BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 51127501 CC(C)Cc1ccc(cc1)C(C)c1nc2cc(CCC(O)=O)ccc2n1Cc1ccccc1Cl InChI=1S/C29H31ClN2O2/c1-19(2)16-21-8-12-23(13-9-21)20(3)29-31-26-17-22(11-15-28(33)34)10-14-27(26)32(29)18-24-6-4-5-7-25(24)30/h4-10,12-14,17,19-20H,11,15-16,18H2,1-3H3,(H,33,34) SIFBQIMEQWYVBG-UHFFFAOYSA-N 50462326 CHEMBL4251024 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 70 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462326 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462326&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145985137 433929591 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127502 CC(C)Cc1ccc(cc1)C(C)c1nc2cc(ccc2n1Cc1ccccc1Cl)-c1ccc(cc1)C(O)=O InChI=1S/C33H31ClN2O2/c1-21(2)18-23-8-10-24(11-9-23)22(3)32-35-30-19-27(25-12-14-26(15-13-25)33(37)38)16-17-31(30)36(32)20-28-6-4-5-7-29(28)34/h4-17,19,21-22H,18,20H2,1-3H3,(H,37,38) RBTVLIKFGSTVHT-UHFFFAOYSA-N 50462327 CHEMBL4246749 Prostaglandin E synthase Homo sapiens 2100 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462327 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5944&target=Prostaglandin+E+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462327&enzyme=Prostaglandin+E+synthase&column=ki&startPg=0&Increment=50&submit=Search 145985303 433929592 1 MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL 8PYV,4AL1,4AL0,3DWW,6VL4,5TL9,5T37,5T36,5K0I,5BQI,5BQH,5BQG,4YK5,4YL3,4YL1,4YL0 Prostaglandin E synthase PTGES_HUMAN O14684 O14900 Q5SZC0 51127503 CC(C)Cc1ccc(cc1)C(C)c1nc2cc(ccc2n1Cc1ccccc1Cl)-c1ccc(cc1)C(O)=O InChI=1S/C33H31ClN2O2/c1-21(2)18-23-8-10-24(11-9-23)22(3)32-35-30-19-27(25-12-14-26(15-13-25)33(37)38)16-17-31(30)36(32)20-28-6-4-5-7-29(28)34/h4-17,19,21-22H,18,20H2,1-3H3,(H,37,38) RBTVLIKFGSTVHT-UHFFFAOYSA-N 50462327 CHEMBL4246749 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 40 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462327 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462327&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145985303 433929592 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127504 CC(C)Cc1ccc(cc1)C(C)c1nc2cc(ccc2n1Cc1ccccc1Cl)-c1n[nH]c(=S)o1 InChI=1S/C28H27ClN4OS/c1-17(2)14-19-8-10-20(11-9-19)18(3)26-30-24-15-21(27-31-32-28(35)34-27)12-13-25(24)33(26)16-22-6-4-5-7-23(22)29/h4-13,15,17-18H,14,16H2,1-3H3,(H,32,35) ZADYAZTTWZYTSD-UHFFFAOYSA-N 50462328 CHEMBL4251469 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 50 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462328 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462328&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145983649 433929593 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127505 CC(C)Cc1ccc(cc1)C(C)c1nc2cc(CCC(O)=O)ccc2n1Cc1ccccc1Cl InChI=1S/C29H31ClN2O2/c1-19(2)16-21-8-12-23(13-9-21)20(3)29-31-26-17-22(11-15-28(33)34)10-14-27(26)32(29)18-24-6-4-5-7-25(24)30/h4-10,12-14,17,19-20H,11,15-16,18H2,1-3H3,(H,33,34) SIFBQIMEQWYVBG-UHFFFAOYSA-N 50462326 CHEMBL4251024 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 50 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462326 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462326&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145985137 433929591 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127506 CC(C)Cc1ccc(cc1)C(C)c1nc2cc(ccc2n1Cc1ccccc1Cl)-c1noc(C)n1 InChI=1S/C29H29ClN4O/c1-18(2)15-21-9-11-22(12-10-21)19(3)29-32-26-16-23(28-31-20(4)35-33-28)13-14-27(26)34(29)17-24-7-5-6-8-25(24)30/h5-14,16,18-19H,15,17H2,1-4H3 SFMSYFJUDZGCIZ-UHFFFAOYSA-N 50462329 CHEMBL4247181 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 180 