BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50886586 COc1ccc(Cc2nnc(SCc3c(F)cccc3F)n2-c2ccc(F)cc2)cc1OC InChI=1S/C24H20F3N3O2S/c1-31-21-11-6-15(12-22(21)32-2)13-23-28-29-24(30(23)17-9-7-16(25)8-10-17)33-14-18-19(26)4-3-5-20(18)27/h3-12H,13-14H2,1-2H3 QYTVXMFHESIMAM-UHFFFAOYSA-N 50266530 CHEMBL4092629 G-protein coupled bile acid receptor 1 Mus musculus 21 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266530 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266530&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 66740913 404858026 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886587 COc1ccc(Cc2nnc(SCc3c(F)cccc3F)n2-c2ccc(F)cc2)cc1OC InChI=1S/C24H20F3N3O2S/c1-31-21-11-6-15(12-22(21)32-2)13-23-28-29-24(30(23)17-9-7-16(25)8-10-17)33-14-18-19(26)4-3-5-20(18)27/h3-12H,13-14H2,1-2H3 QYTVXMFHESIMAM-UHFFFAOYSA-N 50266530 CHEMBL4092629 G-protein coupled bile acid receptor 1 Homo sapiens 470 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266530 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266530&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 66740913 404858026 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50886588 CCn1c2nnc(SCc3ccc(cc3)C(F)(F)F)n2c2ccccc2c1=O InChI=1S/C19H15F3N4OS/c1-2-25-16(27)14-5-3-4-6-15(14)26-17(25)23-24-18(26)28-11-12-7-9-13(10-8-12)19(20,21)22/h3-10H,2,11H2,1H3 OFUZHYLZBLDDHQ-UHFFFAOYSA-N 50266535 CHEMBL4082345 G-protein coupled bile acid receptor 1 Mus musculus 1680 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266535 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266535&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 1434463 104113864 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886589 COc1ccc(cc1OC)N(C)c1cnc(SCc2ccccc2)n1-c1ccc(F)cc1 InChI=1S/C25H24FN3O2S/c1-28(21-13-14-22(30-2)23(15-21)31-3)24-16-27-25(32-17-18-7-5-4-6-8-18)29(24)20-11-9-19(26)10-12-20/h4-16H,17H2,1-3H3 FSKBDQOKJRCKGZ-UHFFFAOYSA-N 50266536 US10323016, Example 1::CHEMBL4085664 G-protein coupled bile acid receptor 1 Mus musculus 68 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266536 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266536&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118586298 404858027 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886590 COc1ccc(cc1OC)N(C)c1cnc(SCc2ccccc2F)n1-c1ccc(F)cc1 InChI=1S/C25H23F2N3O2S/c1-29(20-12-13-22(31-2)23(14-20)32-3)24-15-28-25(30(24)19-10-8-18(26)9-11-19)33-16-17-6-4-5-7-21(17)27/h4-15H,16H2,1-3H3 FGPFAMGSKPYXBQ-UHFFFAOYSA-N 50266537 US10323016, Example 3::CHEMBL4075688 G-protein coupled bile acid receptor 1 Mus musculus 12 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266537 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266537&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118576974 404858028 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886591 COc1ccc(cc1OC)N(C)c1cnc(SCc2c(F)cccc2F)n1-c1ccc(F)cc1 InChI=1S/C25H22F3N3O2S/c1-30(18-11-12-22(32-2)23(13-18)33-3)24-14-29-25(31(24)17-9-7-16(26)8-10-17)34-15-19-20(27)5-4-6-21(19)28/h4-14H,15H2,1-3H3 DEBXSGITWCYLOY-UHFFFAOYSA-N 50266538 US10323016, Example 4::CHEMBL4084668 G-protein coupled bile acid receptor 1 Mus musculus 0.800000 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266538 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266538&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118576935 404858029 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886592 COc1ccc(cc1OC)N(C)c1nnc(SCc2c(F)cccc2F)n1-c1ccc(F)cc1 InChI=1S/C24H21F3N4O2S/c1-30(17-11-12-21(32-2)22(13-17)33-3)23-28-29-24(31(23)16-9-7-15(25)8-10-16)34-14-18-19(26)5-4-6-20(18)27/h4-13H,14H2,1-3H3 IBAUFLYJKHGLLI-UHFFFAOYSA-N 50266540 US10323016, Example 12::CHEMBL4102610 G-protein coupled bile acid receptor 1 Mus musculus 180 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266540 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266540&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118586282 404858030 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886593 COC(=O)CCc1nc(SCc2c(F)cccc2F)n(c1N(C)c1ccc(OC)c(OC)c1)-c1ccc(F)cc1 InChI=1S/C29H28F3N3O4S/c1-34(20-12-14-25(37-2)26(16-20)38-3)28-24(13-15-27(36)39-4)33-29(35(28)19-10-8-18(30)9-11-19)40-17-21-22(31)6-5-7-23(21)32/h5-12,14,16H,13,15,17H2,1-4H3 GYOAXIGPIFOLQA-UHFFFAOYSA-N 50266541 CHEMBL4069569 G-protein coupled bile acid receptor 1 Homo sapiens 1113 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266541 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266541&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 126673489 404858031 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50886594 