BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 51098873 CCCOc1ccc(cc1)-c1cc(OCCN2CCCCC2)c2cccc(OC)c2n1 InChI=1S/C26H32N2O3/c1-3-17-30-21-12-10-20(11-13-21)23-19-25(31-18-16-28-14-5-4-6-15-28)22-8-7-9-24(29-2)26(22)27-23/h7-13,19H,3-6,14-18H2,1-2H3 SJXFTYNYYDZXLD-UHFFFAOYSA-N 50367958 CHEMBL4169390 Quinolone resistance protein NorA Staphylococcus aureus 11900 ChEMBL 10.1021/acs.jmedchem.8b00791 10.7270/Q2D50QHG 30067360 Felicetti, T; Cannalire, R; Pietrella, D; Latacz, G; Lubelska, A; Manfroni, G; Barreca, ML; Massari, S; Tabarrini, O; Kieć-Kononowicz, K; Schindler, BD; Kaatz, GW; Cecchetti, V; Sabatini, S 9/13/2018 8/14/2020 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50367958 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50367958&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 145954413 160847060 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 51098874 CCCOc1ccc(cc1)-c1cc(OCCN2CCCCC2)c2cc(OC)c(OC)cc2n1 InChI=1S/C27H34N2O4/c1-4-15-32-21-10-8-20(9-11-21)23-18-25(33-16-14-29-12-6-5-7-13-29)22-17-26(30-2)27(31-3)19-24(22)28-23/h8-11,17-19H,4-7,12-16H2,1-3H3 FHUPGUSCOXVTFF-UHFFFAOYSA-N 50368050 CHEMBL4164426 Quinolone resistance protein NorA Staphylococcus aureus 3900 ChEMBL 10.1021/acs.jmedchem.8b00791 10.7270/Q2D50QHG 30067360 Felicetti, T; Cannalire, R; Pietrella, D; Latacz, G; Lubelska, A; Manfroni, G; Barreca, ML; Massari, S; Tabarrini, O; Kieć-Kononowicz, K; Schindler, BD; Kaatz, GW; Cecchetti, V; Sabatini, S 9/13/2018 8/14/2020 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50368050 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50368050&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 145957810 160847152 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 51098875 CCCOc1ccc(cc1)-c1cc(OCCN2CCCCC2)c2c(OC)cccc2n1 InChI=1S/C26H32N2O3/c1-3-17-30-21-12-10-20(11-13-21)23-19-25(31-18-16-28-14-5-4-6-15-28)26-22(27-23)8-7-9-24(26)29-2/h7-13,19H,3-6,14-18H2,1-2H3 ULCOURPOWKMCRY-UHFFFAOYSA-N 50368051 CHEMBL4161319 Quinolone resistance protein NorA Staphylococcus aureus 19100 ChEMBL 10.1021/acs.jmedchem.8b00791 10.7270/Q2D50QHG 30067360 Felicetti, T; Cannalire, R; Pietrella, D; Latacz, G; Lubelska, A; Manfroni, G; Barreca, ML; Massari, S; Tabarrini, O; Kieć-Kononowicz, K; Schindler, BD; Kaatz, GW; Cecchetti, V; Sabatini, S 9/13/2018 8/14/2020 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50368051 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50368051&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 145959665 160847153 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 51098876 CCCOc1ccc(cc1)-c1cc(OCCN2CCNCC2)c2cc(OC)ccc2n1 InChI=1S/C25H31N3O3/c1-3-15-30-20-6-4-19(5-7-20)24-18-25(31-16-14-28-12-10-26-11-13-28)22-17-21(29-2)8-9-23(22)27-24/h4-9,17-18,26H,3,10-16H2,1-2H3 VSSXMBMAMGKMDA-UHFFFAOYSA-N 50368052 CHEMBL4176869 Quinolone resistance protein NorA Staphylococcus aureus 15600 ChEMBL 10.1021/acs.jmedchem.8b00791 10.7270/Q2D50QHG 30067360 