BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 455105 CN(C)CCCN1c2ccccc2Sc2ccc(Cl)cc12 InChI=1S/C17H19ClN2S/c1-19(2)10-5-11-20-14-6-3-4-7-16(14)21-17-9-8-13(18)12-15(17)20/h3-4,6-9,12H,5,10-11H2,1-2H3 ZPEIMTDSQAKGNT-UHFFFAOYSA-N 50001888 (chloropromazine) [3-(2-Chloro-phenothiazin-10-yl)-propyl]-dimethyl-amine::(chlorpromazine)[3-(2-Chloro-phenothiazin-10-yl)-propyl]-dimethyl-amine::1-(2-Allyl-phenoxy)-3-isopropylamino-propan-2-ol::1N,1N-dimethyl-3-(2-chloro-10H-10-phenothiazinyl)-1-propanamine::3-(2-chloro-10H-phenothiazin-10-yl)-N,N-dimethylpropan-1-amine::CHEMBL71::CHLORPROMAZINE::CHLORPROMAZINE HIBENZATE::CHLORPROMAZINE HYDROCHLORIDE::CHLORPROMAZINE PHENOLPHTHALINATE::CHLORPROMAZINE TANNATE::Chlorpromazine;[3-(2-Chloro-phenothiazin-10-yl)-propyl]-dimethyl-amine::PROMAPAR::SONAZINE::THORAZINE::[3-(2-Chloro-phenothiazin-10-yl)-propyl]-dimethyl-amine (chlor-promazine)::[3-(2-Chloro-phenothiazin-10-yl)-propyl]-dimethyl-amine( Chlorpromazine)::[3-(2-Chloro-phenothiazin-10-yl)-propyl]-dimethyl-amine(clorpromazine)::chloropromazine::med.21724, Compound 15 Proteasome subunit alpha type-6 Human 14800 7.5 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.7b00489 10.7270/Q2DV1H2F 28719185 aid1794859 Jones, CL; Njomen, E; Sjögren, B; Dexheimer, TS; Tepe, JJ 9/15/2017 1/3/2018 Michigan State University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001888 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006561&target=Proteasome+subunit+alpha+type-6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001888&enzyme=Proteasome+subunit+alpha+type-6&column=ki&startPg=0&Increment=50&submit=Search Z80 3LK0,5NUM,5NUN,5NUJ,5NUK,5G08,4MA8,7OOK,5LG3,3APX 2726 103916255 3647 CHEMBL71 DB00477 83 C06906 ZINC00044027 1 MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD 1IRU,4R3O,4R67,5A0Q,5GJQ,5GJR,5L4G,5LE5,5LEX,5LEY,5LEZ,5LF0,5LF1,5LF3,5LF4,5LF6,5LF7,5LN3,5M32,5T0G,5T0H,5T0I,5T0J,5VFO,5VFP,5VFQ,5VFR,5VFS,5VFT,5VFU,6AVO,6E5B,6EPC,6EPD,6EPE,6EPF,6KWY,6MSB,6MSD,6MSE,6MSG,6MSH,6MSJ,6MSK,6R70,6REY,6RGQ,6TU3,6WJD,6WJN,6XMJ,7AWE,7B12,7DR6,7DR7,7DRW,7LXV,7NAN,7NAO,7NAP,7NAQ,7NHT,7PG9,7QXN,7QXP,7QXU,7QXW,7QXX,7QY7,7QYA,7QYB,7V5G,7V5M,7W37,7W38,7W39,7W3A,7W3B,7W3C,7W3F,7W3G,7W3H,7W3I,7W3J,7W3K,7W3M,8CVR,8CVS,8CVT,8CXB,8FZ5,8FZ6 Proteasome subunit alpha type-6 PSA6_HUMAN P60900 B2R7J9 B4DQR4 B4DXJ9 P34062 Q6IB60 455106 CN(C)CCCN1c2ccccc2Sc2ccc(cc12)C(F)(F)F InChI=1S/C18H19F3N2S/c1-22(2)10-5-11-23-14-6-3-4-7-16(14)24-17-9-8-13(12-15(17)23)18(19,20)21/h3-4,6-9,12H,5,10-11H2,1-2H3 XSCGXQMFQXDFCW-UHFFFAOYSA-N 67544 N,N-dimethyl-3-[2-(trifluoromethyl)-10-phenothiazinyl]-1-propanamine;hydrochloride::N,N-dimethyl-3-[2-(trifluoromethyl)phenothiazin-10-yl]propan-1-amine;hydrochloride::SR-01000000224-4::TRIFLUPROMAZINE::cid_66069::dimethyl-[3-[2-(trifluoromethyl)phenothiazin-10-yl]propyl]amine;hydrochloride::med.21724, Compound Triflupromazine Proteasome subunit alpha type-6 Human 7800 7.5 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.7b00489 10.7270/Q2DV1H2F 28719185 aid1794859 Jones, CL; Njomen, E; Sjögren, B; Dexheimer, TS; Tepe, JJ 9/15/2017 1/3/2018 Michigan State University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=67544 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006561&target=Proteasome+subunit+alpha+type-6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=67544&enzyme=Proteasome+subunit+alpha+type-6&column=ki&startPg=0&Increment=50&submit=Search 5568 252645839 DB00508 ZINC00538507 1 MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD 1IRU,4R3O,4R67,5A0Q,5GJQ,5GJR,5L4G,5LE5,5LEX,5LEY,5LEZ,5LF0,5LF1,5LF3,5LF4,5LF6,5LF7,5LN3,5M32,5T0G,5T0H,5T0I,5T0J,5VFO,5VFP,5VFQ,5VFR,5VFS,5VFT,5VFU,6AVO,6E5B,6EPC,6EPD,6EPE,6EPF,6KWY,6MSB,6MSD,6MSE,6MSG,6MSH,6MSJ,6MSK,6R70,6REY,6RGQ,6TU3,6WJD,6WJN,6XMJ,7AWE,7B12,7DR6,7DR7,7DRW,7LXV,7NAN,7NAO,7NAP,7NAQ,7NHT,7PG9,7QXN,7QXP,7QXU,7QXW,7QXX,7QY7,7QYA,7QYB,7V5G,7V5M,7W37,7W38,7W39,7W3A,7W3B,7W3C,7W3F,7W3G,7W3H,7W3I,7W3J,7W3K,7W3M,8CVR,8CVS,8CVT,8CXB,8FZ5,8FZ6 