COc1ccc(cc1OC)N(C)c1c(CCCCN)nc(SCc2c(F)cccc2F)n1-c1ccc(F)cc1 InChI=1S/C29H31F3N4O2S/c1-35(21-14-15-26(37-2)27(17-21)38-3)28-25(9-4-5-16-33)34-29(36(28)20-12-10-19(30)11-13-20)39-18-22-23(31)7-6-8-24(22)32/h6-8,10-15,17H,4-5,9,16,18,33H2,1-3H3 JAHODMSQJJFAQW-UHFFFAOYSA-N 50266542 CHEMBL4098315 G-protein coupled bile acid receptor 1 Homo sapiens >4500 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266542 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266542&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 126673464 404858032 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50886595 COc1ccc(cc1OC)N(C)c1c(C)nc(SCc2c(F)cccc2F)n1-c1ccc(F)cc1 InChI=1S/C26H24F3N3O2S/c1-16-25(31(2)19-12-13-23(33-3)24(14-19)34-4)32(18-10-8-17(27)9-11-18)26(30-16)35-15-20-21(28)6-5-7-22(20)29/h5-14H,15H2,1-4H3 PODBKRLJPSUMHY-UHFFFAOYSA-N 50266543 CHEMBL4080290 G-protein coupled bile acid receptor 1 Homo sapiens 337 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266543 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266543&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 126673445 404858033 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50886596 COc1ccc(cc1OC)N(C)c1cnc(SCc2c(F)cc(OCCCS(O)(=O)=O)cc2F)n1-c1ccc(F)cc1 InChI=1S/C28H28F3N3O6S2/c1-33(20-9-10-25(38-2)26(13-20)39-3)27-16-32-28(34(27)19-7-5-18(29)6-8-19)41-17-22-23(30)14-21(15-24(22)31)40-11-4-12-42(35,36)37/h5-10,13-16H,4,11-12,17H2,1-3H3,(H,35,36,37) AUGWFSKMKLCJIL-UHFFFAOYSA-N 50266544 CHEMBL4060410 G-protein coupled bile acid receptor 1 Homo sapiens 24 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266544 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266544&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118577239 404858034 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50886597 COc1ccc(cc1OC)N(C)c1cnc(SCc2c(F)cc(OCCC[N+]34CCN(CC3)CC4)cc2F)n1-c1ccc(F)cc1 InChI=1S/C34H39F3N5O3S/c1-39(26-9-10-31(43-2)32(19-26)44-3)33-22-38-34(41(33)25-7-5-24(35)6-8-25)46-23-28-29(36)20-27(21-30(28)37)45-18-4-14-42-15-11-40(12-16-42)13-17-42/h5-10,19-22H,4,11-18,23H2,1-3H3/q+1 RMXSSKGSTYUERI-UHFFFAOYSA-N 50266545 CHEMBL4078612 G-protein coupled bile acid receptor 1 Homo sapiens 238 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266545 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266545&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118576918 404858035 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50886598 COc1cc(ccc1F)-n1c(SCc2c(F)cccc2F)ncc1N(C)c1ccc(OC)c(OC)c1 InChI=1S/C26H24F3N3O3S/c1-31(16-9-11-22(33-2)24(12-16)35-4)25-14-30-26(36-15-18-19(27)6-5-7-20(18)28)32(25)17-8-10-21(29)23(13-17)34-3/h5-14H,15H2,1-4H3 CWJPFQTWSDPZOY-UHFFFAOYSA-N 50266552 US10323016, Example 20::CHEMBL4094487 G-protein coupled bile acid receptor 1 Mus musculus 0.800000 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266552 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266552&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118576930 404858036 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886599 COc1cc(ccc1Cl)N(C)c1cnc(SCc2c(F)cccc2F)n1-c1ccc(F)cc1 InChI=1S/C24H19ClF3N3OS/c1-30(17-10-11-19(25)22(12-17)32-2)23-13-29-24(31(23)16-8-6-15(26)7-9-16)33-14-18-20(27)4-3-5-21(18)28/h3-13H,14H2,1-2H3 IFIJPYCPQQHJTC-UHFFFAOYSA-N 50266556 US10323016, Example 5::CHEMBL4073081 G-protein coupled bile acid receptor 1 Mus musculus 44 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266556 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266556&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118577011 404858037 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886600 COc1cccc(c1)N(C)c1cnc(SCc2c(F)cccc2F)n1-c1ccc(F)cc1 InChI=1S/C24H20F3N3OS/c1-29(18-5-3-6-19(13-18)31-2)23-14-28-24(30(23)17-11-9-16(25)10-12-17)32-15-20-21(26)7-4-8-22(20)27/h3-14H,15H2,1-2H3 FOQHSUBQNPOLDN-UHFFFAOYSA-N 50266557 US10323016, Example 16::CHEMBL4063932 G-protein coupled bile acid receptor 1 Mus musculus 91 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266557 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266557&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118586276 404858038 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886601 CN(c1cnc(SCc2c(F)cccc2F)n1-c1ccc(F)cc1)c1ccc(Cl)c(Cl)c1 InChI=1S/C23H16Cl2F3N3S/c1-30(16-9-10-18(24)19(25)11-16)22-12-29-23(31(22)15-7-5-14(26)6-8-15)32-13-17-20(27)3-2-4-21(17)28/h2-12H,13H2,1H3 OTECHJIJAUHLNR-UHFFFAOYSA-N 50266558 US10323016, Example 18::CHEMBL4088938 G-protein coupled bile acid receptor 1 Mus musculus 507 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266558 