Felicetti, T; Cannalire, R; Pietrella, D; Latacz, G; Lubelska, A; Manfroni, G; Barreca, ML; Massari, S; Tabarrini, O; Kieć-Kononowicz, K; Schindler, BD; Kaatz, GW; Cecchetti, V; Sabatini, S 9/13/2018 8/14/2020 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50368052 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50368052&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 145974098 160847154 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 51098877 CCCOc1ccc(cc1)-c1cc(OCCN2CCCCC2)c2ccc(OC)cc2n1 InChI=1S/C26H32N2O3/c1-3-16-30-21-9-7-20(8-10-21)24-19-26(31-17-15-28-13-5-4-6-14-28)23-12-11-22(29-2)18-25(23)27-24/h7-12,18-19H,3-6,13-17H2,1-2H3 ZPGXCFLEPOTDQN-UHFFFAOYSA-N 50368053 CHEMBL4161736 Quinolone resistance protein NorA Staphylococcus aureus 4000 ChEMBL 10.1021/acs.jmedchem.8b00791 10.7270/Q2D50QHG 30067360 Felicetti, T; Cannalire, R; Pietrella, D; Latacz, G; Lubelska, A; Manfroni, G; Barreca, ML; Massari, S; Tabarrini, O; Kieć-Kononowicz, K; Schindler, BD; Kaatz, GW; Cecchetti, V; Sabatini, S 9/13/2018 8/14/2020 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50368053 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50368053&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 145957472 160847155 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 51098878 CCCOc1ccc(cc1)-c1cc(OCCN2CCN(Cc3ccccc3)CC2)c2ccc(OC)cc2n1 InChI=1S/C32H37N3O3/c1-3-20-37-27-11-9-26(10-12-27)30-23-32(29-14-13-28(36-2)22-31(29)33-30)38-21-19-34-15-17-35(18-16-34)24-25-7-5-4-6-8-25/h4-14,22-23H,3,15-21,24H2,1-2H3 RRAPHEOULFXJRH-UHFFFAOYSA-N 50368054 CHEMBL4168315 Quinolone resistance protein NorA Staphylococcus aureus 7300 ChEMBL 10.1021/acs.jmedchem.8b00791 10.7270/Q2D50QHG 30067360 Felicetti, T; Cannalire, R; Pietrella, D; Latacz, G; Lubelska, A; Manfroni, G; Barreca, ML; Massari, S; Tabarrini, O; Kieć-Kononowicz, K; Schindler, BD; Kaatz, GW; Cecchetti, V; Sabatini, S 9/13/2018 8/14/2020 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50368054 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50368054&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 145955275 160847156 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 51098879 CCCOc1ccc(cc1)-c1cc(OCCN(CC)CC)c2cc(OC)c(OC)cc2n1 InChI=1S/C26H34N2O4/c1-6-14-31-20-11-9-19(10-12-20)22-17-24(32-15-13-28(7-2)8-3)21-16-25(29-4)26(30-5)18-23(21)27-22/h9-12,16-18H,6-8,13-15H2,1-5H3 RVXHOMAHKDADGD-UHFFFAOYSA-N 50368055 CHEMBL4175717 Quinolone resistance protein NorA Staphylococcus aureus 4100 ChEMBL 10.1021/acs.jmedchem.8b00791 10.7270/Q2D50QHG 30067360 Felicetti, T; Cannalire, R; Pietrella, D; Latacz, G; Lubelska, A; Manfroni, G; Barreca, ML; Massari, S; Tabarrini, O; Kieć-Kononowicz, K; Schindler, BD; Kaatz, GW; Cecchetti, V; Sabatini, S 9/13/2018 8/14/2020 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50368055 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50368055&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 145973585 160847157 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 51098880 CCCOc1ccc(cc1)-c1cc(OCCN2CCCCC2)c2cc(OC)cc(OC)c2n1 