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462329 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462329&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145983586 433929594 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127507 CC(C)Cc1ccc(cc1)C(C)c1nc2cc(ccc2n1Cc1ccccc1Cl)-c1n[nH]c(=O)o1 InChI=1S/C28H27ClN4O2/c1-17(2)14-19-8-10-20(11-9-19)18(3)26-30-24-15-21(27-31-32-28(34)35-27)12-13-25(24)33(26)16-22-6-4-5-7-23(22)29/h4-13,15,17-18H,14,16H2,1-3H3,(H,32,34) VPHAZNKSSIOHNU-UHFFFAOYSA-N 50462330 CHEMBL4247178 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 100 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462330 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462330&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145983346 433929595 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127508 CC(C)Cc1ccc(cc1)C(C)c1nc2c(cccc2n1Cc1ccccc1Cl)C(O)=O InChI=1S/C27H27ClN2O2/c1-17(2)15-19-11-13-20(14-12-19)18(3)26-29-25-22(27(31)32)8-6-10-24(25)30(26)16-21-7-4-5-9-23(21)28/h4-14,17-18H,15-16H2,1-3H3,(H,31,32) KAQQCGVBQQUOID-UHFFFAOYSA-N 50462331 CHEMBL4250303 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 400 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462331 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462331&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145983878 433929596 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127509 CC(C)Cc1ccc(cc1)C(C)c1nc2cc(ccc2n1Cc1ccccc1Cl)S(N)(=O)=O InChI=1S/C26H28ClN3O2S/c1-17(2)14-19-8-10-20(11-9-19)18(3)26-29-24-15-22(33(28,31)32)12-13-25(24)30(26)16-21-6-4-5-7-23(21)27/h4-13,15,17-18H,14,16H2,1-3H3,(H2,28,31,32) QYFAYOCSHBFBFK-UHFFFAOYSA-N 50462332 CHEMBL4247754 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 280 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462332 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462332&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145986249 433929597 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127510 Clc1ccccc1Cn1c(NCc2ccc3cc[nH]c3c2)nc2cc(ccc12)C#N InChI=1S/C24H18ClN5/c25-20-4-2-1-3-19(20)15-30-23-8-6-16(13-26)11-22(23)29-24(30)28-14-17-5-7-18-9-10-27-21(18)12-17/h1-12,27H,14-15H2,(H,28,29) JBNVNCOCZZYRBY-UHFFFAOYSA-N 50462333 CHEMBL4244196 Arachidonate 5-lipoxygenase-activating protein Homo sapiens >10000 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462333 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462333&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145982804 433929598 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127511 CC(C)Cc1ccc(cc1)C(C)c1nc2cc(ccc2n1Cc1ccccc1Cl)-c1ccc(cc1)C(O)=O InChI=1S/C33H31ClN2O2/c1-21(2)18-23-8-10-24(11-9-23)22(3)32-35-30-19-27(25-12-14-26(15-13-25)33(37)38)16-17-31(30)36(32)20-28-6-4-5-7-29(28)34/h4-17,19,21-22H,18,20H2,1-3H3,(H,37,38) RBTVLIKFGSTVHT-UHFFFAOYSA-N 50462327 CHEMBL4246749 Leukotriene C4 synthase Homo sapiens 15860 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462327 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462327&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 145985303 433929592 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 51127512 CC(C)Cc1ccc(cc1)C(C)c1nc2cc(ccc2n1Cc1ccccc1Cl)-c1n[nH]c(=S)o1 InChI=1S/C28H27ClN4OS/c1-17(2)14-19-8-10-20(11-9-19)18(3)26-30-24-15-21(27-31-32-28(35)34-27)12-13-25(24)33(26)16-22-6-4-5-7-23(22)29/h4-13,15,17-18H,14,16H2,1-3H3,(H,32,35) ZADYAZTTWZYTSD-UHFFFAOYSA-N 50462328 CHEMBL4251469 Leukotriene C4 synthase Homo sapiens 6190 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462328 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462328&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 