BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
50678461	Cc1cccc(OCCC2CCOC3(CCN(Cc4ccc(COc5ccc(CCC(O)=O)cc5)cc4)CC3)C2)n1	InChI=1S/C34H42N2O5/c1-26-3-2-4-32(35-26)39-21-15-28-16-22-41-34(23-28)17-19-36(20-18-34)24-29-5-7-30(8-6-29)25-40-31-12-9-27(10-13-31)11-14-33(37)38/h2-10,12-13,28H,11,14-25H2,1H3,(H,37,38)	SNFYYQJIUQTXFB-UHFFFAOYSA-N	50230295	CHEMBL4098843	Free fatty acid receptor 4	Homo sapiens				>10000					ChEMBL	10.1016/j.ejmech.2017.01.005	10.7270/Q2DZ0BJ9	28076825			Krasavin, M; Lukin, A; Bagnyukova, D; Zhurilo, N; Golovanov, A; Zozulya, S; Zahanich, I; Moore, D; Tikhonova, IG	2/15/2017	4/29/2019	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50230295	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003696&target=Free+fatty+acid+receptor+4&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50230295&enzyme=Free+fatty+acid+receptor+4&column=ki&startPg=0&Increment=50&submit=Search			137630491	383543001		CHEMBL4098843					1	MSPECARAAGDAPLRSLEQANRTRFPFFSDVKGDHRLVLAAVETTVLVLIFAVSLLGNVCALVLVARRRRRGATACLVLNLFCADLLFISAIPLVLAVRWTEAWLLGPVACHLLFYVMTLSGSVTILTLAAVSLERMVCIVHLQRGVRGPGRRARAVLLALIWGYSAVAALPLCVFFRVVPQRLPGADQEISICTLIWPTIPGEISWDVSFVTLNFLVPGLVIVISYSKILQTSEHLLDARAVVTHSEITKASRKRLTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIMWSPIIITILLILIQNFKQDLVIWPSLFFWVVAFTFANSALNPILYNMTLCRNEWKKIFCCFWFPEKGAILTDTSVKRNDLSIISG	8IYS,8ID9,8ID8,8ID6,8ID4,8ID3,8H4L,8H4K,8H4I,8G59,8T3Q,8T3O	Free fatty acid receptor 4	FFAR4_HUMAN	Q5NUL3	Q495H1 Q5VY25 Q5VY26 Q7Z605 Q86SM7																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50678462	OC(=O)CCc1ccc(OCc2ccc(CN3CCC4(CC3)CC(CCOc3ncccn3)CCO4)cc2)cc1	InChI=1S/C32H39N3O5/c36-30(37)11-8-25-6-9-29(10-7-25)39-24-28-4-2-27(3-5-28)23-35-18-14-32(15-19-35)22-26(13-21-40-32)12-20-38-31-33-16-1-17-34-31/h1-7,9-10,16-17,26H,8,11-15,18-24H2,(H,36,37)	ALAVTAGPRISCTR-UHFFFAOYSA-N	50230296	CHEMBL4093571	Free fatty acid receptor 1	Homo sapiens				 3870					ChEMBL	10.1016/j.ejmech.2017.01.005	10.7270/Q2DZ0BJ9	28076825			Krasavin, M; Lukin, A; Bagnyukova, D; Zhurilo, N; Golovanov, A; Zozulya, S; Zahanich, I; Moore, D; Tikhonova, IG	2/15/2017	4/29/2019	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50230296	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50230296&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			137629794	383543002		CHEMBL4093571					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50678463	Cc1cccc(OCCC2CCOC3(CCN(Cc4ccc(COc5ccc(CCC(O)=O)cc5)cc4)CC3)C2)n1	InChI=1S/C34H42N2O5/c1-26-3-2-4-32(35-26)39-21-15-28-16-22-41-34(23-28)17-19-36(20-18-34)24-29-5-7-30(8-6-29)25-40-31-12-9-27(10-13-31)11-14-33(37)38/h2-10,12-13,28H,11,14-25H2,1H3,(H,37,38)	SNFYYQJIUQTXFB-UHFFFAOYSA-N	50230295	CHEMBL4098843	Free fatty acid receptor 1	Homo sapiens				 260					ChEMBL	10.1016/j.ejmech.2017.01.005	10.7270/Q2DZ0BJ9	28076825			Krasavin, M; Lukin, A; Bagnyukova, D; Zhurilo, N; Golovanov, A; Zozulya, S; Zahanich, I; Moore, D; Tikhonova, IG	2/15/2017	4/29/2019	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50230295	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50230295&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			137630491	383543001		CHEMBL4098843					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50678464	OC(=O)CCc1ccc(OCc2ccc(CN3CCC4(CC3)CC(CCOc3nc(nc5CCCc35)C3CC3)CCO4)cc2)cc1	