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266558&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118586280 404858039 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886602 COc1ccc(CN(C)c2cnc(SCc3c(F)cccc3F)n2-c2ccc(F)cc2)cc1OC InChI=1S/C26H24F3N3O2S/c1-31(15-17-7-12-23(33-2)24(13-17)34-3)25-14-30-26(32(25)19-10-8-18(27)9-11-19)35-16-20-21(28)5-4-6-22(20)29/h4-14H,15-16H2,1-3H3 QQJLRZZJOUTJSL-UHFFFAOYSA-N 50266559 CHEMBL4067717 G-protein coupled bile acid receptor 1 Mus musculus 40 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266559 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266559&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 126700765 404858040 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886603 COc1ccc(cc1OC)N(C)c1cnc(SCc2c(F)cc(cc2F)C#CCN(C)C)n1-c1ccc(F)cc1 InChI=1S/C30H29F3N4O2S/c1-35(2)14-6-7-20-15-25(32)24(26(33)16-20)19-40-30-34-18-29(37(30)22-10-8-21(31)9-11-22)36(3)23-12-13-27(38-4)28(17-23)39-5/h8-13,15-18H,14,19H2,1-5H3 VAEQURLTVRZWMG-UHFFFAOYSA-N 50266560 US10323016, Example 6::CHEMBL4104359 G-protein coupled bile acid receptor 1 Mus musculus 4.1 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266560 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266560&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118576999 404858041 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886604 COc1ccc(cc1OC)N(C)c1cnc(SCc2c(F)cc(cc2F)C#CC[N+](C)(C)C)n1-c1ccc(F)cc1 InChI=1S/C31H32F3N4O2S/c1-36(24-13-14-28(39-5)29(18-24)40-6)30-19-35-31(37(30)23-11-9-22(32)10-12-23)41-20-25-26(33)16-21(17-27(25)34)8-7-15-38(2,3)4/h9-14,16-19H,15,20H2,1-6H3/q+1 LZTYXNALZMPMDG-UHFFFAOYSA-N 50266561 CHEMBL4096633 G-protein coupled bile acid receptor 1 Mus musculus 17 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266561 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266561&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118577298 404858042 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886605 COc1ccc(cc1OC)N(C)c1cnc(SCc2c(F)cc(OCCC[N+]34CCN(CC3)CC4)cc2F)n1-c1ccc(F)cc1 InChI=1S/C34H39F3N5O3S/c1-39(26-9-10-31(43-2)32(19-26)44-3)33-22-38-34(41(33)25-7-5-24(35)6-8-25)46-23-28-29(36)20-27(21-30(28)37)45-18-4-14-42-15-11-40(12-16-42)13-17-42/h5-10,19-22H,4,11-18,23H2,1-3H3/q+1 RMXSSKGSTYUERI-UHFFFAOYSA-N 50266545 CHEMBL4078612 G-protein coupled bile acid receptor 1 Mus musculus 9.8 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266545 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266545&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118576918 404858035 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886606 COc1ccc(cc1OC)N(C)c1cnc(SCc2c(F)cc(OCCCS(O)(=O)=O)cc2F)n1-c1ccc(F)cc1 InChI=1S/C28H28F3N3O6S2/c1-33(20-9-10-25(38-2)26(13-20)39-3)27-16-32-28(34(27)19-7-5-18(29)6-8-19)41-17-22-23(30)14-21(15-24(22)31)40-11-4-12-42(35,36)37/h5-10,13-16H,4,11-12,17H2,1-3H3,(H,35,36,37) AUGWFSKMKLCJIL-UHFFFAOYSA-N 50266544 CHEMBL4060410 G-protein coupled bile acid receptor 1 Mus musculus 0.400000 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266544 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266544&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118577239 404858034 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886607 COc1ccc(cc1OC)N(C)c1c(C)nc(SCc2c(F)cccc2F)n1-c1ccc(F)cc1 InChI=1S/C26H24F3N3O2S/c1-16-25(31(2)19-12-13-23(33-3)24(14-19)34-4)32(18-10-8-17(27)9-11-18)26(30-16)35-15-20-21(28)6-5-7-22(20)29/h5-14H,15H2,1-4H3 PODBKRLJPSUMHY-UHFFFAOYSA-N 50266543 CHEMBL4080290 G-protein coupled bile acid receptor 1 Mus musculus 7.0 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266543 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266543&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 126673445 404858033 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886608 COc1ccc(cc1OC)N(C)c1c(CCCCN)nc(SCc2c(F)cccc2F)n1-c1ccc(F)cc1 InChI=1S/C29H31F3N4O2S/c1-35(21-14-15-26(37-2)27(17-21)38-3)28-25(9-4-5-16-33)34-29(36(28)20-12-10-19(30)11-13-20)39-18-22-23(31)7-6-8-24(22)32/h6-8,10-15,17H,4-5,9,16,18,33H2,1-3H3 JAHODMSQJJFAQW-UHFFFAOYSA-N 50266542 CHEMBL4098315 G-protein coupled bile acid receptor 1 Mus musculus 119 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266542 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266542&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 126673464 404858032 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886609 COC(=O)CCc1nc(SCc2c(F)cccc2F)n(c1N(C)c1ccc(OC)c(OC)c1)-c1ccc(F)cc1 InChI=1S/C29H28F3N3O4S/c1-34(20-12-14-25(37-2)26(16-20)38-3)28-24(13-15-27(36)39-4)33-29(35(28)19-10-8-18(30)9-11-19)40-17-21-22(31)6-5-7-23(21)32/h5-12,14,16H,13,15,17H2,1-4H3 