145983649 433929593 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 51127513 CC(C)Cc1ccc(cc1)C(C)c1nc2c(CC(O)=O)cccc2n1Cc1ccccc1Cl InChI=1S/C28H29ClN2O2/c1-18(2)15-20-11-13-21(14-12-20)19(3)28-30-27-22(16-26(32)33)8-6-10-25(27)31(28)17-23-7-4-5-9-24(23)29/h4-14,18-19H,15-17H2,1-3H3,(H,32,33) RATMZTJDSBJDKY-UHFFFAOYSA-N 50462334 CHEMBL4246500 Arachidonate 5-lipoxygenase-activating protein Homo sapiens >1000 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462334 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462334&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145986003 433929599 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127514 CC(C)Cc1ccc(cc1)C(C)c1nc2c(CCC(O)=O)cccc2n1Cc1ccccc1Cl InChI=1S/C29H31ClN2O2/c1-19(2)17-21-11-13-22(14-12-21)20(3)29-31-28-23(15-16-27(33)34)8-6-10-26(28)32(29)18-24-7-4-5-9-25(24)30/h4-14,19-20H,15-18H2,1-3H3,(H,33,34) COPSOPUDBYEVPX-UHFFFAOYSA-N 50462335 CHEMBL4246974 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 190 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462335 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462335&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145984302 433929600 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127515 CC(C)Cc1ccc(cc1)C(C)c1nc2cc(ccc2n1Cc1ccccc1Cl)-c1ccccc1C(O)=O InChI=1S/C33H31ClN2O2/c1-21(2)18-23-12-14-24(15-13-23)22(3)32-35-30-19-25(27-9-5-6-10-28(27)33(37)38)16-17-31(30)36(32)20-26-8-4-7-11-29(26)34/h4-17,19,21-22H,18,20H2,1-3H3,(H,37,38) VOQAQQBARVZPEC-UHFFFAOYSA-N 50462336 CHEMBL4240446 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 1100 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462336 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462336&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145984976 433929601 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127516 CC(C)Cc1ccc(cc1)C(C)c1nc2cc(OCC(O)=O)ccc2n1Cc1ccccc1Cl InChI=1S/C28H29ClN2O3/c1-18(2)14-20-8-10-21(11-9-20)19(3)28-30-25-15-23(34-17-27(32)33)12-13-26(25)31(28)16-22-6-4-5-7-24(22)29/h4-13,15,18-19H,14,16-17H2,1-3H3,(H,32,33) RRTUZGYODFPODW-UHFFFAOYSA-N 50462337 CHEMBL4246028 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 180 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462337 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462337&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145983337 433929602 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127517 CC(C)Cc1ccc(cc1)C(C)c1nc2cc(OC(C)(C)C(O)=O)ccc2n1Cc1ccccc1Cl InChI=1S/C30H33ClN2O3/c1-19(2)16-21-10-12-22(13-11-21)20(3)28-32-26-17-24(36-30(4,5)29(34)35)14-15-27(26)33(28)18-23-8-6-7-9-25(23)31/h6-15,17,19-20H,16,18H2,1-5H3,(H,34,35) RLANWNKGLXAWPG-UHFFFAOYSA-N 50462338 CHEMBL4239176 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 200 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462338 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462338&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145982991 433929603 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127518 CC(C)Cc1ccc(cc1)C(C)c1nc2cc(ccc2n1Cc1ccccc1Cl)-c1nnn[nH]1 InChI=1S/C27H27ClN6/c1-17(2)14-19-8-10-20(11-9-19)18(3)27-29-24-15-21(26-30-32-33-31-26)12-13-25(24)34(27)16-22-6-4-5-7-23(22)28/h4-13,15,17-18H,14,16H2,1-3H3,(H,30,31,32,33) PCYVYDIUKWCZKD-UHFFFAOYSA-N 50462339 CHEMBL4250180 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 320 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462339 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462339&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145985817 433929604 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127519 