InChI=1S/C38H47N3O5/c42-35(43)15-10-27-8-13-32(14-9-27)45-26-30-6-4-29(5-7-30)25-41-20-18-38(19-21-41)24-28(17-23-46-38)16-22-44-37-33-2-1-3-34(33)39-36(40-37)31-11-12-31/h4-9,13-14,28,31H,1-3,10-12,15-26H2,(H,42,43)	YOSMYHSILQJIEY-UHFFFAOYSA-N	50230297	CHEMBL4091100	Free fatty acid receptor 1	Homo sapiens				 1210					ChEMBL	10.1016/j.ejmech.2017.01.005	10.7270/Q2DZ0BJ9	28076825			Krasavin, M; Lukin, A; Bagnyukova, D; Zhurilo, N; Golovanov, A; Zozulya, S; Zahanich, I; Moore, D; Tikhonova, IG	2/15/2017	4/29/2019	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50230297	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50230297&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			137642174	383543003		CHEMBL4091100					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50678465	OC(=O)CCc1ccc(OCc2ccc(CN3CCC4(CC3)CC(CCOc3cnccn3)CCO4)cc2)cc1	InChI=1S/C32H39N3O5/c36-31(37)10-7-25-5-8-29(9-6-25)39-24-28-3-1-27(2-4-28)23-35-17-13-32(14-18-35)21-26(12-20-40-32)11-19-38-30-22-33-15-16-34-30/h1-6,8-9,15-16,22,26H,7,10-14,17-21,23-24H2,(H,36,37)	BTFATDODRIYJNU-UHFFFAOYSA-N	50230298	CHEMBL4063221	Free fatty acid receptor 1	Homo sapiens				 1480					ChEMBL	10.1016/j.ejmech.2017.01.005	10.7270/Q2DZ0BJ9	28076825			Krasavin, M; Lukin, A; Bagnyukova, D; Zhurilo, N; Golovanov, A; Zozulya, S; Zahanich, I; Moore, D; Tikhonova, IG	2/15/2017	4/29/2019	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50230298	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50230298&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			137629795	383543004		CHEMBL4063221					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50678466	OC(=O)CCc1ccc(OCc2ccc(CN3CCC4(CC3)CC(CCOc3ncnc5CCCc35)CCO4)cc2)cc1	InChI=1S/C35H43N3O5/c39-33(40)13-10-26-8-11-30(12-9-26)42-24-29-6-4-28(5-7-29)23-38-18-16-35(17-19-38)22-27(15-21-43-35)14-20-41-34-31-2-1-3-32(31)36-25-37-34/h4-9,11-12,25,27H,1-3,10,13-24H2,(H,39,40)	MLSIFMXYBYZSRV-UHFFFAOYSA-N	50230299	CHEMBL4063785	Free fatty acid receptor 1	Homo sapiens				 1260					ChEMBL	10.1016/j.ejmech.2017.01.005	10.7270/Q2DZ0BJ9	28076825			Krasavin, M; Lukin, A; Bagnyukova, D; Zhurilo, N; Golovanov, A; Zozulya, S; Zahanich, I; Moore, D; Tikhonova, IG	2/15/2017	4/29/2019	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50230299	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50230299&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			137629014	383543005		CHEMBL4063785					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50678467	OC(=O)CCc1ccc(OCc2ccc(CN3CCC4(CC3)CC(CCOc3ccc5ccccc5n3)CCO4)cc2)cc1	InChI=1S/C37H42N2O5/c40-36(41)16-11-28-9-13-33(14-10-28)43-27-31-7-5-30(6-8-31)26-39-21-19-37(20-22-39)25-29(18-24-44-37)17-23-42-35-15-12-32-3-1-2-4-34(32)38-35/h1-10,12-15,29H,11,16-27H2,(H,40,41)	MIIUDIDUEQSLRL-UHFFFAOYSA-N	50230300	CHEMBL4101806	Free fatty acid receptor 1	Homo sapiens				 2360					ChEMBL	10.1016/j.ejmech.2017.01.005	10.7270/Q2DZ0BJ9	28076825			Krasavin, M; Lukin, A; Bagnyukova, D; Zhurilo, N; Golovanov, A; Zozulya, S; Zahanich, I; Moore, D; Tikhonova, IG	2/15/2017	4/29/2019	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50230300	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50230300&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			137628912	383543006		CHEMBL4101806					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50678468	OC(=O)CCc1ccc(OCc2ccc(CN3CCC4(CC3)CC(CCOc3ccc(cn3)C(F)(F)F)CCO4)cc2)cc1	