6TPA	154815588	461685443							1	MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF	8P7L,8S0T,8S0R,8PLZ,8P79,8P78,8P77,8P76,8P75,8P74,8P73,8P72,8P71,8P70,8P6Z,8P6Y,8P6X,8P6W,8P6V,8ORM,6XD3,8PYR,1UA2,9SKQ,9QCX,9QCV,9I9K,9I9J,9I9I,7B5Q,7B5O,6XBZ,8R9U,8R9S,8R9O,8R9A,8R99,8P4Z	Cyclin-dependent kinase 7	CDK7_HUMAN	P50613	Q9BS60 Q9UE19																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51398765	c1cc2c(nc1)Oc3cc(ccc3N(C2=O)c4ccncc4)NC(=O)Nc5ccc(c(c5)C(F)(F)F)Cl	InChI=1S/C25H15ClF3N5O3/c26-19-5-3-14(12-18(19)25(27,28)29)32-24(36)33-15-4-6-20-21(13-15)37-22-17(2-1-9-31-22)23(35)34(20)16-7-10-30-11-8-16/h1-13H,(H2,32,33,36)	NQHGDUGVQSAKOR-UHFFFAOYSA-N	50565105	CHEMBL4792974	Dual specificity protein kinase CLK4	Homo sapiens		>10000							ChEMBL	10.1016/j.ejmech.2020.112443	10.7270/Q2TF023Q	32599324			Martínez-González, S; García, AB; Albarrán, MI; Cebriá, A; Amezquita-Alves, A; García-Campos, FJ; Martínez-Gago, J; Martínez-Torrecuadrada, J; Muñoz, IG; Blanco-Aparicio, C; Pastor, J	9/1/2020	3/29/2022	Spanish National Cancer Research Centre (Cnio)	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565105	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3913&target=Dual+specificity+protein+kinase+CLK4&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565105&enzyme=Dual+specificity+protein+kinase+CLK4&column=ki&startPg=0&Increment=50&submit=Search	NZ8	6TPA	154815588	461685443							1	MRHSKRTHCPDWDSRESWGHESYRGSHKRKRRSHSSTQENRHCKPHHQFKESDCHYLEARSLNERDYRDRRYVDEYRNDYCEGYVPRHYHRDIESGYRIHCSKSSVRSRRSSPKRKRNRHCSSHQSRSKSHRRKRSRSIEDDEEGHLICQSGDVLRARYEIVDTLGEGAFGKVVECIDHGMDGMHVAVKIVKNVGRYREAARSEIQVLEHLNSTDPNSVFRCVQMLEWFDHHGHVCIVFELLGLSTYDFIKENSFLPFQIDHIRQMAYQICQSINFLHHNKLTHTDLKPENILFVKSDYVVKYNSKMKRDERTLKNTDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCDVWSIGCILIEYYLGFTVFQTHDSKEHLAMMERILGPIPQHMIQKTRKRKYFHHNQLDWDEHSSAGRYVRRRCKPLKEFMLCHDEEHEKLFDLVRRMLEYDPTQRITLDEALQHPFFDLLKKK	6FYV	Dual specificity protein kinase CLK4	CLK4_HUMAN	Q9HAZ1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51398766	c1cc2c(nc1)Oc3cc(ccc3N(C2=O)c4ccncc4)NC(=O)Nc5ccc(c(c5)C(F)(F)F)Cl	InChI=1S/C25H15ClF3N5O3/c26-19-5-3-14(12-18(19)25(27,28)29)32-24(36)33-15-4-6-20-21(13-15)37-22-17(2-1-9-31-22)23(35)34(20)16-7-10-30-11-8-16/h1-13H,(H2,32,33,36)	NQHGDUGVQSAKOR-UHFFFAOYSA-N	50565105	CHEMBL4792974	Epithelial discoidin domain-containing receptor 1	Homo sapiens		 180							ChEMBL	10.1016/j.ejmech.2020.112443	10.7270/Q2TF023Q	32599324			Martínez-González, S; García, AB; Albarrán, MI; Cebriá, A; Amezquita-Alves, A; García-Campos, FJ; Martínez-Gago, J; Martínez-Torrecuadrada, J; Muñoz, IG; Blanco-Aparicio, C; Pastor, J	9/1/2020	3/29/2022	Spanish National Cancer Research Centre (Cnio)	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565105	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3993&target=Epithelial+discoidin+domain-containing+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565105&enzyme=Epithelial+discoidin+domain-containing+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	NZ8	6TPA	154815588	