Proteasome subunit alpha type-6 PSA6_HUMAN P60900 B2R7J9 B4DQR4 B4DXJ9 P34062 Q6IB60 455107 CSc1ccc2Sc3ccccc3N(CCC3CCCCN3C)c2c1 InChI=1S/C21H26N2S2/c1-22-13-6-5-7-16(22)12-14-23-18-8-3-4-9-20(18)25-21-11-10-17(24-2)15-19(21)23/h3-4,8-11,15-16H,5-7,12-14H2,1-2H3 KLBQZWRITKRQQV-UHFFFAOYSA-N 50002338 (Thioridazine)10-[2-(1-Methyl-piperidin-2-yl)-ethyl]-2-methylsulfanyl-10H-phenothiazine::10-(2-(1-methylpiperidin-2-yl)ethyl)-2-(methylthio)-10H-phenothiazine::10-[2-(1-Methyl-piperidin-2-yl)-ethyl]-2-methylsulfanyl-10H-phenothiazine::10-[2-(1-Methyl-piperidin-2-yl)-ethyl]-2-methylsulfanyl-10H-phenothiazine (thioridazine)::CHEMBL479::MELLARIL::MELLARIL-S::THIORIDAZINE::TP-21::US9504692, Thioridazine Proteasome subunit alpha type-6 Human 12000 7.5 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.7b00489 10.7270/Q2DV1H2F 28719185 aid1794859 Jones, CL; Njomen, E; Sjögren, B; Dexheimer, TS; Tepe, JJ 9/15/2017 1/3/2018 Michigan State University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50002338 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006561&target=Proteasome+subunit+alpha+type-6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50002338&enzyme=Proteasome+subunit+alpha+type-6&column=ki&startPg=0&Increment=50&submit=Search LZU 4I1R,4UHX 5452 103916644 9566 CHEMBL479 DB00679 100 ZINC01530697 1 MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD 1IRU,4R3O,4R67,5A0Q,5GJQ,5GJR,5L4G,5LE5,5LEX,5LEY,5LEZ,5LF0,5LF1,5LF3,5LF4,5LF6,5LF7,5LN3,5M32,5T0G,5T0H,5T0I,5T0J,5VFO,5VFP,5VFQ,5VFR,5VFS,5VFT,5VFU,6AVO,6E5B,6EPC,6EPD,6EPE,6EPF,6KWY,6MSB,6MSD,6MSE,6MSG,6MSH,6MSJ,6MSK,6R70,6REY,6RGQ,6TU3,6WJD,6WJN,6XMJ,7AWE,7B12,7DR6,7DR7,7DRW,7LXV,7NAN,7NAO,7NAP,7NAQ,7NHT,7PG9,7QXN,7QXP,7QXU,7QXW,7QXX,7QY7,7QYA,7QYB,7V5G,7V5M,7W37,7W38,7W39,7W3A,7W3B,7W3C,7W3F,7W3G,7W3H,7W3I,7W3J,7W3K,7W3M,8CVR,8CVS,8CVT,8CXB,8FZ5,8FZ6 Proteasome subunit alpha type-6 PSA6_HUMAN P60900 B2R7J9 B4DQR4 B4DXJ9 P34062 Q6IB60 455108 CN1CCCC(CC2c3ccccc3Sc3ccccc23)C1 InChI=1S/C20H23NS/c1-21-12-6-7-15(14-21)13-18-16-8-2-4-10-19(16)22-20-11-5-3-9-17(18)20/h2-5,8-11,15,18H,6-7,12-14H2,1H3 MJFJKKXQDNNUJF-UHFFFAOYSA-N 79211 1-methyl-3-(9H-thioxanthen-9-ylmethyl)piperidine;hydrate;hydrochloride::METHIXENE::MLS002153842::Metixene::Metixene hydrochloride::SMR001233205::cid_71177 Proteasome subunit alpha type-6 Human 11900 7.5 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.7b00489 10.7270/Q2DV1H2F 28719185 aid1794859 Jones, CL; Njomen, E; Sjögren, B; Dexheimer, TS; Tepe, JJ 9/15/2017 1/3/2018 Michigan State University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=79211 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006561&target=Proteasome+subunit+alpha+type-6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=79211&enzyme=Proteasome+subunit+alpha+type-6&column=ki&startPg=0&Increment=50&submit=Search 4167 252655906 DB00340 ZINC01713960 1 MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD 1IRU,4R3O,4R67,5A0Q,5GJQ,5GJR,5L4G,5LE5,5LEX,5LEY,5LEZ,5LF0,5LF1,5LF3,5LF4,5LF6,5LF7,5LN3,5M32,5T0G,5T0H,5T0I,5T0J,5VFO,5VFP,5VFQ,5VFR,5VFS,5VFT,5VFU,6AVO,6E5B,6EPC,6EPD,6EPE,6EPF,6KWY,6MSB,6MSD,6MSE,6MSG,6MSH,6MSJ,6MSK,6R70,6REY,6RGQ,6TU3,6WJD,6WJN,6XMJ,7AWE,7B12,7DR6,7DR7,7DRW,7LXV,7NAN,7NAO,7NAP,7NAQ,7NHT,7PG9,7QXN,7QXP,7QXU,7QXW,7QXX,7QY7,7QYA,7QYB,7V5G,7V5M,7W37,7W38,7W39,7W3A,7W3B,7W3C,7W3F,7W3G,7W3H,7W3I,7W3J,7W3K,7W3M,8CVR,8CVS,8CVT,8CXB,8FZ5,8FZ6 Proteasome subunit alpha type-6 PSA6_HUMAN P60900 B2R7J9 B4DQR4 B4DXJ9 P34062 Q6IB60 455109 CN(C)CCCN1c2ccccc2CCc2ccc(Cl)cc12 InChI=1S/C19H23ClN2/c1-21(2)12-5-13-22-18-7-4-3-6-15(18)8-9-16-10-11-17(20)14-19(16)22/h3-4,6-7,10-11,14H,5,8-9,12-13H2,1-2H3 GDLIGKIOYRNHDA-UHFFFAOYSA-N 77970 