InChI=1S/C34H39F3N2O5/c35-34(36,37)29-8-11-31(38-22-29)42-19-13-26-14-20-44-33(21-26)15-17-39(18-16-33)23-27-1-3-28(4-2-27)24-43-30-9-5-25(6-10-30)7-12-32(40)41/h1-6,8-11,22,26H,7,12-21,23-24H2,(H,40,41)	RSXZRIXOXJRLMZ-UHFFFAOYSA-N	50230301	CHEMBL4064196	Free fatty acid receptor 1	Homo sapiens				 33500					ChEMBL	10.1016/j.ejmech.2017.01.005	10.7270/Q2DZ0BJ9	28076825			Krasavin, M; Lukin, A; Bagnyukova, D; Zhurilo, N; Golovanov, A; Zozulya, S; Zahanich, I; Moore, D; Tikhonova, IG	2/15/2017	4/29/2019	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50230301	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50230301&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			137630696	383543007		CHEMBL4064196					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50678469	OC(=O)CCc1ccc(OCc2ccc(CN3CCC4(CC3)CC(CCOc3ccc(F)cc3)CCO4)cc2)cc1	InChI=1S/C34H40FNO5/c35-30-8-12-31(13-9-30)39-21-15-27-16-22-41-34(23-27)17-19-36(20-18-34)24-28-1-3-29(4-2-28)25-40-32-10-5-26(6-11-32)7-14-33(37)38/h1-6,8-13,27H,7,14-25H2,(H,37,38)	OLXINUSHEJKOLD-UHFFFAOYSA-N	50230302	CHEMBL4077784	Free fatty acid receptor 1	Homo sapiens				 2060					ChEMBL	10.1016/j.ejmech.2017.01.005	10.7270/Q2DZ0BJ9	28076825			Krasavin, M; Lukin, A; Bagnyukova, D; Zhurilo, N; Golovanov, A; Zozulya, S; Zahanich, I; Moore, D; Tikhonova, IG	2/15/2017	4/29/2019	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50230302	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50230302&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			137630008	383543008		CHEMBL4077784					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50678474	OC(=O)CCc1ccc(OCc2ccc(CN3CCC4(CCCCO4)CC3)cc2)cc1	InChI=1S/C26H33NO4/c28-25(29)12-9-21-7-10-24(11-8-21)30-20-23-5-3-22(4-6-23)19-27-16-14-26(15-17-27)13-1-2-18-31-26/h3-8,10-11H,1-2,9,12-20H2,(H,28,29)	JIVBMSPODOCBON-UHFFFAOYSA-N	50230303	CHEMBL3990703	Free fatty acid receptor 1	Homo sapiens				>20000					ChEMBL	10.1016/j.ejmech.2017.01.005	10.7270/Q2DZ0BJ9	28076825			Krasavin, M; Lukin, A; Bagnyukova, D; Zhurilo, N; Golovanov, A; Zozulya, S; Zahanich, I; Moore, D; Tikhonova, IG	2/15/2017	4/29/2019	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50230303	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50230303&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			134142025	383543009		CHEMBL3990703					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50678475	OC(=O)CCc1ccc(OCc2ccc(CN3CCC4(CC3)CC(CCOc3ccncc3)CCO4)cc2)cc1	InChI=1S/C33H40N2O5/c36-32(37)10-7-26-5-8-30(9-6-26)39-25-29-3-1-28(2-4-29)24-35-19-15-33(16-20-35)23-27(14-22-40-33)13-21-38-31-11-17-34-18-12-31/h1-6,8-9,11-12,17-18,27H,7,10,13-16,19-25H2,(H,36,37)	XJQLEJOCXKPFIG-UHFFFAOYSA-N	50230304	CHEMBL4101306	Free fatty acid receptor 1	Homo sapiens				 6100					ChEMBL	10.1016/j.ejmech.2017.01.005	10.7270/Q2DZ0BJ9	28076825			Krasavin, M; Lukin, A; Bagnyukova, D; Zhurilo, N; Golovanov, A; Zozulya, S; Zahanich, I; Moore, D; Tikhonova, IG	2/15/2017	4/29/2019	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50230304	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50230304&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			137629985	383543010		CHEMBL4101306					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50678476	Cc1cccc(OCCC2CCOC3(CCN(Cc4ccc(COc5ccc(CCC(O)=O)cc5)cc4)CC3)C2)n1	InChI=1S/C34H42N2O5/c1-26-3-2-4-32(35-26)39-21-15-28-16-22-41-34(23-28)17-19-36(20-18-34)24-29-5-7-30(8-6-29)25-40-31-12-9-27(10-13-31)11-14-33(37)38/h2-10,12-13,28H,11,14-25H2,1H3,(H,37,38)	