GYOAXIGPIFOLQA-UHFFFAOYSA-N 50266541 CHEMBL4069569 G-protein coupled bile acid receptor 1 Mus musculus 82 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266541 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266541&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 126673489 404858031 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886610 COc1ccc(cc1OC)N(C)c1c(CCCC[N+](C)(C)C)nc(SCc2c(F)cccc2F)n1-c1ccc(F)cc1 InChI=1S/C32H38F3N4O2S/c1-37(24-17-18-29(40-5)30(20-24)41-6)31-28(12-7-8-19-39(2,3)4)36-32(38(31)23-15-13-22(33)14-16-23)42-21-25-26(34)10-9-11-27(25)35/h9-11,13-18,20H,7-8,12,19,21H2,1-6H3/q+1 QNRQNFAYVDHFEV-UHFFFAOYSA-N 50266562 CHEMBL4068186 G-protein coupled bile acid receptor 1 Mus musculus 254 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266562 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266562&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 137630592 404858043 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886611 COc1ccc(cc1OC)N(C)c1cnc(SCc2c(F)cc(cc2F)C#CC[N+](C)(C)C)n1-c1ccc(F)cc1 InChI=1S/C31H32F3N4O2S/c1-36(24-13-14-28(39-5)29(18-24)40-6)30-19-35-31(37(30)23-11-9-22(32)10-12-23)41-20-25-26(33)16-21(17-27(25)34)8-7-15-38(2,3)4/h9-14,16-19H,15,20H2,1-6H3/q+1 LZTYXNALZMPMDG-UHFFFAOYSA-N 50266561 CHEMBL4096633 G-protein coupled bile acid receptor 1 Homo sapiens 260 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266561 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266561&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118577298 404858042 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50886612 COc1ccc(cc1OC)N(C)c1cnc(SCc2c(F)cc(cc2F)C#CC[N+](C)(C)C)n1-c1ccc(F)cc1 InChI=1S/C31H32F3N4O2S/c1-36(24-13-14-28(39-5)29(18-24)40-6)30-19-35-31(37(30)23-11-9-22(32)10-12-23)41-20-25-26(33)16-21(17-27(25)34)8-7-15-38(2,3)4/h9-14,16-19H,15,20H2,1-6H3/q+1 LZTYXNALZMPMDG-UHFFFAOYSA-N 50266563 CHEMBL4086463 G-protein coupled bile acid receptor 1 Homo sapiens 177 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266563 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266563&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118577298 404858044 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50886613 COc1ccc(cc1OC)N(C)c1cnc(SCc2c(F)cc(cc2F)C#CCN(C)C)n1-c1ccc(F)cc1 InChI=1S/C30H29F3N4O2S/c1-35(2)14-6-7-20-15-25(32)24(26(33)16-20)19-40-30-34-18-29(37(30)22-10-8-21(31)9-11-22)36(3)23-12-13-27(38-4)28(17-23)39-5/h8-13,15-18H,14,19H2,1-5H3 VAEQURLTVRZWMG-UHFFFAOYSA-N 50266560 US10323016, Example 6::CHEMBL4104359 G-protein coupled bile acid receptor 1 Homo sapiens 71 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266560 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266560&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118576999 404858041 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50886614 COc1ccc(cc1OC)N(CC=C)c1cnc(SCc2c(F)cccc2F)n1-c1ccc(F)cc1 InChI=1S/C27H24F3N3O2S/c1-4-14-32(20-12-13-24(34-2)25(15-20)35-3)26-16-31-27(33(26)19-10-8-18(28)9-11-19)36-17-21-22(29)6-5-7-23(21)30/h4-13,15-16H,1,14,17H2,2-3H3 BILPIGWTPHZTBL-UHFFFAOYSA-N 50266564 CHEMBL4081050 G-protein coupled bile acid receptor 1 Homo sapiens 86 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266564 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266564&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 126673504 404858045 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50886615 COc1ccc(CN(C)c2cnc(SCc3c(F)cccc3F)n2-c2ccc(F)cc2)cc1OC InChI=1S/C26H24F3N3O2S/c1-31(15-17-7-12-23(33-2)24(13-17)34-3)25-14-30-26(32(25)19-10-8-18(27)9-11-19)35-16-20-21(28)5-4-6-22(20)29/h4-14H,15-16H2,1-3H3 QQJLRZZJOUTJSL-UHFFFAOYSA-N 50266559 CHEMBL4067717 G-protein coupled bile acid receptor 1 Homo sapiens 326 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266559 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266559&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 126700765 404858040 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50886616 CN(c1cnc(SCc2c(F)cccc2F)n1-c1ccc(F)cc1)c1ccc(Cl)c(Cl)c1 InChI=1S/C23H16Cl2F3N3S/c1-30(16-9-10-18(24)19(25)11-16)22-12-29-23(31(22)15-7-5-14(26)6-8-15)32-13-17-20(27)3-2-4-21(17)28/h2-12H,13H2,1H3 OTECHJIJAUHLNR-UHFFFAOYSA-N 50266558 US10323016, Example 18::CHEMBL4088938 G-protein coupled bile acid receptor 1 Homo sapiens 750 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266558 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266558&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118586280 404858039 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50886617 