3-(2-chloranyl-5,6-dihydrobenzo[b][1]benzazepin-11-yl)-N,N-dimethyl-propan-1-amine;hydrochloride::3-(2-chloro-5,6-dihydrobenzo[b][1]benzazepin-11-yl)-N,N-dimethyl-1-propanamine;hydrochloride::3-(2-chloro-5,6-dihydrobenzo[b][1]benzazepin-11-yl)-N,N-dimethylpropan-1-amine;hydrochloride::3-(2-chloro-5,6-dihydrobenzo[b][1]benzazepin-11-yl)propyl-dimethyl-amine;hydrochloride::CHLORIMIPRAMINE::CLOMIPRAMINE::CLOMIPRAMINE HYDROCHLORIDE::CLOMIPRIMINE::MLS000028511::SMR000058295::cid_68539::med.21724, Compound Clomipramine Proteasome subunit alpha type-6 Human 12400 7.5 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.7b00489 10.7270/Q2DV1H2F 28719185 aid1794859 Jones, CL; Njomen, E; Sjögren, B; Dexheimer, TS; Tepe, JJ 9/15/2017 1/3/2018 Michigan State University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=77970 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006561&target=Proteasome+subunit+alpha+type-6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=77970&enzyme=Proteasome+subunit+alpha+type-6&column=ki&startPg=0&Increment=50&submit=Search CXX 4MMA,2QEI,6G9I,2Q6H 2801 252654733 3755 DB01242 C06918 1 MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD 1IRU,4R3O,4R67,5A0Q,5GJQ,5GJR,5L4G,5LE5,5LEX,5LEY,5LEZ,5LF0,5LF1,5LF3,5LF4,5LF6,5LF7,5LN3,5M32,5T0G,5T0H,5T0I,5T0J,5VFO,5VFP,5VFQ,5VFR,5VFS,5VFT,5VFU,6AVO,6E5B,6EPC,6EPD,6EPE,6EPF,6KWY,6MSB,6MSD,6MSE,6MSG,6MSH,6MSJ,6MSK,6R70,6REY,6RGQ,6TU3,6WJD,6WJN,6XMJ,7AWE,7B12,7DR6,7DR7,7DRW,7LXV,7NAN,7NAO,7NAP,7NAQ,7NHT,7PG9,7QXN,7QXP,7QXU,7QXW,7QXX,7QY7,7QYA,7QYB,7V5G,7V5M,7W37,7W38,7W39,7W3A,7W3B,7W3C,7W3F,7W3G,7W3H,7W3I,7W3J,7W3K,7W3M,8CVR,8CVS,8CVT,8CXB,8FZ5,8FZ6 Proteasome subunit alpha type-6 PSA6_HUMAN P60900 B2R7J9 B4DQR4 B4DXJ9 P34062 Q6IB60 455110 CN(C)CCCN1c2ccccc2Sc2ccc(Cl)cc12 InChI=1S/C17H19ClN2S/c1-19(2)10-5-11-20-14-6-3-4-7-16(14)21-17-9-8-13(18)12-15(17)20/h3-4,6-9,12H,5,10-11H2,1-2H3 ZPEIMTDSQAKGNT-UHFFFAOYSA-N 50001888 (chloropromazine) [3-(2-Chloro-phenothiazin-10-yl)-propyl]-dimethyl-amine::(chlorpromazine)[3-(2-Chloro-phenothiazin-10-yl)-propyl]-dimethyl-amine::1-(2-Allyl-phenoxy)-3-isopropylamino-propan-2-ol::1N,1N-dimethyl-3-(2-chloro-10H-10-phenothiazinyl)-1-propanamine::3-(2-chloro-10H-phenothiazin-10-yl)-N,N-dimethylpropan-1-amine::CHEMBL71::CHLORPROMAZINE::CHLORPROMAZINE HIBENZATE::CHLORPROMAZINE HYDROCHLORIDE::CHLORPROMAZINE PHENOLPHTHALINATE::CHLORPROMAZINE TANNATE::Chlorpromazine;[3-(2-Chloro-phenothiazin-10-yl)-propyl]-dimethyl-amine::PROMAPAR::SONAZINE::THORAZINE::[3-(2-Chloro-phenothiazin-10-yl)-propyl]-dimethyl-amine (chlor-promazine)::[3-(2-Chloro-phenothiazin-10-yl)-propyl]-dimethyl-amine( Chlorpromazine)::[3-(2-Chloro-phenothiazin-10-yl)-propyl]-dimethyl-amine(clorpromazine)::chloropromazine::med.21724, Compound 15 Proteasome subunit alpha type-6 Human 9900 7.5 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.7b00489 10.7270/Q2DV1H2F 28719185 aid1794859 Jones, CL; Njomen, E; Sjögren, B; Dexheimer, TS; Tepe, JJ 9/15/2017 1/3/2018 Michigan State University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001888 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006561&target=Proteasome+subunit+alpha+type-6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001888&enzyme=Proteasome+subunit+alpha+type-6&column=ki&startPg=0&Increment=50&submit=Search Z80 3LK0,5NUM,5NUN,5NUJ,5NUK,5G08,4MA8,7OOK,5LG3,3APX 2726 103916255 3647 CHEMBL71 DB00477 83 C06906 ZINC00044027 1 MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD 1IRU,4R3O,4R67,5A0Q,5GJQ,5GJR,5L4G,5LE5,5LEX,5LEY,5LEZ,5LF0,5LF1,5LF3,5LF4,5LF6,5LF7,5LN3,5M32,5T0G,5T0H,5T0I,5T0J,5VFO,5VFP,5VFQ,5VFR,5VFS,5VFT,5VFU,6AVO,6E5B,6EPC,6EPD,6EPE,6EPF,6KWY,6MSB,6MSD,6MSE,6MSG,6MSH,6MSJ,6MSK,6R70,6REY,6RGQ,6TU3,6WJD,6WJN,6XMJ,7AWE,7B12,7DR6,7DR7,7DRW,7LXV,7NAN,7NAO,7NAP,7NAQ,7NHT,7PG9,7QXN,7QXP,7QXU,7QXW,7QXX,7QY7,7QYA,7QYB,7V5G,7V5M,7W37,7W38,7W39,7W3A,7W3B,7W3C,7W3F,7W3G,7W3H,7W3I,7W3J,7W3K,7W3M,8CVR,8CVS,8CVT,8CXB,8FZ5,8FZ6 Proteasome subunit alpha type-6 