CC(C)Cc1ccc(cc1)C(C)c1nc2cc(ccc2n1Cc1ccccc1Cl)-c1nnco1 InChI=1S/C28H27ClN4O/c1-18(2)14-20-8-10-21(11-9-20)19(3)27-31-25-15-22(28-32-30-17-34-28)12-13-26(25)33(27)16-23-6-4-5-7-24(23)29/h4-13,15,17-19H,14,16H2,1-3H3 KQZCTTDQKPXYME-UHFFFAOYSA-N 50462340 CHEMBL4247640 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 90 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462340 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462340&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145984813 433929605 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127520 CC(C)CCc1ccc(cc1)C(C)c1nc2cc(ccc2n1Cc1ccccc1Cl)C#N InChI=1S/C28H28ClN3/c1-19(2)8-9-21-10-13-23(14-11-21)20(3)28-31-26-16-22(17-30)12-15-27(26)32(28)18-24-6-4-5-7-25(24)29/h4-7,10-16,19-20H,8-9,18H2,1-3H3 UVYLLQWZVGIURX-UHFFFAOYSA-N 50462341 CHEMBL4251022 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 18000 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462341 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462341&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145985135 433929606 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127521 CC(c1nc2cc(ccc2n1Cc1ccccc1Cl)C#N)c1ccc(CC(C)(C)C)cc1 InChI=1S/C28H28ClN3/c1-19(22-12-9-20(10-13-22)16-28(2,3)4)27-31-25-15-21(17-30)11-14-26(25)32(27)18-23-7-5-6-8-24(23)29/h5-15,19H,16,18H2,1-4H3 DQFMTWIZANAIJR-UHFFFAOYSA-N 50462342 CHEMBL4240912 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 1700 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462342 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462342&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145983019 433929607 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127522 CCC(C)c1ccc(cc1)C(C)c1nc2cc(ccc2n1Cc1ccccc1Cl)C#N InChI=1S/C27H26ClN3/c1-4-18(2)21-10-12-22(13-11-21)19(3)27-30-25-15-20(16-29)9-14-26(25)31(27)17-23-7-5-6-8-24(23)28/h5-15,18-19H,4,17H2,1-3H3 AZOFJFRTKKNOCL-UHFFFAOYSA-N 50462343 CHEMBL4240443 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 700 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462343 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462343&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145984975 433929608 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127523 CC(C)Cc1ccc(cc1)C(C)c1nc2cc(CC(O)=O)ccc2n1Cc1ccccc1Cl InChI=1S/C28H29ClN2O2/c1-18(2)14-20-8-11-22(12-9-20)19(3)28-30-25-15-21(16-27(32)33)10-13-26(25)31(28)17-23-6-4-5-7-24(23)29/h4-13,15,18-19H,14,16-17H2,1-3H3,(H,32,33) NIBSYERGBZKLTQ-UHFFFAOYSA-N 50462344 CHEMBL4249435 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 450 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462344 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462344&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145983375 433929609 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127524 CC(C)Cc1ccc(cc1)C(C)c1nc2cc(ccc2n1Cc1ccccc1Cl)C(O)=O InChI=1S/C27H27ClN2O2/c1-17(2)14-19-8-10-20(11-9-19)18(3)26-29-24-15-21(27(31)32)12-13-25(24)30(26)16-22-6-4-5-7-23(22)28/h4-13,15,17-18H,14,16H2,1-3H3,(H,31,32) MRGWBRMLKXZGKM-UHFFFAOYSA-N 50462345 CHEMBL4239733 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 280 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462345 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462345&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145982995 433929610 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127525 Clc1ccccc1Cn1c(NCc2ccc3[nH]ccc3c2)nc2cc(ccc12)C#N InChI=1S/C24H18ClN5/c25-20-4-2-1-3-19(20)15-30-23-8-6-16(13-26)12-22(23)29-24(30)28-14-17-5-7-21-18(11-17)9-10-27-21/h1-12,27H,14-15H2,(H,28,29) JGCJGFQQOYONDS-UHFFFAOYSA-N 50462346 CHEMBL4248447 