COc1cccc(c1)N(C)c1cnc(SCc2c(F)cccc2F)n1-c1ccc(F)cc1 InChI=1S/C24H20F3N3OS/c1-29(18-5-3-6-19(13-18)31-2)23-14-28-24(30(23)17-11-9-16(25)10-12-17)32-15-20-21(26)7-4-8-22(20)27/h3-14H,15H2,1-2H3 FOQHSUBQNPOLDN-UHFFFAOYSA-N 50266557 US10323016, Example 16::CHEMBL4063932 G-protein coupled bile acid receptor 1 Homo sapiens 994 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266557 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266557&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118586276 404858038 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50886618 COc1ccc(cc1)N(C)c1cnc(SCc2c(F)cccc2F)n1-c1ccc(F)cc1 InChI=1S/C24H20F3N3OS/c1-29(17-10-12-19(31-2)13-11-17)23-14-28-24(30(23)18-8-6-16(25)7-9-18)32-15-20-21(26)4-3-5-22(20)27/h3-14H,15H2,1-2H3 UZNTUTSDOWWOIL-UHFFFAOYSA-N 50266565 US10323016, Example 17::CHEMBL4091702 G-protein coupled bile acid receptor 1 Homo sapiens 1106 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266565 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266565&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118586281 404858046 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50886619 COc1cc(ccc1Cl)N(C)c1cnc(SCc2c(F)cccc2F)n1-c1ccc(F)cc1 InChI=1S/C24H19ClF3N3OS/c1-30(17-10-11-19(25)22(12-17)32-2)23-13-29-24(31(23)16-8-6-15(26)7-9-16)33-14-18-20(27)4-3-5-21(18)28/h3-13H,14H2,1-2H3 IFIJPYCPQQHJTC-UHFFFAOYSA-N 50266556 US10323016, Example 5::CHEMBL4073081 G-protein coupled bile acid receptor 1 Homo sapiens 885 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266556 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266556&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118577011 404858037 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50886620 COc1cc(ccc1F)-n1c(SCc2c(F)cccc2F)ncc1N(C)c1ccc(OC)c(OC)c1 InChI=1S/C26H24F3N3O3S/c1-31(16-9-11-22(33-2)24(12-16)35-4)25-14-30-26(36-15-18-19(27)6-5-7-20(18)28)32(25)17-8-10-21(29)23(13-17)34-3/h5-14H,15H2,1-4H3 CWJPFQTWSDPZOY-UHFFFAOYSA-N 50266552 US10323016, Example 20::CHEMBL4094487 G-protein coupled bile acid receptor 1 Homo sapiens 20 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266552 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266552&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118576930 404858036 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50886621 COc1ccc(cc1OC)N(C)c1cnc(SCc2c(F)cccc2F)n1-c1ccc(F)cc1F |(12.49,-10.11,;13.96,-9.63,;15.09,-10.67,;16.56,-10.2,;17.7,-11.23,;17.37,-12.73,;15.91,-13.21,;14.77,-12.18,;13.31,-12.65,;12.99,-14.15,;18.51,-13.76,;18.18,-15.27,;19.97,-13.3,;20.45,-11.83,;21.99,-11.84,;22.46,-13.31,;23.94,-13.8,;25.03,-12.71,;26.51,-13.15,;26.88,-14.63,;25.79,-15.72,;28.37,-15.07,;29.48,-14,;29.1,-12.5,;27.63,-12.08,;27.26,-10.58,;21.21,-14.21,;21.21,-15.75,;19.87,-16.51,;19.86,-18.05,;21.19,-18.83,;21.18,-20.37,;22.53,-18.06,;22.53,-16.52,;23.87,-15.76,)| InChI=1S/C25H21F4N3O2S/c1-31(16-8-10-22(33-2)23(12-16)34-3)24-13-30-25(32(24)21-9-7-15(26)11-20(21)29)35-14-17-18(27)5-4-6-19(17)28/h4-13H,14H2,1-3H3 ZAMHKBLMSOWWNH-UHFFFAOYSA-N 50266566 US10323016, Example 19::CHEMBL4068227 G-protein coupled bile acid receptor 1 Homo sapiens 47 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266566 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266566&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118586284 404858047 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50886622 COc1ccc(cc1OC)N(C)c1cnc(SCc2c(F)cccc2F)n1-c1ccc(F)c(Cl)c1 InChI=1S/C25H21ClF3N3O2S/c1-31(15-8-10-22(33-2)23(12-15)34-3)24-13-30-25(32(24)16-7-9-21(29)18(26)11-16)35-14-17-19(27)5-4-6-20(17)28/h4-13H,14H2,1-3H3 KMVFKKSWUDYTDB-UHFFFAOYSA-N 50266567 US10323016, Example 21::CHEMBL4090147 G-protein coupled bile acid receptor 1 Homo sapiens 35 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266567 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266567&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118576958 404858048 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50886623 COc1ccc(cc1OC)N(C)c1cnc(SCc2c(F)cccc2F)n1-c1ccc(F)c(Cl)c1 InChI=1S/C25H21ClF3N3O2S/c1-31(15-8-10-22(33-2)23(12-15)34-3)24-13-30-25(32(24)16-7-9-21(29)18(26)11-16)35-14-17-19(27)5-4-6-20(17)28/h4-13H,14H2,1-3H3 KMVFKKSWUDYTDB-UHFFFAOYSA-N 50266567 US10323016, Example 21::CHEMBL4090147 G-protein coupled bile acid receptor 1 Mus musculus 2.0 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266567 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266567&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118576958 404858048 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886624 