PSA6_HUMAN P60900 B2R7J9 B4DQR4 B4DXJ9 P34062 Q6IB60 455111 CC(C)CCCN1c2ccccc2Sc2ccc(Cl)cc12 InChI=1S/C18H20ClNS/c1-13(2)6-5-11-20-15-7-3-4-8-17(15)21-18-10-9-14(19)12-16(18)20/h3-4,7-10,12-13H,5-6,11H2,1-2H3 IMYKKTVSQLRQPB-UHFFFAOYSA-N 65507 CPZ analog, 1 Proteasome subunit alpha type-6 Human >25000 7.5 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.7b00489 10.7270/Q2DV1H2F 28719185 aid1794859 Jones, CL; Njomen, E; Sjögren, B; Dexheimer, TS; Tepe, JJ 9/15/2017 1/3/2018 Michigan State University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=65507 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006561&target=Proteasome+subunit+alpha+type-6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=65507&enzyme=Proteasome+subunit+alpha+type-6&column=ki&startPg=0&Increment=50&submit=Search 131953890 350083128 ZINC15953031 1 MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD 1IRU,4R3O,4R67,5A0Q,5GJQ,5GJR,5L4G,5LE5,5LEX,5LEY,5LEZ,5LF0,5LF1,5LF3,5LF4,5LF6,5LF7,5LN3,5M32,5T0G,5T0H,5T0I,5T0J,5VFO,5VFP,5VFQ,5VFR,5VFS,5VFT,5VFU,6AVO,6E5B,6EPC,6EPD,6EPE,6EPF,6KWY,6MSB,6MSD,6MSE,6MSG,6MSH,6MSJ,6MSK,6R70,6REY,6RGQ,6TU3,6WJD,6WJN,6XMJ,7AWE,7B12,7DR6,7DR7,7DRW,7LXV,7NAN,7NAO,7NAP,7NAQ,7NHT,7PG9,7QXN,7QXP,7QXU,7QXW,7QXX,7QY7,7QYA,7QYB,7V5G,7V5M,7W37,7W38,7W39,7W3A,7W3B,7W3C,7W3F,7W3G,7W3H,7W3I,7W3J,7W3K,7W3M,8CVR,8CVS,8CVT,8CXB,8FZ5,8FZ6 Proteasome subunit alpha type-6 PSA6_HUMAN P60900 B2R7J9 B4DQR4 B4DXJ9 P34062 Q6IB60 455112 OS(=O)(=O)CCCCN1c2ccccc2Sc2ccc(Cl)cc12 InChI=1S/C16H16ClNO3S2/c17-12-7-8-16-14(11-12)18(9-3-4-10-23(19,20)21)13-5-1-2-6-15(13)22-16/h1-2,5-8,11H,3-4,9-10H2,(H,19,20,21) LYNDVTVYYWZTSM-UHFFFAOYSA-N 65508 CPZ analog, 2 Proteasome subunit alpha type-6 Human 6300 7.5 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.7b00489 10.7270/Q2DV1H2F 28719185 aid1794859 Jones, CL; Njomen, E; Sjögren, B; Dexheimer, TS; Tepe, JJ 9/15/2017 1/3/2018 Michigan State University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=65508 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006561&target=Proteasome+subunit+alpha+type-6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=65508&enzyme=Proteasome+subunit+alpha+type-6&column=ki&startPg=0&Increment=50&submit=Search 22572547 350083129 C15521 ZINC60238933 1 MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD 1IRU,4R3O,4R67,5A0Q,5GJQ,5GJR,5L4G,5LE5,5LEX,5LEY,5LEZ,5LF0,5LF1,5LF3,5LF4,5LF6,5LF7,5LN3,5M32,5T0G,5T0H,5T0I,5T0J,5VFO,5VFP,5VFQ,5VFR,5VFS,5VFT,5VFU,6AVO,6E5B,6EPC,6EPD,6EPE,6EPF,6KWY,6MSB,6MSD,6MSE,6MSG,6MSH,6MSJ,6MSK,6R70,6REY,6RGQ,6TU3,6WJD,6WJN,6XMJ,7AWE,7B12,7DR6,7DR7,7DRW,7LXV,7NAN,7NAO,7NAP,7NAQ,7NHT,7PG9,7QXN,7QXP,7QXU,7QXW,7QXX,7QY7,7QYA,7QYB,7V5G,7V5M,7W37,7W38,7W39,7W3A,7W3B,7W3C,7W3F,7W3G,7W3H,7W3I,7W3J,7W3K,7W3M,8CVR,8CVS,8CVT,8CXB,8FZ5,8FZ6 Proteasome subunit alpha type-6 PSA6_HUMAN P60900 B2R7J9 B4DQR4 B4DXJ9 P34062 Q6IB60 455113 OS(=O)(=O)CCCN1c2ccccc2Sc2ccc(Cl)cc12 InChI=1S/C15H14ClNO3S2/c16-11-6-7-15-13(10-11)17(8-3-9-22(18,19)20)12-4-1-2-5-14(12)21-15/h1-2,4-7,10H,3,8-9H2,(H,18,19,20) WOZZYXWXMZHYCA-UHFFFAOYSA-N 65509 CPZ analog, 3 Proteasome subunit alpha type-6 Human >25000 7.5 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.7b00489 10.7270/Q2DV1H2F 28719185 aid1794859 Jones, CL; Njomen, E; Sjögren, B; Dexheimer, TS; Tepe, JJ 9/15/2017 1/3/2018 Michigan State University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=65509 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006561&target=Proteasome+subunit+alpha+type-6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=65509&enzyme=Proteasome+subunit+alpha+type-6&column=ki&startPg=0&Increment=50&submit=Search 54442341 350083130 C15521 ZINC05185218 1 MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD 1IRU,4R3O,4R67,5A0Q,5GJQ,5GJR,5L4G,5LE5,5LEX,5LEY,5LEZ,5LF0,5LF1,5LF3,5LF4,5LF6,5LF7,5LN3,5M32,5T0G,5T0H,5T0I,5T0J,5VFO,5VFP,5VFQ,5VFR,5VFS,5VFT,5VFU,6AVO,6E5B,6EPC,6EPD,6EPE,6EPF,6KWY,6MSB,6MSD,6MSE,6MSG,6MSH,6MSJ,6MSK,6R70,6REY,6RGQ,6TU3,6WJD,6WJN,6XMJ,7AWE,7B12,7DR6,7DR7,7DRW,7LXV,7NAN,7NAO,7NAP,7NAQ,7NHT,7PG9,7QXN,7QXP,7QXU,7QXW,7QXX,7QY7,7QYA,7QYB,7V5G,7V5M,7W37,7W38,7W39,7W3A,7W3B,7W3C,7W3F,7W3G,7W3H,7W3I,7W3J,7W3K,7W3M,8CVR,8CVS,8CVT,8CXB,8FZ5,8FZ6 Proteasome subunit alpha type-6 PSA6_HUMAN P60900 B2R7J9 B4DQR4 B4DXJ9 P34062 Q6IB60 455114 OS(=O)(=O)CCCCCN1c2ccccc2Sc2ccc(Cl)cc12 InChI=1S/C17H18ClNO3S2/c18-13-8-9-17-15(12-13)19(10-4-1-5-11-24(20,21)22)14-6-2-3-7-16(14)23-17/h2-3,6-9,12H,1,4-5,10-11H2,(H,20,21,22) FKUGMGRFWHLRJB-UHFFFAOYSA-N 65510 CPZ analog, 4 Proteasome subunit alpha type-6 Human >25000 7.5 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.7b00489 10.7270/Q2DV1H2F 28719185 aid1794859 Jones, CL; Njomen, E; Sjögren, B; Dexheimer, TS; Tepe, JJ 9/15/2017 1/3/2018 Michigan State University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=65510 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006561&target=Proteasome+subunit+alpha+type-6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=65510&enzyme=Proteasome+subunit+alpha+type-6&column=ki&startPg=0&Increment=50&submit=Search 131953891 350083131 C15521 ZINC02623180 1 MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD 1IRU,4R3O,4R67,5A0Q,5GJQ,5GJR,5L4G,5LE5,5LEX,5LEY,5LEZ,5LF0,5LF1,5LF3,5LF4,5LF6,5LF7,5LN3,5M32,5T0G,5T0H,5T0I,5T0J,5VFO,5VFP,5VFQ,5VFR,5VFS,5VFT,5VFU,6AVO,6E5B,6EPC,6EPD,6EPE,6EPF,6KWY,6MSB,6MSD,6MSE,6MSG,6MSH,6MSJ,6MSK,6R70,6REY,6RGQ,6TU3,6WJD,6WJN,6XMJ,7AWE,7B12,7DR6,7DR7,7DRW,7LXV,7NAN,7NAO,7NAP,7NAQ,7NHT,7PG9,7QXN,7QXP,7QXU,7QXW,7QXX,7QY7,7QYA,7QYB,7V5G,7V5M,7W37,7W38,7W39,7W3A,7W3B,7W3C,7W3F,7W3G,7W3H,7W3I,7W3J,7W3K,7W3M,8CVR,8CVS,8CVT,8CXB,8FZ5,8FZ6 Proteasome subunit alpha type-6 PSA6_HUMAN P60900 B2R7J9 B4DQR4 B4DXJ9 P34062 Q6IB60 455115 Clc1ccc2Sc3ccccc3N(CCCCN3CCOCC3)c2c1 InChI=1S/C20H23ClN2OS/c21-16-7-8-20-18(15-16)23(17-5-1-2-6-19(17)25-20)10-4-3-9-22-11-13-24-14-12-22/h1-2,5-8,15H,3-4,9-14H2 NYTLEHCHADNPCL-UHFFFAOYSA-N 65511 CPZ analog, 5 Proteasome subunit alpha type-6 Human 8900 7.5 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.7b00489 10.7270/Q2DV1H2F 28719185 aid1794859 Jones, CL; Njomen, E; Sjögren, B; Dexheimer, TS; Tepe, JJ 9/15/2017 1/3/2018 Michigan State University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=65511 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006561&target=Proteasome+subunit+alpha+type-6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=65511&enzyme=Proteasome+subunit+alpha+type-6&column=ki&startPg=0&Increment=50&submit=Search 131953892 350083132 ZINC04056380 1 MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD 1IRU,4R3O,4R67,5A0Q,5GJQ,5GJR,5L4G,5LE5,5LEX,5LEY,5LEZ,5LF0,5LF1,5LF3,5LF4,5LF6,5LF7,5LN3,5M32,5T0G,5T0H,5T0I,5T0J,5VFO,5VFP,5VFQ,5VFR,5VFS,5VFT,5VFU,6AVO,6E5B,6EPC,6EPD,6EPE,6EPF,6KWY,6MSB,6MSD,6MSE,6MSG,6MSH,6MSJ,6MSK,6R70,6REY,6RGQ,6TU3,6WJD,6WJN,6XMJ,7AWE,7B12,7DR6,7DR7,7DRW,7LXV,7NAN,7NAO,7NAP,7NAQ,7NHT,7PG9,7QXN,7QXP,7QXU,7QXW,7QXX,7QY7,7QYA,7QYB,7V5G,7V5M,7W37,7W38,7W39,7W3A,7W3B,7W3C,7W3F,7W3G,7W3H,7W3I,7W3J,7W3K,7W3M,8CVR,8CVS,8CVT,8CXB,8FZ5,8FZ6 Proteasome subunit alpha type-6 PSA6_HUMAN P60900 B2R7J9 B4DQR4 B4DXJ9 P34062 Q6IB60 455116 OC(=O)C#CCN1c2ccccc2Sc2ccc(Cl)cc12 InChI=1S/C16H10ClNO2S/c17-11-7-8-15-13(10-11)18(9-3-6-16(19)20)12-4-1-2-5-14(12)21-15/h1-2,4-5,7-8,10H,9H2,(H,19,20) RUZNPXQEIDOOFE-UHFFFAOYSA-N 65512 CPZ analog, 6 Proteasome subunit alpha type-6 Human >25000 7.5 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.7b00489 10.7270/Q2DV1H2F 28719185 aid1794859 Jones, CL; Njomen, E; Sjögren, B; Dexheimer, TS; Tepe, JJ 9/15/2017 1/3/2018 Michigan State University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=65512 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006561&target=Proteasome+subunit+alpha+type-6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=65512&enzyme=Proteasome+subunit+alpha+type-6&column=ki&startPg=0&Increment=50&submit=Search 