461685443							1	MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAARHSRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGRRWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFSEISFISDVVNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILIGCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPREPPPYQEPRPRGNPPHSAPCVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNTQAYSGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVSLDFPLNVRKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLEDKAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDALNTV	6BSD,6BRJ,5BVW,5BVO,5BVN,5BVK,5FDX,5FDP,7BE6,7BCM,6HP9,6GWR,4CKR,4BKJ,3ZOS,6FIQ,6FIO,6FIN,6FIL,6FEX,6FEW,5SB2,5SB1,5SB0,5SAZ,5SAY,5SAX,5SAW,5SAV,5SAU,7FEH,8PE9	Epithelial discoidin domain-containing receptor 1	DDR1_HUMAN	Q08345	B5A975 B5A976 B7Z2K0 Q14196 Q16562 Q2L6H3 Q4LE50 Q5ST11 Q5ST12 Q6NSK4 Q9UD35 Q9UD36 Q9UD37 Q9UD86 Q9UDL2			N/A	A0A024RCL1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																														
51398767	c1cc2c(nc1)Oc3cc(ccc3N(C2=O)c4ccncc4)NC(=O)Nc5ccc(c(c5)C(F)(F)F)Cl	InChI=1S/C25H15ClF3N5O3/c26-19-5-3-14(12-18(19)25(27,28)29)32-24(36)33-15-4-6-20-21(13-15)37-22-17(2-1-9-31-22)23(35)34(20)16-7-10-30-11-8-16/h1-13H,(H2,32,33,36)	NQHGDUGVQSAKOR-UHFFFAOYSA-N	50565105	CHEMBL4792974	Epithelial discoidin domain-containing receptor 1	Homo sapiens		 170							ChEMBL	10.1016/j.ejmech.2020.112443	10.7270/Q2TF023Q	32599324			Martínez-González, S; García, AB; Albarrán, MI; Cebriá, A; Amezquita-Alves, A; García-Campos, FJ; Martínez-Gago, J; Martínez-Torrecuadrada, J; Muñoz, IG; Blanco-Aparicio, C; Pastor, J	9/1/2020	3/29/2022	Spanish National Cancer Research Centre (Cnio)	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50565105	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3993&target=Epithelial+discoidin+domain-containing+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50565105&enzyme=Epithelial+discoidin+domain-containing+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	NZ8	6TPA	154815588	461685443							1	MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAARHSRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGRRWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFSEISFISDVVNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILIGCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPREPPPYQEPRPRGNPPHSAPCVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNTQAYSGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVSLDFPLNVRKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLEDKAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDALNTV	6BSD,6BRJ,5BVW,5BVO,5BVN,5BVK,5FDX,5FDP,7BE6,7BCM,6HP9,6GWR,4CKR,4BKJ,3ZOS,6FIQ,6FIO,6FIN,6FIL,6FEX,6FEW,5SB2,5SB1,5SB0,5SAZ,5SAY,5SAX,5SAW,5SAV,5SAU,7FEH,8PE9	Epithelial discoidin domain-containing receptor 1	DDR1_HUMAN	Q08345	B5A975 B5A976 B7Z2K0 Q14196 Q16562 Q2L6H3 Q4LE50 Q5ST11 Q5ST12 Q6NSK4 Q9UD35 Q9UD36 Q9UD37 Q9UD86 Q9UDL2			N/A	A0A024RCL1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																														