SNFYYQJIUQTXFB-UHFFFAOYSA-N	50230295	CHEMBL4098843	Free fatty acid receptor 3	Homo sapiens				>10000					ChEMBL	10.1016/j.ejmech.2017.01.005	10.7270/Q2DZ0BJ9	28076825			Krasavin, M; Lukin, A; Bagnyukova, D; Zhurilo, N; Golovanov, A; Zozulya, S; Zahanich, I; Moore, D; Tikhonova, IG	2/15/2017	4/29/2019	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50230295	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003609&target=Free+fatty+acid+receptor+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50230295&enzyme=Free+fatty+acid+receptor+3&column=ki&startPg=0&Increment=50&submit=Search			137630491	383543001		CHEMBL4098843					1	MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLQRRPVAVDVLLLNLTASDLLLLLFLPFRMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHPLWYKTRPRLGQAGLVSVACWLLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFRKDQLAILLPVRLEMAVVLFVVPLIITSYCYSRLVWILGRGGSHRRQRRVAGLLAATLLNFLVCFGPYNVSHVVGYICGESPAWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES		Free fatty acid receptor 3	FFAR3_HUMAN	O14843	B2RWM8 Q14CM7																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50678477	Cc1cccc(OCCC2CCOC3(CCN(Cc4ccc(COc5ccc(CCC(O)=O)cc5)cc4)CC3)C2)n1	InChI=1S/C34H42N2O5/c1-26-3-2-4-32(35-26)39-21-15-28-16-22-41-34(23-28)17-19-36(20-18-34)24-29-5-7-30(8-6-29)25-40-31-12-9-27(10-13-31)11-14-33(37)38/h2-10,12-13,28H,11,14-25H2,1H3,(H,37,38)	SNFYYQJIUQTXFB-UHFFFAOYSA-N	50230295	CHEMBL4098843	Free fatty acid receptor 2	Homo sapiens				>10000					ChEMBL	10.1016/j.ejmech.2017.01.005	10.7270/Q2DZ0BJ9	28076825			Krasavin, M; Lukin, A; Bagnyukova, D; Zhurilo, N; Golovanov, A; Zozulya, S; Zahanich, I; Moore, D; Tikhonova, IG	2/15/2017	4/29/2019	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50230295	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003610&target=Free+fatty+acid+receptor+2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50230295&enzyme=Free+fatty+acid+receptor+2&column=ki&startPg=0&Increment=50&submit=Search			137630491	383543001		CHEMBL4098843					1	MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLLLLPFKIIEAASNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLSRRPLYGVIAALVAWVMSFGHCTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVRLELCLVLFFIPMAVTIFCYWRFVWIMLSQPLVGAQRRRRAVGLAVVTLLNFLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE	9NS9,9CM7,9CM3,9CLW,9K1D,8Y6W,8T3S,8Y6Y	Free fatty acid receptor 2	FFAR2_HUMAN	O15552	B0M0J9 Q4VAZ3 Q4VAZ5 Q4VBL5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50678478	OC(=O)CCc1ccc(OCc2ccc(CN3CCC4(CC3)CC(CCO4)Oc3ccccn3)cc2)cc1	InChI=1S/C31H36N2O5/c34-30(35)13-10-24-8-11-27(12-9-24)36-23-26-6-4-25(5-7-26)22-33-18-15-31(16-19-33)21-28(14-20-37-31)38-29-3-1-2-17-32-29/h1-9,11-12,17,28H,10,13-16,18-23H2,(H,34,35)	DEYQONOAYIGYQY-UHFFFAOYSA-N	50230306	CHEMBL4073421	Free fatty acid receptor 1	Homo sapiens				 900					ChEMBL	10.1016/j.ejmech.2017.01.005	10.7270/Q2DZ0BJ9	28076825			Krasavin, M; Lukin, A; Bagnyukova, D; Zhurilo, N; Golovanov, A; Zozulya, S; Zahanich, I; Moore, D; Tikhonova, IG	2/15/2017	4/29/2019	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50230306	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50230306&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			137640781	383543011		CHEMBL4073421					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50678480	