COc1ccc(cc1OC)N(C)c1cnc(SCc2c(F)cccc2F)n1-c1ccc(cc1)C(F)(F)F InChI=1S/C26H22F5N3O2S/c1-33(18-11-12-22(35-2)23(13-18)36-3)24-14-32-25(37-15-19-20(27)5-4-6-21(19)28)34(24)17-9-7-16(8-10-17)26(29,30)31/h4-14H,15H2,1-3H3 YTYJFQFVEOIIKC-UHFFFAOYSA-N 50266572 US10323016, Example 15::CHEMBL4060122 G-protein coupled bile acid receptor 1 Mus musculus 366 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266572 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266572&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118586279 404858049 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886625 COc1ccc(cc1OC)N(C)c1cnc(SCc2c(F)cccc2F)n1-c1ccccc1 InChI=1S/C25H23F2N3O2S/c1-29(18-12-13-22(31-2)23(14-18)32-3)24-15-28-25(30(24)17-8-5-4-6-9-17)33-16-19-20(26)10-7-11-21(19)27/h4-15H,16H2,1-3H3 YCQSXPGNRWLUMG-UHFFFAOYSA-N 50266573 US10323016, Example 13::CHEMBL4104779 G-protein coupled bile acid receptor 1 Mus musculus 5.1 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266573 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266573&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118586278 404858050 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886626 COc1ccc(cc1OC)N(C)c1cnc(SCc2c(C)cccc2C)n1-c1ccc(F)cc1 InChI=1S/C27H28FN3O2S/c1-18-7-6-8-19(2)23(18)17-34-27-29-16-26(31(27)21-11-9-20(28)10-12-21)30(3)22-13-14-24(32-4)25(15-22)33-5/h6-16H,17H2,1-5H3 WJRHPAULQVASLE-UHFFFAOYSA-N 50266574 US10323016, Example 2::CHEMBL4081298 G-protein coupled bile acid receptor 1 Mus musculus 41 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266574 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266574&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118576916 404858051 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886627 COc1ccc(cc1OC)N(C)c1cnc(SCc2c(F)cccc2F)n1-c1ccc(cc1)C(F)(F)F InChI=1S/C26H22F5N3O2S/c1-33(18-11-12-22(35-2)23(13-18)36-3)24-14-32-25(37-15-19-20(27)5-4-6-21(19)28)34(24)17-9-7-16(8-10-17)26(29,30)31/h4-14H,15H2,1-3H3 YTYJFQFVEOIIKC-UHFFFAOYSA-N 50266572 US10323016, Example 15::CHEMBL4060122 G-protein coupled bile acid receptor 1 Homo sapiens 900 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266572 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266572&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118586279 404858049 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50886628 COc1ccc(cc1)-n1c(SCc2c(F)cccc2F)ncc1N(C)c1ccc(OC)c(OC)c1 InChI=1S/C26H25F2N3O3S/c1-30(18-10-13-23(33-3)24(14-18)34-4)25-15-29-26(31(25)17-8-11-19(32-2)12-9-17)35-16-20-21(27)6-5-7-22(20)28/h5-15H,16H2,1-4H3 JCKNYVPCZLTWCY-UHFFFAOYSA-N 50266575 US10323016, Example 14::CHEMBL4085777 G-protein coupled bile acid receptor 1 Homo sapiens 7745 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266575 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266575&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118577093 404858052 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50886629 COc1ccc(cc1OC)N(C)c1cnc(SCc2c(F)cccc2F)n1-c1ccccc1 InChI=1S/C25H23F2N3O2S/c1-29(18-12-13-22(31-2)23(14-18)32-3)24-15-28-25(30(24)17-8-5-4-6-9-17)33-16-19-20(26)10-7-11-21(19)27/h4-15H,16H2,1-3H3 YCQSXPGNRWLUMG-UHFFFAOYSA-N 50266573 US10323016, Example 13::CHEMBL4104779 G-protein coupled bile acid receptor 1 Homo sapiens 254 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266573 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266573&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118586278 404858050 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50886630 COc1ccc(cc1OC)N(C)c1cnc(SCc2c(C)cccc2C)n1-c1ccc(F)cc1 InChI=1S/C27H28FN3O2S/c1-18-7-6-8-19(2)23(18)17-34-27-29-16-26(31(27)21-11-9-20(28)10-12-21)30(3)22-13-14-24(32-4)25(15-22)33-5/h6-16H,17H2,1-5H3 WJRHPAULQVASLE-UHFFFAOYSA-N 50266574 US10323016, Example 2::CHEMBL4081298 G-protein coupled bile acid receptor 1 Homo sapiens 299 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266574 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266574&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118576916 404858051 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50886631 COc1ccc(cc1OC)N(C)c1cnc(SCc2ccccc2)n1-c1ccc(F)cc1 InChI=1S/C25H24FN3O2S/c1-28(21-13-14-22(30-2)23(15-21)31-3)24-16-27-25(32-17-18-7-5-4-6-8-18)29(24)20-11-9-19(26)10-12-20/h4-16H,17H2,1-3H3 FSKBDQOKJRCKGZ-UHFFFAOYSA-N 50266536 US10323016, Example 1::CHEMBL4085664 G-protein coupled bile acid receptor 1 Homo sapiens 156 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266536 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266536&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118586298 404858027 