InChI=1S/C27H34N2O4/c1-4-15-32-21-10-8-20(9-11-21)24-19-25(33-16-14-29-12-6-5-7-13-29)23-17-22(30-2)18-26(31-3)27(23)28-24/h8-11,17-19H,4-7,12-16H2,1-3H3 ZJMANDMETRMHHL-UHFFFAOYSA-N 50368056 CHEMBL4169284 Quinolone resistance protein NorA Staphylococcus aureus 3800 ChEMBL 10.1021/acs.jmedchem.8b00791 10.7270/Q2D50QHG 30067360 Felicetti, T; Cannalire, R; Pietrella, D; Latacz, G; Lubelska, A; Manfroni, G; Barreca, ML; Massari, S; Tabarrini, O; Kieć-Kononowicz, K; Schindler, BD; Kaatz, GW; Cecchetti, V; Sabatini, S 9/13/2018 8/14/2020 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50368056 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50368056&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 145953257 160847158 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 51098881 CCCOc1ccc(cc1)-c1cc(OCCN(CC)CC)c2ccccc2n1 InChI=1S/C24H30N2O2/c1-4-16-27-20-13-11-19(12-14-20)23-18-24(28-17-15-26(5-2)6-3)21-9-7-8-10-22(21)25-23/h7-14,18H,4-6,15-17H2,1-3H3 SHIKXKJXWQEZOU-UHFFFAOYSA-N 50350505 CHEMBL1651180 Quinolone resistance protein NorA Staphylococcus aureus 8900 ChEMBL 10.1021/acs.jmedchem.8b00791 10.7270/Q2D50QHG 30067360 Felicetti, T; Cannalire, R; Pietrella, D; Latacz, G; Lubelska, A; Manfroni, G; Barreca, ML; Massari, S; Tabarrini, O; Kieć-Kononowicz, K; Schindler, BD; Kaatz, GW; Cecchetti, V; Sabatini, S 9/13/2018 8/14/2020 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50350505 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50350505&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 53316933 136357191 CHEMBL1651180 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 51098882 CCCOc1ccc(cc1)-c1cc(OCCN(CC)CC)c2cccc(OC)c2n1 InChI=1S/C25H32N2O3/c1-5-16-29-20-13-11-19(12-14-20)22-18-24(30-17-15-27(6-2)7-3)21-9-8-10-23(28-4)25(21)26-22/h8-14,18H,5-7,15-17H2,1-4H3 JXCAZCGMXHCFIR-UHFFFAOYSA-N 50368103 CHEMBL4164881 Quinolone resistance protein NorA Staphylococcus aureus 13700 ChEMBL 10.1021/acs.jmedchem.8b00791 10.7270/Q2D50QHG 30067360 Felicetti, T; Cannalire, R; Pietrella, D; Latacz, G; Lubelska, A; Manfroni, G; Barreca, ML; Massari, S; Tabarrini, O; Kieć-Kononowicz, K; Schindler, BD; Kaatz, GW; Cecchetti, V; Sabatini, S 9/13/2018 8/14/2020 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50368103 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50368103&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 145960310 160847205 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 51098883 COc1ccc2c(c1)[nH]c3c2CCN4[C@@H]3C[C@H]5[C@@H](C4)C[C@H]([C@@H]([C@H]5C(=O)OC)OC)OC(=O)c6cc(c(c(c6)OC)OC)OC InChI=1S/C33H40N2O9/c1-38-19-7-8-20-21-9-10-35-16-18-13-27(44-32(36)17-11-25(39-2)30(41-4)26(12-17)40-3)31(42-5)28(33(37)43-6)22(18)15-24(35)29(21)34-23(20)14-19/h7-8,11-12,14,18,22,24,27-28,31,34H,9-10,13,15-16H2,1-6H3 QEVHRUUCFGRFIF-UHFFFAOYSA-N 50017712 Apoplon::3,4,5-trimethoxybenzoyl methyl reserpate::Reserpin::(3beta,16beta,17alpha,18beta,20alpha)-11,17-dimethoxy-18-[(3,4,5-trimethoxybenzoyl)oxy]yohimban-16-carboxylic acid methyl ester::methyl (3beta,16beta,17alpha,18beta,20alpha)-11,17-dimethoxy-18-[(3,4,5-trimethoxybenzoyl)oxy]yohimban-16-carboxylate::(-)-reserpine::CHEMBL772::Serpalan::RESERPINE::NCGC00091250::cid_5770 Quinolone resistance protein NorA Staphylococcus aureus 9200 ChEMBL 10.1021/acs.jmedchem.8b00791 10.7270/Q2D50QHG 30067360 Felicetti, T; Cannalire, R; Pietrella, D; Latacz, G; Lubelska, A; Manfroni, G; Barreca, ML; Massari, S; Tabarrini, O; Kieć-Kononowicz, K; Schindler, BD; Kaatz, GW; Cecchetti, V; Sabatini, S 9/13/2018 8/14/2020 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50017712 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50017712&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search YHR 8JTC,8T6A,8TGG,8TGH,8TGI,8TGJ,8TGK,8TGL,8TGM,8TGN,8UCM,8WLL 5770 103928980 CHEMBL772 DB00206 C06539 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 51098884 CCCOc1ccc(cc1)-c1cc(OCCN(CC)CC)c2cc(OC)ccc2n1 InChI=1S/C25H32N2O3/c1-5-15-29-20-10-8-19(9-11-20)24-18-25(30-16-14-27(6-2)7-3)22-17-21(28-4)12-13-23(22)26-24/h8-13,17-18H,5-7,14-16H2,1-4H3 INFDRNPSISUGST-UHFFFAOYSA-N 50368118 CHEMBL4164737 Quinolone resistance protein NorA Staphylococcus aureus 4700 ChEMBL 10.1021/acs.jmedchem.8b00791 10.7270/Q2D50QHG 30067360 Felicetti, T; Cannalire, R; Pietrella, D; Latacz, G; Lubelska, A; Manfroni, G; Barreca, ML; Massari, S; Tabarrini, O; Kieć-Kononowicz, K; Schindler, BD; Kaatz, GW; Cecchetti, V; Sabatini, S 9/13/2018 8/14/2020 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50368118 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50368118&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 145958815 160847220 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 51098885 CCCOc1ccc(cc1)-c1cc(OCCN2CCCCC2)c2cc(OC)ccc2n1 InChI=1S/C26H32N2O3/c1-3-16-30-21-9-7-20(8-10-21)25-19-26(31-17-15-28-13-5-4-6-14-28)23-18-22(29-2)11-12-24(23)27-25/h7-12,18-19H,3-6,13-17H2,1-2H3 KMFGCJWPFAWJQJ-UHFFFAOYSA-N 50368119 CHEMBL4162139 Quinolone resistance protein NorA Staphylococcus aureus 4200 ChEMBL 10.1021/acs.jmedchem.8b00791 10.7270/Q2D50QHG 30067360 Felicetti, T; Cannalire, R; Pietrella, D; Latacz, G; Lubelska, A; Manfroni, G; Barreca, ML; Massari, S; Tabarrini, O; Kieć-Kononowicz, K; Schindler, BD; Kaatz, GW; Cecchetti, V; Sabatini, S 9/13/2018 8/14/2020 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50368119 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50368119&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 145958704 160847221 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 51098886 CCCOc1ccc(cc1)-c1cc(OCCN2CCCCCC2)c2cc(OC)ccc2n1 InChI=1S/C27H34N2O3/c1-3-17-31-22-10-8-21(9-11-22)26-20-27(24-19-23(30-2)12-13-25(24)28-26)32-18-16-29-14-6-4-5-7-15-29/h8-13,19-20H,3-7,14-18H2,1-2H3 XFBWAOKZRJKTSZ-UHFFFAOYSA-N 50368124 CHEMBL4170063 Quinolone resistance protein NorA Staphylococcus aureus 8100 ChEMBL 10.1021/acs.jmedchem.8b00791 10.7270/Q2D50QHG 30067360 Felicetti, T; Cannalire, R; Pietrella, D; Latacz, G; Lubelska, A; Manfroni, G; Barreca, ML; Massari, S; Tabarrini, O; Kieć-Kononowicz, K; Schindler, BD; Kaatz, GW; Cecchetti, V; Sabatini, S 9/13/2018 