131953893 350083133 ZINC04034780 1 MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD 1IRU,4R3O,4R67,5A0Q,5GJQ,5GJR,5L4G,5LE5,5LEX,5LEY,5LEZ,5LF0,5LF1,5LF3,5LF4,5LF6,5LF7,5LN3,5M32,5T0G,5T0H,5T0I,5T0J,5VFO,5VFP,5VFQ,5VFR,5VFS,5VFT,5VFU,6AVO,6E5B,6EPC,6EPD,6EPE,6EPF,6KWY,6MSB,6MSD,6MSE,6MSG,6MSH,6MSJ,6MSK,6R70,6REY,6RGQ,6TU3,6WJD,6WJN,6XMJ,7AWE,7B12,7DR6,7DR7,7DRW,7LXV,7NAN,7NAO,7NAP,7NAQ,7NHT,7PG9,7QXN,7QXP,7QXU,7QXW,7QXX,7QY7,7QYA,7QYB,7V5G,7V5M,7W37,7W38,7W39,7W3A,7W3B,7W3C,7W3F,7W3G,7W3H,7W3I,7W3J,7W3K,7W3M,8CVR,8CVS,8CVT,8CXB,8FZ5,8FZ6 Proteasome subunit alpha type-6 PSA6_HUMAN P60900 B2R7J9 B4DQR4 B4DXJ9 P34062 Q6IB60 455117 OC(=O)c1ccc(CN2c3ccccc3Sc3ccc(Cl)cc23)cc1 InChI=1S/C20H14ClNO2S/c21-15-9-10-19-17(11-15)22(16-3-1-2-4-18(16)25-19)12-13-5-7-14(8-6-13)20(23)24/h1-11H,12H2,(H,23,24) YKOKIGJUJYYSAF-UHFFFAOYSA-N 65513 CPZ analog, 7 Proteasome subunit alpha type-6 Human 6400 7.5 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.7b00489 10.7270/Q2DV1H2F 28719185 aid1794859 Jones, CL; Njomen, E; Sjögren, B; Dexheimer, TS; Tepe, JJ 9/15/2017 1/3/2018 Michigan State University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=65513 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006561&target=Proteasome+subunit+alpha+type-6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=65513&enzyme=Proteasome+subunit+alpha+type-6&column=ki&startPg=0&Increment=50&submit=Search 131953894 350083134 ZINC03031577 1 MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD 1IRU,4R3O,4R67,5A0Q,5GJQ,5GJR,5L4G,5LE5,5LEX,5LEY,5LEZ,5LF0,5LF1,5LF3,5LF4,5LF6,5LF7,5LN3,5M32,5T0G,5T0H,5T0I,5T0J,5VFO,5VFP,5VFQ,5VFR,5VFS,5VFT,5VFU,6AVO,6E5B,6EPC,6EPD,6EPE,6EPF,6KWY,6MSB,6MSD,6MSE,6MSG,6MSH,6MSJ,6MSK,6R70,6REY,6RGQ,6TU3,6WJD,6WJN,6XMJ,7AWE,7B12,7DR6,7DR7,7DRW,7LXV,7NAN,7NAO,7NAP,7NAQ,7NHT,7PG9,7QXN,7QXP,7QXU,7QXW,7QXX,7QY7,7QYA,7QYB,7V5G,7V5M,7W37,7W38,7W39,7W3A,7W3B,7W3C,7W3F,7W3G,7W3H,7W3I,7W3J,7W3K,7W3M,8CVR,8CVS,8CVT,8CXB,8FZ5,8FZ6 Proteasome subunit alpha type-6 PSA6_HUMAN P60900 B2R7J9 B4DQR4 B4DXJ9 P34062 Q6IB60 455118 COC(=O)c1ccc(CN2c3ccccc3Sc3ccc(Cl)cc23)cc1 InChI=1S/C21H16ClNO2S/c1-25-21(24)15-8-6-14(7-9-15)13-23-17-4-2-3-5-19(17)26-20-11-10-16(22)12-18(20)23/h2-12H,13H2,1H3 HIDDWKTVRSKQSL-UHFFFAOYSA-N 65514 CPZ analog, 8 Proteasome subunit alpha type-6 Human 15600 7.5 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.7b00489 10.7270/Q2DV1H2F 28719185 aid1794859 Jones, CL; Njomen, E; Sjögren, B; Dexheimer, TS; Tepe, JJ 9/15/2017 1/3/2018 Michigan State University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=65514 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006561&target=Proteasome+subunit+alpha+type-6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=65514&enzyme=Proteasome+subunit+alpha+type-6&column=ki&startPg=0&Increment=50&submit=Search 131953895 350083135 ZINC03369390 1 MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD 1IRU,4R3O,4R67,5A0Q,5GJQ,5GJR,5L4G,5LE5,5LEX,5LEY,5LEZ,5LF0,5LF1,5LF3,5LF4,5LF6,5LF7,5LN3,5M32,5T0G,5T0H,5T0I,5T0J,5VFO,5VFP,5VFQ,5VFR,5VFS,5VFT,5VFU,6AVO,6E5B,6EPC,6EPD,6EPE,6EPF,6KWY,6MSB,6MSD,6MSE,6MSG,6MSH,6MSJ,6MSK,6R70,6REY,6RGQ,6TU3,6WJD,6WJN,6XMJ,7AWE,7B12,7DR6,7DR7,7DRW,7LXV,7NAN,7NAO,7NAP,7NAQ,7NHT,7PG9,7QXN,7QXP,7QXU,7QXW,7QXX,7QY7,7QYA,7QYB,7V5G,7V5M,7W37,7W38,7W39,7W3A,7W3B,7W3C,7W3F,7W3G,7W3H,7W3I,7W3J,7W3K,7W3M,8CVR,8CVS,8CVT,8CXB,8FZ5,8FZ6 Proteasome subunit alpha type-6 PSA6_HUMAN P60900 B2R7J9 B4DQR4 B4DXJ9 P34062 Q6IB60 455119 CN(C)CCCN1c2ccccc2Sc2ccc(Cl)cc12 InChI=1S/C17H19ClN2S/c1-19(2)10-5-11-20-14-6-3-4-7-16(14)21-17-9-8-13(18)12-15(17)20/h3-4,6-9,12H,5,10-11H2,1-2H3 ZPEIMTDSQAKGNT-UHFFFAOYSA-N 50001888 (chloropromazine) [3-(2-Chloro-phenothiazin-10-yl)-propyl]-dimethyl-amine::(chlorpromazine)[3-(2-Chloro-phenothiazin-10-yl)-propyl]-dimethyl-amine::1-(2-Allyl-phenoxy)-3-isopropylamino-propan-2-ol::1N,1N-dimethyl-3-(2-chloro-10H-10-phenothiazinyl)-1-propanamine::3-(2-chloro-10H-phenothiazin-10-yl)-N,N-dimethylpropan-1-amine::CHEMBL71::CHLORPROMAZINE::CHLORPROMAZINE HIBENZATE::CHLORPROMAZINE HYDROCHLORIDE::CHLORPROMAZINE PHENOLPHTHALINATE::CHLORPROMAZINE TANNATE::Chlorpromazine;[3-(2-Chloro-phenothiazin-10-yl)-propyl]-dimethyl-amine::PROMAPAR::SONAZINE::THORAZINE::[3-(2-Chloro-phenothiazin-10-yl)-propyl]-dimethyl-amine (chlor-promazine)::[3-(2-Chloro-phenothiazin-10-yl)-propyl]-dimethyl-amine( Chlorpromazine)::[3-(2-Chloro-phenothiazin-10-yl)-propyl]-dimethyl-amine(clorpromazine)::chloropromazine::med.21724, Compound 15 5-hydroxytryptamine receptor 7 Homo sapiens 480 Curated from the literature by BindingDB 10.1021/acschembio.7b00489 10.7270/Q2DV1H2F 28719185 aid1794860 Jones, CL; Njomen, E; Sjögren, B; Dexheimer, TS; Tepe, JJ 9/15/2017 1/3/2018 Michigan State University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001888 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3431&target=5-hydroxytryptamine+receptor+7&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001888&enzyme=5-hydroxytryptamine+receptor+7&column=ki&startPg=0&Increment=50&submit=Search Z80 3LK0,5NUM,5NUN,5NUJ,5NUK,5G08,4MA8,7OOK,5LG3,3APX 2726 103916255 3647 CHEMBL71 DB00477 83 C06906 ZINC00044027 1 MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSCIPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD 7XTC 5-hydroxytryptamine receptor 7 5HT7R_HUMAN P34969 B5BUP6 P78336 P78372 P78516 Q5VX01 Q5VX02 Q5VX03 455120 CC(C)CCCN1c2ccccc2Sc2ccc(Cl)cc12 InChI=1S/C18H20ClNS/c1-13(2)6-5-11-20-15-7-3-4-8-17(15)21-18-10-9-14(19)12-16(18)20/h3-4,7-10,12-13H,5-6,11H2,1-2H3 IMYKKTVSQLRQPB-UHFFFAOYSA-N 65507 CPZ analog, 1 5-hydroxytryptamine receptor 7 Homo sapiens >250000 Curated from the literature by BindingDB 10.1021/acschembio.7b00489 10.7270/Q2DV1H2F 28719185 aid1794860 Jones, CL; Njomen, E; Sjögren, B; Dexheimer, TS; Tepe, JJ 9/15/2017 1/3/2018 Michigan State University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=65507 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3431&target=5-hydroxytryptamine+receptor+7&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=65507&enzyme=5-hydroxytryptamine+receptor+7&column=ki&startPg=0&Increment=50&submit=Search 131953890 350083128 ZINC15953031 1 MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSCIPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD 7XTC 5-hydroxytryptamine receptor 7 5HT7R_HUMAN P34969 B5BUP6 P78336 P78372 P78516 Q5VX01 Q5VX02 Q5VX03 455121 OS(=O)(=O)CCCCN1c2ccccc2Sc2ccc(Cl)cc12 InChI=1S/C16H16ClNO3S2/c17-12-7-8-16-14(11-12)18(9-3-4-10-23(19,20)21)13-5-1-2-6-15(13)22-16/h1-2,5-8,11H,3-4,9-10H2,(H,19,20,21) LYNDVTVYYWZTSM-UHFFFAOYSA-N 65508 CPZ analog, 2 5-hydroxytryptamine receptor 7 Homo sapiens >250000 Curated from the literature by BindingDB 10.1021/acschembio.7b00489 10.7270/Q2DV1H2F 28719185 aid1794860 Jones, CL; Njomen, E; Sjögren, B; Dexheimer, TS; Tepe, JJ 9/15/2017 1/3/2018 Michigan State University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=65508 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3431&target=5-hydroxytryptamine+receptor+7&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=65508&enzyme=5-hydroxytryptamine+receptor+7&column=ki&startPg=0&Increment=50&submit=Search 22572547 350083129 C15521 ZINC60238933 1 MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSCIPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD 7XTC 5-hydroxytryptamine receptor 7 5HT7R_HUMAN P34969 B5BUP6 P78336 P78372 P78516 Q5VX01 Q5VX02 Q5VX03 455122 Clc1ccc2Sc3ccccc3N(CCCCN3CCOCC3)c2c1 InChI=1S/C20H23ClN2OS/c21-16-7-8-20-18(15-16)23(17-5-1-2-6-19(17)25-20)10-4-3-9-22-11-13-24-14-12-22/h1-2,5-8,15H,3-4,9-14H2 NYTLEHCHADNPCL-UHFFFAOYSA-N 65511 CPZ analog, 5 5-hydroxytryptamine