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50886632 COc1ccc(cc1OC)N(C)c1cnc(SCc2ccccc2F)n1-c1ccc(F)cc1 InChI=1S/C25H23F2N3O2S/c1-29(20-12-13-22(31-2)23(14-20)32-3)24-15-28-25(30(24)19-10-8-18(26)9-11-19)33-16-17-6-4-5-7-21(17)27/h4-15H,16H2,1-3H3 FGPFAMGSKPYXBQ-UHFFFAOYSA-N 50266537 US10323016, Example 3::CHEMBL4075688 G-protein coupled bile acid receptor 1 Homo sapiens 128 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266537 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266537&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118576974 404858028 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50886633 COc1ccc(cc1OC)N(C)c1cnc(SCc2c(F)cccc2F)n1-c1ccc(F)cc1 InChI=1S/C25H22F3N3O2S/c1-30(18-11-12-22(32-2)23(13-18)33-3)24-14-29-25(31(24)17-9-7-16(26)8-10-17)34-15-19-20(27)5-4-6-21(19)28/h4-14H,15H2,1-3H3 DEBXSGITWCYLOY-UHFFFAOYSA-N 50266538 US10323016, Example 4::CHEMBL4084668 G-protein coupled bile acid receptor 1 Homo sapiens 35 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266538 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266538&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118576935 404858029 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50886634 COc1ccc(Nc2nnc(SCc3c(F)cccc3F)n2-c2ccc(F)cc2)cc1OC InChI=1S/C23H19F3N4O2S/c1-31-20-11-8-15(12-21(20)32-2)27-22-28-29-23(30(22)16-9-6-14(24)7-10-16)33-13-17-18(25)4-3-5-19(17)26/h3-12H,13H2,1-2H3,(H,27,28) ABQUGNJECWNJQN-UHFFFAOYSA-N 50266579 CHEMBL4074376 G-protein coupled bile acid receptor 1 Homo sapiens >10000 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266579 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266579&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118586274 404858053 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50886635 COc1ccc(cc1OC)N(C)c1nnc(SCc2c(F)cccc2F)n1-c1ccc(F)cc1 InChI=1S/C24H21F3N4O2S/c1-30(17-11-12-21(32-2)22(13-17)33-3)23-28-29-24(31(23)16-9-7-15(25)8-10-16)34-14-18-19(26)5-4-6-20(18)27/h4-13H,14H2,1-3H3 IBAUFLYJKHGLLI-UHFFFAOYSA-N 50266540 US10323016, Example 12::CHEMBL4102610 G-protein coupled bile acid receptor 1 Homo sapiens 4300 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266540 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266540&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118586282 404858030 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50886636 COc1ccc(cc1OC)N(C)c1cnc(SCc2c(F)cccc2F)n1-c1ccc(F)cc1F |(12.49,-10.11,;13.96,-9.63,;15.09,-10.67,;16.56,-10.2,;17.7,-11.23,;17.37,-12.73,;15.91,-13.21,;14.77,-12.18,;13.31,-12.65,;12.99,-14.15,;18.51,-13.76,;18.18,-15.27,;19.97,-13.3,;20.45,-11.83,;21.99,-11.84,;22.46,-13.31,;23.94,-13.8,;25.03,-12.71,;26.51,-13.15,;26.88,-14.63,;25.79,-15.72,;28.37,-15.07,;29.48,-14,;29.1,-12.5,;27.63,-12.08,;27.26,-10.58,;21.21,-14.21,;21.21,-15.75,;19.87,-16.51,;19.86,-18.05,;21.19,-18.83,;21.18,-20.37,;22.53,-18.06,;22.53,-16.52,;23.87,-15.76,)| InChI=1S/C25H21F4N3O2S/c1-31(16-8-10-22(33-2)23(12-16)34-3)24-13-30-25(32(24)21-9-7-15(26)11-20(21)29)35-14-17-18(27)5-4-6-19(17)28/h4-13H,14H2,1-3H3 ZAMHKBLMSOWWNH-UHFFFAOYSA-N 50266566 US10323016, Example 19::CHEMBL4068227 G-protein coupled bile acid receptor 1 Mus musculus 4.8 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266566 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266566&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118586284 404858047 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886637 COc1ccc(cc1)-n1c(SCc2c(F)cccc2F)ncc1N(C)c1ccc(OC)c(OC)c1 InChI=1S/C26H25F2N3O3S/c1-30(18-10-13-23(33-3)24(14-18)34-4)25-15-29-26(31(25)17-8-11-19(32-2)12-9-17)35-16-20-21(27)6-5-7-22(20)28/h5-15H,16H2,1-4H3 JCKNYVPCZLTWCY-UHFFFAOYSA-N 50266575 US10323016, Example 14::CHEMBL4085777 G-protein coupled bile acid receptor 1 Mus musculus 939 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266575 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266575&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118577093 404858052 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886638 COc1ccc(Nc2nnc(SCc3c(F)cccc3F)n2-c2ccc(F)cc2)cc1OC InChI=1S/C23H19F3N4O2S/c1-31-20-11-8-15(12-21(20)32-2)27-22-28-29-23(30(22)16-9-6-14(24)7-10-16)33-13-17-18(25)4-3-5-19(17)26/h3-12H,13H2,1-2H3,(H,27,28) ABQUGNJECWNJQN-UHFFFAOYSA-N 50266579 CHEMBL4074376 G-protein coupled bile acid receptor 1 Mus musculus >10000 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266579 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266579&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118586274 404858053 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886639 