8/14/2020 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50368124 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50368124&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 145956269 160847226 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 51098887 CCCOc1ccc(cc1)-c1cc(OCCN(CC)CC)c2ccc(OC)cc2n1 InChI=1S/C25H32N2O3/c1-5-15-29-20-10-8-19(9-11-20)23-18-25(30-16-14-27(6-2)7-3)22-13-12-21(28-4)17-24(22)26-23/h8-13,17-18H,5-7,14-16H2,1-4H3 MGSCFPDGTQAGJG-UHFFFAOYSA-N 50368126 CHEMBL4172372 Quinolone resistance protein NorA Staphylococcus aureus 4700 ChEMBL 10.1021/acs.jmedchem.8b00791 10.7270/Q2D50QHG 30067360 Felicetti, T; Cannalire, R; Pietrella, D; Latacz, G; Lubelska, A; Manfroni, G; Barreca, ML; Massari, S; Tabarrini, O; Kieć-Kononowicz, K; Schindler, BD; Kaatz, GW; Cecchetti, V; Sabatini, S 9/13/2018 8/14/2020 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50368126 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50368126&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 145949258 160847228 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 51098888 CCCOc1ccc(cc1)-c1cc(OCCN2CCCCCC2)c2ccc(OC)cc2n1 InChI=1S/C27H34N2O3/c1-3-17-31-22-10-8-21(9-11-22)25-20-27(24-13-12-23(30-2)19-26(24)28-25)32-18-16-29-14-6-4-5-7-15-29/h8-13,19-20H,3-7,14-18H2,1-2H3 SYYBFXZADKVYHS-UHFFFAOYSA-N 50368143 CHEMBL4167074 Quinolone resistance protein NorA Staphylococcus aureus 4900 ChEMBL 10.1021/acs.jmedchem.8b00791 10.7270/Q2D50QHG 30067360 Felicetti, T; Cannalire, R; Pietrella, D; Latacz, G; Lubelska, A; Manfroni, G; Barreca, ML; Massari, S; Tabarrini, O; Kieć-Kononowicz, K; Schindler, BD; Kaatz, GW; Cecchetti, V; Sabatini, S 9/13/2018 8/14/2020 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50368143 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50368143&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 145953601 160847245 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 51098889 CCCOc1ccc(cc1)-c1cc(OCCN2CCc3cc(OC)c(OC)cc3C2)c2ccc(OC)cc2n1 InChI=1S/C32H36N2O5/c1-5-15-38-25-8-6-22(7-9-25)28-20-30(27-11-10-26(35-2)19-29(27)33-28)39-16-14-34-13-12-23-17-31(36-3)32(37-4)18-24(23)21-34/h6-11,17-20H,5,12-16,21H2,1-4H3 NDJLPEQJWHKEBM-UHFFFAOYSA-N 50368158 CHEMBL4174957 Quinolone resistance protein NorA Staphylococcus aureus 4700 ChEMBL 10.1021/acs.jmedchem.8b00791 10.7270/Q2D50QHG 30067360 Felicetti, T; Cannalire, R; Pietrella, D; Latacz, G; Lubelska, A; Manfroni, G; Barreca, ML; Massari, S; Tabarrini, O; Kieć-Kononowicz, K; Schindler, BD; Kaatz, GW; Cecchetti, V; Sabatini, S 9/13/2018 8/14/2020 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50368158 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50368158&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 145950651 160847260 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 51098890 CCCOc1ccc(cc1)-c1cc(OCCCN(C)C)c2ccc(OC)cc2n1 InChI=1S/C24H30N2O3/c1-5-14-28-19-9-7-18(8-10-19)22-17-24(29-15-6-13-26(2)3)21-12-11-20(27-4)16-23(21)25-22/h7-12,16-17H,5-6,13-15H2,1-4H3 VUXBZLRWSUXXKG-UHFFFAOYSA-N 