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 3800 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462346 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462346&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145984322 433929611 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127526 Nc1cnc(cn1)-c1ccc(CCc2nc3cc(ccc3n2Cc2ccccc2Cl)C#N)cc1 InChI=1S/C27H21ClN6/c28-22-4-2-1-3-21(22)17-34-25-11-7-19(14-29)13-23(25)33-27(34)12-8-18-5-9-20(10-6-18)24-15-32-26(30)16-31-24/h1-7,9-11,13,15-16H,8,12,17H2,(H2,30,32) DPIPCNHZOBNKMJ-UHFFFAOYSA-N 50462347 CHEMBL4247819 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 260 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462347 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462347&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145983594 433929612 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127527 Nc1ccc(cn1)-c1ccc(CCc2nc3cc(ccc3n2Cc2ccccc2Cl)C#N)cc1 InChI=1S/C28H22ClN5/c29-24-4-2-1-3-23(24)18-34-26-12-7-20(16-30)15-25(26)33-28(34)14-8-19-5-9-21(10-6-19)22-11-13-27(31)32-17-22/h1-7,9-13,15,17H,8,14,18H2,(H2,31,32) SDBPCACWISQKNM-UHFFFAOYSA-N 50462348 CHEMBL4249908 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 250 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462348 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462348&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145985815 433929613 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127528 Nc1ncc(cn1)-c1ccc(CCc2nc3cc(ccc3n2Cc2ccccc2Cl)C#N)cc1 InChI=1S/C27H21ClN6/c28-23-4-2-1-3-21(23)17-34-25-11-7-19(14-29)13-24(25)33-26(34)12-8-18-5-9-20(10-6-18)22-15-31-27(30)32-16-22/h1-7,9-11,13,15-16H,8,12,17H2,(H2,30,31,32) OPGRUAXMDAIPLI-UHFFFAOYSA-N 50462349 CHEMBL4239812 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 370 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462349 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462349&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145984213 433929614 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127529 CC(C)Cc1ccc(cc1)C(C)c1nc2cc(CCC(O)=O)ccc2n1Cc1ccccc1Cl InChI=1S/C29H31ClN2O2/c1-19(2)16-21-8-12-23(13-9-21)20(3)29-31-26-17-22(11-15-28(33)34)10-14-27(26)32(29)18-24-6-4-5-7-25(24)30/h4-10,12-14,17,19-20H,11,15-16,18H2,1-3H3,(H,33,34) SIFBQIMEQWYVBG-UHFFFAOYSA-N 50462326 CHEMBL4251024 Polyunsaturated fatty acid 5-lipoxygenase Homo sapiens 60 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462326 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2259&target=Polyunsaturated+fatty+acid+5-lipoxygenase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462326&enzyme=Polyunsaturated+fatty+acid+5-lipoxygenase&column=ki&startPg=0&Increment=50&submit=Search 145985137 433929591 1 MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECGLFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYYYLSPDRIPNSVAI Polyunsaturated fatty acid 5-lipoxygenase LOX5_HUMAN P09917 B7ZLS0 E5FPY5 E5FPY7 E5FPY8 Q5JQ14 51127530 CC(C)Cc1ccc(cc1)C(C)c1nc2cc(CCC(O)=O)ccc2n1Cc1ccccc1Cl InChI=1S/C29H31ClN2O2/c1-19(2)16-21-8-12-23(13-9-21)20(3)29-31-26-17-22(11-15-28(33)34)10-14-27(26)32(29)18-24-6-4-5-7-25(24)30/h4-10,12-14,17,19-20H,11,15-16,18H2,1-3H3,(H,33,34) SIFBQIMEQWYVBG-UHFFFAOYSA-N 50462326 CHEMBL4251024 Leukotriene C4 synthase Homo sapiens 30 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462326 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462326&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 145985137 433929591 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 51127531 CC(C)Cc1ccc(cc1)C(C)c1nc2cc(ccc2n1Cc1ccccc1Cl)-c1ccc(cc1)C(O)=O