COc1ccc(cc1OC)N(C)c1cnc(SCc2c(F)cc(OCCCN(CCS(O)(=O)=O)CCS(O)(=O)=O)cc2F)n1-c1ccc(F)cc1 InChI=1S/C32H37F3N4O9S3/c1-37(24-9-10-29(46-2)30(17-24)47-3)31-20-36-32(39(31)23-7-5-22(33)6-8-23)49-21-26-27(34)18-25(19-28(26)35)48-14-4-11-38(12-15-50(40,41)42)13-16-51(43,44)45/h5-10,17-20H,4,11-16,21H2,1-3H3,(H,40,41,42)(H,43,44,45) OLYFOLUROBNZLJ-UHFFFAOYSA-N 50266580 CHEMBL4087611 G-protein coupled bile acid receptor 1 Homo sapiens 77 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266580 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266580&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 126673452 404858054 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50886640 COc1ccc(cc1)N(C)c1cnc(SCc2c(F)cccc2F)n1-c1ccc(F)cc1 InChI=1S/C24H20F3N3OS/c1-29(17-10-12-19(31-2)13-11-17)23-14-28-24(30(23)18-8-6-16(25)7-9-18)32-15-20-21(26)4-3-5-22(20)27/h3-14H,15H2,1-2H3 UZNTUTSDOWWOIL-UHFFFAOYSA-N 50266565 US10323016, Example 17::CHEMBL4091702 G-protein coupled bile acid receptor 1 Mus musculus 141 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266565 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266565&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118586281 404858046 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886641 COc1ccc(cc1OC)N(CC=C)c1cnc(SCc2c(F)cccc2F)n1-c1ccc(F)cc1 InChI=1S/C27H24F3N3O2S/c1-4-14-32(20-12-13-24(34-2)25(15-20)35-3)26-16-31-27(33(26)19-10-8-18(28)9-11-19)36-17-21-22(29)6-5-7-23(21)30/h4-13,15-16H,1,14,17H2,2-3H3 BILPIGWTPHZTBL-UHFFFAOYSA-N 50266564 CHEMBL4081050 G-protein coupled bile acid receptor 1 Mus musculus 7.7 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266564 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266564&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 126673504 404858045 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886642 COc1ccc(cc1OC)N(C)c1cnc(SCc2c(F)cc(cc2F)C#CC[N+](C)(C)C)n1-c1ccc(F)cc1 InChI=1S/C31H32F3N4O2S/c1-36(24-13-14-28(39-5)29(18-24)40-6)30-19-35-31(37(30)23-11-9-22(32)10-12-23)41-20-25-26(33)16-21(17-27(25)34)8-7-15-38(2,3)4/h9-14,16-19H,15,20H2,1-6H3/q+1 LZTYXNALZMPMDG-UHFFFAOYSA-N 50266563 CHEMBL4086463 G-protein coupled bile acid receptor 1 Mus musculus 7.5 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266563 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266563&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 118577298 404858044 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886643 COc1ccc(cc1OC)N(C)c1cnc(SCc2c(F)cc(OCCCN(CCS(O)(=O)=O)CCS(O)(=O)=O)cc2F)n1-c1ccc(F)cc1 InChI=1S/C32H37F3N4O9S3/c1-37(24-9-10-29(46-2)30(17-24)47-3)31-20-36-32(39(31)23-7-5-22(33)6-8-23)49-21-26-27(34)18-25(19-28(26)35)48-14-4-11-38(12-15-50(40,41)42)13-16-51(43,44)45/h5-10,17-20H,4,11-16,21H2,1-3H3,(H,40,41,42)(H,43,44,45) OLYFOLUROBNZLJ-UHFFFAOYSA-N 50266580 CHEMBL4087611 G-protein coupled bile acid receptor 1 Mus musculus 0.300000 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266580 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266580&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 126673452 404858054 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886644 COc1ccc(cc1OC)N(C)c1c(CCC(O)=O)nc(SCc2c(F)cccc2F)n1-c1ccc(F)cc1 InChI=1S/C28H26F3N3O4S/c1-33(19-11-13-24(37-2)25(15-19)38-3)27-23(12-14-26(35)36)32-28(34(27)18-9-7-17(29)8-10-18)39-16-20-21(30)5-4-6-22(20)31/h4-11,13,15H,12,14,16H2,1-3H3,(H,35,36) NLFAQCWDVWTFLW-UHFFFAOYSA-N 50266581 CHEMBL4090586 G-protein coupled bile acid receptor 1 Mus musculus 1935 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266581 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266581&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 126700763 404858055 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50886645 CCn1c2nnc(SCc3ccc(cc3)C(F)(F)F)n2c2ccccc2c1=O InChI=1S/C19H15F3N4OS/c1-2-25-16(27)14-5-3-4-6-15(14)26-17(25)23-24-18(26)28-11-12-7-9-13(10-8-12)19(20,21)22/h3-10H,2,11H2,1H3 OFUZHYLZBLDDHQ-UHFFFAOYSA-N 50266535 CHEMBL4082345 G-protein coupled bile acid receptor 1 Homo sapiens 1310 ChEMBL 10.1021/acs.jmedchem.6b01873 10.7270/Q21838ZP 28414465 Lasalle, M; Hoguet, V; Hennuyer, N; Leroux, F; Piveteau, C; Belloy, L; Lestavel, S; Vallez, E; Dorchies, E; Duplan, I; Sevin, E; Culot, M; Gosselet, F; Boulahjar, R; Herledan, A; Staels, B; Deprez, B; Tailleux, A; Charton, J 5/25/2017 2/17/2020 Universities of Lille http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50266535 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50266535&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 1434463 104113864 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35