50368171 CHEMBL4176162 Quinolone resistance protein NorA Staphylococcus aureus 4300 ChEMBL 10.1021/acs.jmedchem.8b00791 10.7270/Q2D50QHG 30067360 Felicetti, T; Cannalire, R; Pietrella, D; Latacz, G; Lubelska, A; Manfroni, G; Barreca, ML; Massari, S; Tabarrini, O; Kieć-Kononowicz, K; Schindler, BD; Kaatz, GW; Cecchetti, V; Sabatini, S 9/13/2018 8/14/2020 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50368171 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50368171&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 145972663 160847273 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 51098891 CCCOc1ccc(cc1)-c1cc(OCCN2CCNCC2)c2ccc(OC)cc2n1 InChI=1S/C25H31N3O3/c1-3-15-30-20-6-4-19(5-7-20)23-18-25(31-16-14-28-12-10-26-11-13-28)22-9-8-21(29-2)17-24(22)27-23/h4-9,17-18,26H,3,10-16H2,1-2H3 CNXZLNYHPLJODW-UHFFFAOYSA-N 50368181 CHEMBL4172781 Quinolone resistance protein NorA Staphylococcus aureus 5500 ChEMBL 10.1021/acs.jmedchem.8b00791 10.7270/Q2D50QHG 30067360 Felicetti, T; Cannalire, R; Pietrella, D; Latacz, G; Lubelska, A; Manfroni, G; Barreca, ML; Massari, S; Tabarrini, O; Kieć-Kononowicz, K; Schindler, BD; Kaatz, GW; Cecchetti, V; Sabatini, S 9/13/2018 8/14/2020 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50368181 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50368181&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 145951822 160847283 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 51098892 CCCOc1ccc(cc1)-c1cc(OCCN(CC)CC)c2c(OC)cc(OC)cc2n1 InChI=1S/C26H34N2O4/c1-6-14-31-20-11-9-19(10-12-20)22-18-25(32-15-13-28(7-2)8-3)26-23(27-22)16-21(29-4)17-24(26)30-5/h9-12,16-18H,6-8,13-15H2,1-5H3 KALYBLCPMCWTDM-UHFFFAOYSA-N 50368182 CHEMBL4163342 Quinolone resistance protein NorA Staphylococcus aureus 2800 ChEMBL 10.1021/acs.jmedchem.8b00791 10.7270/Q2D50QHG 30067360 Felicetti, T; Cannalire, R; Pietrella, D; Latacz, G; Lubelska, A; Manfroni, G; Barreca, ML; Massari, S; Tabarrini, O; Kieć-Kononowicz, K; Schindler, BD; Kaatz, GW; Cecchetti, V; Sabatini, S 9/13/2018 8/14/2020 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50368182 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50368182&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 145959243 160847284 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 51098893 CCCOc1ccc(cc1)-c1cc(OCCN2CCc3cc(OC)c(OC)cc3C2)c2c(OC)cc(OC)cc2n1 InChI=1S/C33H38N2O6/c1-6-14-40-25-9-7-22(8-10-25)27-20-32(33-28(34-27)18-26(36-2)19-31(33)39-5)41-15-13-35-12-11-23-16-29(37-3)30(38-4)17-24(23)21-35/h7-10,16-20H,6,11-15,21H2,1-5H3 YXTIUOGLXGCFRY-UHFFFAOYSA-N 50368195 CHEMBL4175014 Quinolone resistance protein NorA Staphylococcus aureus 1600 ChEMBL 10.1021/acs.jmedchem.8b00791 10.7270/Q2D50QHG 30067360 Felicetti, T; Cannalire, R; Pietrella, D; Latacz, G; Lubelska, A; Manfroni, G; Barreca, ML; Massari, S; Tabarrini, O; Kieć-Kononowicz, K; Schindler, BD; Kaatz, GW; Cecchetti, V; Sabatini, S 9/13/2018 8/14/2020 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50368195 