InChI=1S/C33H31ClN2O2/c1-21(2)18-23-8-10-24(11-9-23)22(3)32-35-30-19-27(25-12-14-26(15-13-25)33(37)38)16-17-31(30)36(32)20-28-6-4-5-7-29(28)34/h4-17,19,21-22H,18,20H2,1-3H3,(H,37,38) RBTVLIKFGSTVHT-UHFFFAOYSA-N 50462327 CHEMBL4246749 Polyunsaturated fatty acid 5-lipoxygenase Homo sapiens 3200 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462327 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2259&target=Polyunsaturated+fatty+acid+5-lipoxygenase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462327&enzyme=Polyunsaturated+fatty+acid+5-lipoxygenase&column=ki&startPg=0&Increment=50&submit=Search 145985303 433929592 1 MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECGLFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYYYLSPDRIPNSVAI Polyunsaturated fatty acid 5-lipoxygenase LOX5_HUMAN P09917 B7ZLS0 E5FPY5 E5FPY7 E5FPY8 Q5JQ14 51127532 CC(C)Cc1ccc(cc1)C(C)c1nc2cc(ccc2n1Cc1ccccc1Cl)-c1n[nH]c(=S)o1 InChI=1S/C28H27ClN4OS/c1-17(2)14-19-8-10-20(11-9-19)18(3)26-30-24-15-21(27-31-32-28(35)34-27)12-13-25(24)33(26)16-22-6-4-5-7-23(22)29/h4-13,15,17-18H,14,16H2,1-3H3,(H,32,35) ZADYAZTTWZYTSD-UHFFFAOYSA-N 50462328 CHEMBL4251469 Polyunsaturated fatty acid 5-lipoxygenase Homo sapiens 600 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462328 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2259&target=Polyunsaturated+fatty+acid+5-lipoxygenase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462328&enzyme=Polyunsaturated+fatty+acid+5-lipoxygenase&column=ki&startPg=0&Increment=50&submit=Search 145983649 433929593 1 MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECGLFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYYYLSPDRIPNSVAI Polyunsaturated fatty acid 5-lipoxygenase LOX5_HUMAN P09917 B7ZLS0 E5FPY5 E5FPY7 E5FPY8 Q5JQ14 51127533 CC(=O)N(O)C\C=C\c1cccc(Oc2ccccc2)c1 InChI=1S/C17H17NO3/c1-14(19)18(20)12-6-8-15-7-5-11-17(13-15)21-16-9-3-2-4-10-16/h2-11,13,20H,12H2,1H3 CEUDWZXMLMKPNN-UHFFFAOYSA-N 22334 N-(3-phenoxycinnamyl)acetohydroxamic acid::BW A4C::CHEMBL314360::JMC515449 Compound 7::BW4C::N-hydroxy-N-[(2E)-3-(3-phenoxyphenyl)prop-2-en-1-yl]acetamide::BWA4C::BWA4C, 10 Polyunsaturated fatty acid 5-lipoxygenase Homo sapiens 100 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=22334 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2259&target=Polyunsaturated+fatty+acid+5-lipoxygenase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=22334&enzyme=Polyunsaturated+fatty+acid+5-lipoxygenase&column=ki&startPg=0&Increment=50&submit=Search 6438354 49846149 CHEMBL314360 1 MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECGLFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYYYLSPDRIPNSVAI Polyunsaturated fatty acid 5-lipoxygenase LOX5_HUMAN P09917 B7ZLS0 E5FPY5 E5FPY7 E5FPY8 Q5JQ14 51127534 CC(C)Cc1ccc(cc1)C(C)c1nc2cc(ccc2n1Cc1ccccc1Cl)-c1n[nH]c(=S)o1 InChI=1S/C28H27ClN4OS/c1-17(2)14-19-8-10-20(11-9-19)18(3)26-30-24-15-21(27-31-32-28(35)34-27)12-13-25(24)33(26)16-22-6-4-5-7-23(22)29/h4-13,15,17-18H,14,16H2,1-3H3,(H,32,35) ZADYAZTTWZYTSD-UHFFFAOYSA-N 50462328 CHEMBL4251469 Prostaglandin E synthase Homo sapiens 420 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462328 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5944&target=Prostaglandin+E+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462328&enzyme=Prostaglandin+E+synthase&column=ki&startPg=0&Increment=50&submit=Search 145983649 433929593 1 MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL 8PYV,4AL1,4AL0,3DWW,6VL4,5TL9,5T37,5T36,5K0I,5BQI,5BQH,5BQG,4YK5,4YL3,4YL1,4YL0 Prostaglandin E synthase PTGES_HUMAN O14684 O14900 Q5SZC0 51127535 CC(C)Cc1ccc(cc1)C(C)c1nc2cc(ccc2n1Cc1ccccc1Cl)-c1nc(cs1)C(O)=O