receptor 7 Homo sapiens >2970 Curated from the literature by BindingDB 10.1021/acschembio.7b00489 10.7270/Q2DV1H2F 28719185 aid1794860 Jones, CL; Njomen, E; Sjögren, B; Dexheimer, TS; Tepe, JJ 9/15/2017 1/3/2018 Michigan State University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=65511 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3431&target=5-hydroxytryptamine+receptor+7&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=65511&enzyme=5-hydroxytryptamine+receptor+7&column=ki&startPg=0&Increment=50&submit=Search 131953892 350083132 ZINC04056380 1 MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSCIPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD 7XTC 5-hydroxytryptamine receptor 7 5HT7R_HUMAN P34969 B5BUP6 P78336 P78372 P78516 Q5VX01 Q5VX02 Q5VX03 455123 OC(=O)C#CCN1c2ccccc2Sc2ccc(Cl)cc12 InChI=1S/C16H10ClNO2S/c17-11-7-8-15-13(10-11)18(9-3-6-16(19)20)12-4-1-2-5-14(12)21-15/h1-2,4-5,7-8,10H,9H2,(H,19,20) RUZNPXQEIDOOFE-UHFFFAOYSA-N 65512 CPZ analog, 6 5-hydroxytryptamine receptor 7 Homo sapiens >250000 Curated from the literature by BindingDB 10.1021/acschembio.7b00489 10.7270/Q2DV1H2F 28719185 aid1794860 Jones, CL; Njomen, E; Sjögren, B; Dexheimer, TS; Tepe, JJ 9/15/2017 1/3/2018 Michigan State University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=65512 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3431&target=5-hydroxytryptamine+receptor+7&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=65512&enzyme=5-hydroxytryptamine+receptor+7&column=ki&startPg=0&Increment=50&submit=Search 131953893 350083133 ZINC04034780 1 MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSCIPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD 7XTC 5-hydroxytryptamine receptor 7 5HT7R_HUMAN P34969 B5BUP6 P78336 P78372 P78516 Q5VX01 Q5VX02 Q5VX03 455124 OC(=O)c1ccc(CN2c3ccccc3Sc3ccc(Cl)cc23)cc1 InChI=1S/C20H14ClNO2S/c21-15-9-10-19-17(11-15)22(16-3-1-2-4-18(16)25-19)12-13-5-7-14(8-6-13)20(23)24/h1-11H,12H2,(H,23,24) YKOKIGJUJYYSAF-UHFFFAOYSA-N 65513 CPZ analog, 7 5-hydroxytryptamine receptor 7 Homo sapiens >250000 Curated from the literature by BindingDB 10.1021/acschembio.7b00489 10.7270/Q2DV1H2F 28719185 aid1794860 Jones, CL; Njomen, E; Sjögren, B; Dexheimer, TS; Tepe, JJ 9/15/2017 1/3/2018 Michigan State University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=65513 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3431&target=5-hydroxytryptamine+receptor+7&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=65513&enzyme=5-hydroxytryptamine+receptor+7&column=ki&startPg=0&Increment=50&submit=Search 131953894 350083134 ZINC03031577 1 MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSCIPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD 7XTC 5-hydroxytryptamine receptor 7 5HT7R_HUMAN P34969 B5BUP6 P78336 P78372 P78516 Q5VX01 Q5VX02 Q5VX03 455125 COC(=O)c1ccc(CN2c3ccccc3Sc3ccc(Cl)cc23)cc1 InChI=1S/C21H16ClNO2S/c1-25-21(24)15-8-6-14(7-9-15)13-23-17-4-2-3-5-19(17)26-20-11-10-16(22)12-18(20)23/h2-12H,13H2,1H3 HIDDWKTVRSKQSL-UHFFFAOYSA-N 65514 CPZ analog, 8 5-hydroxytryptamine receptor 7 Homo sapiens >250000 Curated from the literature by BindingDB 10.1021/acschembio.7b00489 10.7270/Q2DV1H2F 28719185 aid1794860 Jones, CL; Njomen, E; Sjögren, B; Dexheimer, TS; Tepe, JJ 9/15/2017 1/3/2018 Michigan State University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=65514 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3431&target=5-hydroxytryptamine+receptor+7&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=65514&enzyme=5-hydroxytryptamine+receptor+7&column=ki&startPg=0&Increment=50&submit=Search 131953895 350083135 ZINC03369390 1 MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSCIPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD 7XTC 5-hydroxytryptamine receptor 7 5HT7R_HUMAN P34969 B5BUP6 P78336 P78372 P78516 Q5VX01 Q5VX02 Q5VX03