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50368195&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 145950443 160847297 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 51098894 CCCOc1ccc(cc1)-c1cc(OCCN2CCc3cc(OC)c(OC)cc3C2)c2cc(OC)c(OC)cc2n1 InChI=1S/C33H38N2O6/c1-6-14-40-25-9-7-22(8-10-25)27-19-29(26-18-32(38-4)33(39-5)20-28(26)34-27)41-15-13-35-12-11-23-16-30(36-2)31(37-3)17-24(23)21-35/h7-10,16-20H,6,11-15,21H2,1-5H3 NUPHAHUNOVWYAU-UHFFFAOYSA-N 50368252 CHEMBL4171147 Quinolone resistance protein NorA Staphylococcus aureus 1100 ChEMBL 10.1021/acs.jmedchem.8b00791 10.7270/Q2D50QHG 30067360 Felicetti, T; Cannalire, R; Pietrella, D; Latacz, G; Lubelska, A; Manfroni, G; Barreca, ML; Massari, S; Tabarrini, O; Kieć-Kononowicz, K; Schindler, BD; Kaatz, GW; Cecchetti, V; Sabatini, S 9/13/2018 8/14/2020 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50368252 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50368252&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 145950697 160847354 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 51098895 CCCOc1ccc(cc1)-c1cc(OCCN(CC)CC)c2cc(OC)cc(OC)c2n1 InChI=1S/C26H34N2O4/c1-6-14-31-20-11-9-19(10-12-20)23-18-24(32-15-13-28(7-2)8-3)22-16-21(29-4)17-25(30-5)26(22)27-23/h9-12,16-18H,6-8,13-15H2,1-5H3 DHWIZECKOOPCKX-UHFFFAOYSA-N 50368257 CHEMBL4168943 Quinolone resistance protein NorA Staphylococcus aureus 4600 ChEMBL 10.1021/acs.jmedchem.8b00791 10.7270/Q2D50QHG 30067360 Felicetti, T; Cannalire, R; Pietrella, D; Latacz, G; Lubelska, A; Manfroni, G; Barreca, ML; Massari, S; Tabarrini, O; Kieć-Kononowicz, K; Schindler, BD; Kaatz, GW; Cecchetti, V; Sabatini, S 9/13/2018 8/14/2020 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50368257 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50368257&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 145952799 160847359 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 51098896 CCCOc1ccc(cc1)-c1cc(OCCN2CCCCCC2)c2cc(OC)cc(OC)c2n1 InChI=1S/C28H36N2O4/c1-4-16-33-22-11-9-21(10-12-22)25-20-26(34-17-15-30-13-7-5-6-8-14-30)24-18-23(31-2)19-27(32-3)28(24)29-25/h9-12,18-20H,4-8,13-17H2,1-3H3 MQDVTWCARXGCPI-UHFFFAOYSA-N 50368266 CHEMBL4172225 Quinolone resistance protein NorA Staphylococcus aureus 1800 ChEMBL 10.1021/acs.jmedchem.8b00791 10.7270/Q2D50QHG 30067360 Felicetti, T; Cannalire, R; Pietrella, D; Latacz, G; Lubelska, A; Manfroni, G; Barreca, ML; Massari, S; Tabarrini, O; Kieć-Kononowicz, K; Schindler, BD; Kaatz, GW; Cecchetti, V; Sabatini, S 9/13/2018 8/14/2020 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50368266 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50368266&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 145950318 160847368 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 51098897 CCCOc1ccc(cc1)-c1cc(OCCN2CCc3cc(OC)c(OC)cc3C2)c2cc(OC)cc(OC)c2n1 InChI=1S/C33H38N2O6/c1-6-14-40-25-9-7-22(8-10-25)28-20-29(27-18-26(36-2)19-32(39-5)33(27)34-28)41-15-13-35-12-11-23-16-30(37-3)31(38-4)17-24(23)21-35/h7-10,16-20H,6,11-15,21H2,1-5H3 SAMXDQRGFGIMMH-UHFFFAOYSA-N 50368281 CHEMBL4170066 Quinolone