InChI=1S/C30H28ClN3O2S/c1-18(2)14-20-8-10-21(11-9-20)19(3)28-32-25-15-22(29-33-26(17-37-29)30(35)36)12-13-27(25)34(28)16-23-6-4-5-7-24(23)31/h4-13,15,17-19H,14,16H2,1-3H3,(H,35,36) LFSPMNGMPNVYRD-UHFFFAOYSA-N 50462350 CHEMBL4251226 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 150 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462350 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462350&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145983395 433929615 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127536 CC(C)Cc1ccc(cc1)C(C)c1nc2cc(ccc2n1Cc1ccccc1Cl)C(N)=O InChI=1S/C27H28ClN3O/c1-17(2)14-19-8-10-20(11-9-19)18(3)27-30-24-15-21(26(29)32)12-13-25(24)31(27)16-22-6-4-5-7-23(22)28/h4-13,15,17-18H,14,16H2,1-3H3,(H2,29,32) YXFOVOSLDZAZRU-UHFFFAOYSA-N 50462351 CHEMBL4241055 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 130 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462351 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462351&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145985235 433929616 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127537 Clc1ccccc1Cn1c(NCCc2c[nH]c3ccccc23)nc2cc(ccc12)C#N InChI=1S/C25H20ClN5/c26-21-7-3-1-5-19(21)16-31-24-10-9-17(14-27)13-23(24)30-25(31)28-12-11-18-15-29-22-8-4-2-6-20(18)22/h1-10,13,15,29H,11-12,16H2,(H,28,30) BBKXYSAQVDUEPE-UHFFFAOYSA-N 50462352 CHEMBL4244646 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 8800 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462352 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462352&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145984768 433929617 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127538 Nc1ccc(nn1)-c1ccc(CCc2nc3cc(ccc3n2Cc2ccccc2Cl)C#N)cc1 InChI=1S/C27H21ClN6/c28-22-4-2-1-3-21(22)17-34-25-12-7-19(16-29)15-24(25)31-27(34)14-8-18-5-9-20(10-6-18)23-11-13-26(30)33-32-23/h1-7,9-13,15H,8,14,17H2,(H2,30,33) RVJCYHXDGNTGKI-UHFFFAOYSA-N 50462353 CHEMBL4243603 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 660 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462353 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462353&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145985963 433929618 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127539 CC(Cc1ccc(cc1)-c1cnc(N)nc1)c1nc2cc(ccc2n1Cc1ccccc1Cl)C#N InChI=1S/C28H23ClN6/c1-18(12-19-6-9-21(10-7-19)23-15-32-28(31)33-16-23)27-34-25-13-20(14-30)8-11-26(25)35(27)17-22-4-2-3-5-24(22)29/h2-11,13,15-16,18H,12,17H2,1H3,(H2,31,32,33) CLMXPTXFRHPNCQ-UHFFFAOYSA-N 50462354 CHEMBL4240262 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 420 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462354 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462354&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145982760 433929619 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127540 CC(C)c1ccc2c(c1)c(c(n2Cc3ccc(cc3)Cl)CC(C)(C)C(=O)O)SC(C)(C)C InChI=1S/C27H34ClNO2S/c1-17(2)19-10-13-22-21(14-19)24(32-26(3,4)5)23(15-27(6,7)25(30)31)29(22)16-18-8-11-20(28)12-9-18/h8-14,17H,15-16H2,1-7H3,(H,30,31) QAOAOVKBIIKRNL-UHFFFAOYSA-N 50006805 CHEMBL29097::3-(3-(tert-butylthio)-1-(4-chlorobenzyl)-5-isopropyl-1H-indol-2-yl)-2,2-dimethylpropanoic acid::3-[1-(4-chlorobenzyl)-3-t-butyl-thio-5-isopropylindol-2-yl]-2,2-dimethylpropanoic acid::cid_3651377::3-(1-(4-chlorobenzyl)-3-(tert-butylthio)-5-isopropyl-1H-indol-2-yl)-2,2-dimethylpropanoic acid::MK-886::MK886::3-[3-tert-Butylsulfanyl-1-(4-chloro-benzyl)-5-isopropyl-1H-indol-2-yl]-2,2-dimethyl-propionic acid Polyunsaturated fatty acid 5-lipoxygenase Homo sapiens 3000 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50006805 