OC(=O)CCc1ccc(OCc2ccc(CN3CCC4(CC3)CC(CCOc3cccnc3)CCO4)cc2)cc1	InChI=1S/C33H40N2O5/c36-32(37)12-9-26-7-10-30(11-8-26)39-25-29-5-3-28(4-6-29)24-35-18-15-33(16-19-35)22-27(14-21-40-33)13-20-38-31-2-1-17-34-23-31/h1-8,10-11,17,23,27H,9,12-16,18-22,24-25H2,(H,36,37)	QWRRCCVPXGQQPT-UHFFFAOYSA-N	50230307	CHEMBL4083311	Free fatty acid receptor 1	Homo sapiens				 2560					ChEMBL	10.1016/j.ejmech.2017.01.005	10.7270/Q2DZ0BJ9	28076825			Krasavin, M; Lukin, A; Bagnyukova, D; Zhurilo, N; Golovanov, A; Zozulya, S; Zahanich, I; Moore, D; Tikhonova, IG	2/15/2017	4/29/2019	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50230307	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50230307&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			137645353	383543012		CHEMBL4083311					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50678481	Cc1nccnc1OCCC1CCOC2(CCN(Cc3ccc(COc4ccc(CCC(O)=O)cc4)cc3)CC2)C1	InChI=1S/C33H41N3O5/c1-25-32(35-17-16-34-25)39-20-12-27-13-21-41-33(22-27)14-18-36(19-15-33)23-28-2-4-29(5-3-28)24-40-30-9-6-26(7-10-30)8-11-31(37)38/h2-7,9-10,16-17,27H,8,11-15,18-24H2,1H3,(H,37,38)	GUUDCMGHQPBAER-UHFFFAOYSA-N	50230308	CHEMBL4072869	Free fatty acid receptor 1	Homo sapiens				 1270					ChEMBL	10.1016/j.ejmech.2017.01.005	10.7270/Q2DZ0BJ9	28076825			Krasavin, M; Lukin, A; Bagnyukova, D; Zhurilo, N; Golovanov, A; Zozulya, S; Zahanich, I; Moore, D; Tikhonova, IG	2/15/2017	4/29/2019	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50230308	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50230308&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			137630599	383543013		CHEMBL4072869					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50678482	Cc1ccnc(OCCC2CCOC3(CCN(Cc4ccc(COc5ccc(CCC(O)=O)cc5)cc4)CC3)C2)c1	InChI=1S/C34H42N2O5/c1-26-12-17-35-32(22-26)39-20-13-28-14-21-41-34(23-28)15-18-36(19-16-34)24-29-2-4-30(5-3-29)25-40-31-9-6-27(7-10-31)8-11-33(37)38/h2-7,9-10,12,17,22,28H,8,11,13-16,18-21,23-25H2,1H3,(H,37,38)	FWMZXTMMQLCMCF-UHFFFAOYSA-N	50230309	CHEMBL4071849	Free fatty acid receptor 1	Homo sapiens				 1110					ChEMBL	10.1016/j.ejmech.2017.01.005	10.7270/Q2DZ0BJ9	28076825			Krasavin, M; Lukin, A; Bagnyukova, D; Zhurilo, N; Golovanov, A; Zozulya, S; Zahanich, I; Moore, D; Tikhonova, IG	2/15/2017	4/29/2019	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50230309	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50230309&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			137629942	383543014		CHEMBL4071849					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50678483	Cc1cnc(C)c(OCCC2CCOC3(CCN(Cc4ccc(COc5ccc(CCC(O)=O)cc5)cc4)CC3)C2)n1	InChI=1S/C34H43N3O5/c1-25-22-35-26(2)33(36-25)40-19-13-28-14-20-42-34(21-28)15-17-37(18-16-34)23-29-3-5-30(6-4-29)24-41-31-10-7-27(8-11-31)9-12-32(38)39/h3-8,10-11,22,28H,9,12-21,23-24H2,1-2H3,(H,38,39)	BZIHILQPQURWBE-UHFFFAOYSA-N	50230310	CHEMBL4091587	Free fatty acid receptor 1	Homo sapiens				 1140					ChEMBL	10.1016/j.ejmech.2017.01.005	10.7270/Q2DZ0BJ9	28076825			Krasavin, M; Lukin, A; Bagnyukova, D; Zhurilo, N; Golovanov, A; Zozulya, S; Zahanich, I; Moore, D; Tikhonova, IG	2/15/2017	4/29/2019	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50230310	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50230310&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			137630875	383543015		CHEMBL4091587					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