resistance protein NorA Staphylococcus aureus 3800 ChEMBL 10.1021/acs.jmedchem.8b00791 10.7270/Q2D50QHG 30067360 Felicetti, T; Cannalire, R; Pietrella, D; Latacz, G; Lubelska, A; Manfroni, G; Barreca, ML; Massari, S; Tabarrini, O; Kieć-Kononowicz, K; Schindler, BD; Kaatz, GW; Cecchetti, V; Sabatini, S 9/13/2018 8/14/2020 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50368281 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50368281&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 145953508 160847383 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 51098898 CCCOc1ccc(cc1)-c1cc(O)c2c(OC)cccc2n1 InChI=1S/C19H19NO3/c1-3-11-23-14-9-7-13(8-10-14)16-12-17(21)19-15(20-16)5-4-6-18(19)22-2/h4-10,12H,3,11H2,1-2H3,(H,20,21) NGUAOBDHSBRJHX-UHFFFAOYSA-N 50368289 CHEMBL4162146 Quinolone resistance protein NorA Staphylococcus aureus 4100 ChEMBL 10.1021/acs.jmedchem.8b00791 10.7270/Q2D50QHG 30067360 Felicetti, T; Cannalire, R; Pietrella, D; Latacz, G; Lubelska, A; Manfroni, G; Barreca, ML; Massari, S; Tabarrini, O; Kieć-Kononowicz, K; Schindler, BD; Kaatz, GW; Cecchetti, V; Sabatini, S 9/13/2018 8/14/2020 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50368289 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50368289&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 145958958 160847391 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 51098899 CCCOc1ccc(cc1)-c1cc(OCCN2CCNCC2)c2cccc(OC)c2n1 InChI=1S/C25H31N3O3/c1-3-16-30-20-9-7-19(8-10-20)22-18-24(31-17-15-28-13-11-26-12-14-28)21-5-4-6-23(29-2)25(21)27-22/h4-10,18,26H,3,11-17H2,1-2H3 ZUHPYWZPEVNMCG-UHFFFAOYSA-N 50368303 CHEMBL4171241 Quinolone resistance protein NorA Staphylococcus aureus 9900 ChEMBL 10.1021/acs.jmedchem.8b00791 10.7270/Q2D50QHG 30067360 Felicetti, T; Cannalire, R; Pietrella, D; Latacz, G; Lubelska, A; Manfroni, G; Barreca, ML; Massari, S; Tabarrini, O; Kieć-Kononowicz, K; Schindler, BD; Kaatz, GW; Cecchetti, V; Sabatini, S 9/13/2018 8/14/2020 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50368303 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50368303&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 145951132 160847405 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 51098900 CCCOc1ccc(cc1)-c1cc(OCCN(CC)CC)c2c(OC)cccc2n1 InChI=1S/C25H32N2O3/c1-5-16-29-20-13-11-19(12-14-20)22-18-24(30-17-15-27(6-2)7-3)25-21(26-22)9-8-10-23(25)28-4/h8-14,18H,5-7,15-17H2,1-4H3 SUHKJLOOFODABJ-UHFFFAOYSA-N 50368304 CHEMBL4169246 Quinolone resistance protein NorA Staphylococcus aureus 9400 ChEMBL 10.1021/acs.jmedchem.8b00791 10.7270/Q2D50QHG 30067360 Felicetti, T; Cannalire, R; Pietrella, D; Latacz, G; Lubelska, A; Manfroni, G; Barreca, ML; Massari, S; Tabarrini, O; Kieć-Kononowicz, K; Schindler, BD; Kaatz, GW; Cecchetti, V; Sabatini, S 9/13/2018 8/14/2020 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50368304 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50368304&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 145955072 160847406 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191