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2259&target=Polyunsaturated+fatty+acid+5-lipoxygenase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50006805&enzyme=Polyunsaturated+fatty+acid+5-lipoxygenase&column=ki&startPg=0&Increment=50&submit=Search QY7 6VGI 3651377 103920123 CHEMBL29097 1 MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECGLFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYYYLSPDRIPNSVAI Polyunsaturated fatty acid 5-lipoxygenase LOX5_HUMAN P09917 B7ZLS0 E5FPY5 E5FPY7 E5FPY8 Q5JQ14 51127541 CC(C)Cc1ccc(cc1)C(C)c1nc2ccccc2n1Cc1ccccc1Cl InChI=1S/C26H27ClN2/c1-18(2)16-20-12-14-21(15-13-20)19(3)26-28-24-10-6-7-11-25(24)29(26)17-22-8-4-5-9-23(22)27/h4-15,18-19H,16-17H2,1-3H3 RSOFSWHYZCGXSL-UHFFFAOYSA-N 50385390 CHEMBL2036163 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 310 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50385390 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50385390&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 3610995 160864473 CHEMBL2036163 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127542 CC(C)Cc1ccc(cc1)C(C)c1nc2cc(ccc2n1Cc1ccccc1Cl)-c1noc(=O)[nH]1 InChI=1S/C28H27ClN4O2/c1-17(2)14-19-8-10-20(11-9-19)18(3)27-30-24-15-21(26-31-28(34)35-32-26)12-13-25(24)33(27)16-22-6-4-5-7-23(22)29/h4-13,15,17-18H,14,16H2,1-3H3,(H,31,32,34) IZNVGVJVNSLGQP-UHFFFAOYSA-N 50462355 CHEMBL4242947 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 270 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462355 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462355&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145984745 433929620 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127543 CC(C)Cc1ccc(cc1)C(C)c1nc2cc(ccc2n1Cc1ccccc1Cl)-c1cccc(c1)C(O)=O InChI=1S/C33H31ClN2O2/c1-21(2)17-23-11-13-24(14-12-23)22(3)32-35-30-19-26(25-8-6-9-27(18-25)33(37)38)15-16-31(30)36(32)20-28-7-4-5-10-29(28)34/h4-16,18-19,21-22H,17,20H2,1-3H3,(H,37,38) ZTBZXJFKMIDBIN-UHFFFAOYSA-N 50462356 CHEMBL4250561 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 74 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462356 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462356&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145983160 433929621 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127544 Nc1ncc(cn1)-c1ccc(CC(=C)c2nc3cc(ccc3n2Cc2ccccc2Cl)C#N)cc1 InChI=1S/C28H21ClN6/c1-18(12-19-6-9-21(10-7-19)23-15-32-28(31)33-16-23)27-34-25-13-20(14-30)8-11-26(25)35(27)17-22-4-2-3-5-24(22)29/h2-11,13,15-16H,1,12,17H2,(H2,31,32,33) VJNHFGGSHGJDJG-UHFFFAOYSA-N 50462357 CHEMBL4250880 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 370 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462357 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462357&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145982895 433929622 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 51127545 CC(C)Cc1ccc(cc1)C(C)c1nc2cc(ccc2n1Cc1ccccc1Cl)C(N)=S InChI=1S/C27H28ClN3S/c1-17(2)14-19-8-10-20(11-9-19)18(3)27-30-24-15-21(26(29)32)12-13-25(24)31(27)16-22-6-4-5-7-23(22)28/h4-13,15,17-18H,14,16H2,1-3H3,(H2,29,32) QCXJCQDIRDPICF-UHFFFAOYSA-N 50462358 CHEMBL4245924 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 160 ChEMBL 10.1016/j.ejmech.2018.03.045 10.7270/Q25D8VHD 29597170 Gür, ZT; Çalışkan, B; Garscha, U; Olgaç, A; Schubert, US; Gerstmeier, J; Werz, O; Banoglu, E 4/25/2018 8/17/2020 Gazi University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50462358 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50462358&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 145985990 433929623 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04