BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
50527845	CC#C[C@@H](CC(O)=O)c1ccc(OCc2cccc(CN(Cc3ccsc3)C3CC3)c2)cc1 |r|	InChI=1S/C28H29NO3S/c1-2-4-25(16-28(30)31)24-7-11-27(12-8-24)32-19-22-6-3-5-21(15-22)17-29(26-9-10-26)18-23-13-14-33-20-23/h3,5-8,11-15,20,25-26H,9-10,16-19H2,1H3,(H,30,31)	LHCSQNYECDVWLW-UHFFFAOYSA-N	50201656	CHEMBL3966739	Free fatty acid receptor 1	Homo sapiens				 1.9					ChEMBL	10.1021/acsmedchemlett.6b00331	10.7270/Q2K35WN3	27994752			Agarwal, S; Sasane, S; Deshmukh, P; Rami, B; Bandyopadhyay, D; Giri, P; Giri, S; Jain, M; Desai, RC	12/8/2016	8/2/2018	Cadila Healthcare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50201656	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50201656&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			134150797	375979444		CHEMBL3966739					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50527846	CC#C[C@@H](CC(O)=O)c1ccc(OCc2cccc(CN(Cc3ccsc3)C3CCN(C)CC3)c2)cc1 |r|	InChI=1S/C31H36N2O3S/c1-3-5-28(19-31(34)35)27-8-10-30(11-9-27)36-22-25-7-4-6-24(18-25)20-33(21-26-14-17-37-23-26)29-12-15-32(2)16-13-29/h4,6-11,14,17-18,23,28-29H,12-13,15-16,19-22H2,1-2H3,(H,34,35)	KWPLTZTZAACJBZ-UHFFFAOYSA-N	50201657	CHEMBL3905435	Free fatty acid receptor 1	Homo sapiens				 140					ChEMBL	10.1021/acsmedchemlett.6b00331	10.7270/Q2K35WN3	27994752			Agarwal, S; Sasane, S; Deshmukh, P; Rami, B; Bandyopadhyay, D; Giri, P; Giri, S; Jain, M; Desai, RC	12/8/2016	8/2/2018	Cadila Healthcare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50201657	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50201657&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			134134768	375979445		CHEMBL3905435					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50527847	CC#C[C@@H](CC([O-])=O)c1ccc(OCc2cccc(CN(Cc3ccsc3)C(C)C)c2)cc1	InChI=1S/C28H31NO3S/c1-4-6-26(16-28(30)31)25-9-11-27(12-10-25)32-19-23-8-5-7-22(15-23)17-29(21(2)3)18-24-13-14-33-20-24/h5,7-15,20-21,26H,16-19H2,1-3H3,(H,30,31)/p-1	SMSIQLAGVMCTRR-UHFFFAOYSA-M	50201670	CHEMBL3930086	Free fatty acid receptor 1	Homo sapiens				 11					ChEMBL	10.1021/acsmedchemlett.6b00331	10.7270/Q2K35WN3	27994752			Agarwal, S; Sasane, S; Deshmukh, P; Rami, B; Bandyopadhyay, D; Giri, P; Giri, S; Jain, M; Desai, RC	12/8/2016	8/2/2018	Cadila Healthcare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50201670	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50201670&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			175683512	375979446		CHEMBL3930086					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50527848	CC#C[C@@H](CC(O)=O)c1ccc(OCc2cccc(CNCc3ccsc3)c2)cc1 |r|	InChI=1S/C25H25NO3S/c1-2-4-23(14-25(27)28)22-7-9-24(10-8-22)29-17-20-6-3-5-19(13-20)15-26-16-21-11-12-30-18-21/h3,5-13,18,23,26H,14-17H2,1H3,(H,27,28)	FYRHESFAFIUCSB-UHFFFAOYSA-N	50201677	CHEMBL3931296	Free fatty acid receptor 1	Homo sapiens				 118					ChEMBL	10.1021/acsmedchemlett.6b00331	10.7270/Q2K35WN3	27994752			Agarwal, S; Sasane, S; Deshmukh, P; Rami, B; Bandyopadhyay, D; Giri, P; Giri, S; Jain, M; Desai, RC	12/8/2016	8/2/2018	Cadila Healthcare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50201677	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50201677&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			134138359	375979447		CHEMBL3931296					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50527849	CC#C[C@@H](CC(O)=O)c1ccc(OCc2cccc(c2)-c2ccc(cc2)C(F)(F)F)cc1 |r|	InChI=1S/C26H21F3O3/c1-2-4-21(16-25(30)31)20-9-13-24(14-10-20)32-17-18-5-3-6-22(15-18)19-7-11-23(12-8-19)26(27,28)29/h3,5-15,21H,16-17H2,1H3,(H,30,31)	ZOPNBMMVVZRSGH-UHFFFAOYSA-N	50362690	CHEMBL1829173::AMG-837	Free fatty acid receptor 1	Homo sapiens				 2.2					ChEMBL	10.1021/acsmedchemlett.6b00331	10.7270/Q2K35WN3	27994752			Agarwal, S; Sasane, S; Deshmukh, P; Rami, B; Bandyopadhyay, D; Giri, P; Giri, S; Jain, M; Desai, RC	12/8/2016	8/2/2018	Cadila Healthcare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50362690	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50362690&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			46854655	136966752		CHEMBL1829173					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50527850	CC#C[C@@H](CC(O)=O)c1ccc(OCc2cccc(CN(Cc3ccsc3)Cc3ccncc3)c2)cc1 |r|	InChI=1S/C31H30N2O3S/c1-2-4-29(18-31(34)35)28-7-9-30(10-8-28)36-22-26-6-3-5-25(17-26)20-33(21-27-13-16-37-23-27)19-24-11-14-32-15-12-24/h3,5-17,23,29H,18-22H2,1H3,(H,34,35)	TVBXJJUHFFSBLP-UHFFFAOYSA-N	50201678	CHEMBL3896509	Free fatty acid receptor 1	Homo sapiens				 1.9					ChEMBL	10.1021/acsmedchemlett.6b00331	10.7270/Q2K35WN3	27994752			Agarwal, S; Sasane, S; Deshmukh, P; Rami, B; Bandyopadhyay, D; Giri, P; Giri, S; Jain, M; Desai, RC	12/8/2016	8/2/2018	Cadila Healthcare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50201678	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50201678&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			134134433	375979448		CHEMBL3896509					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50527851	CC#C[C@@H](CC(O)=O)c1ccc(OCc2cccc(CN(CCO)Cc3ccsc3)c2)cc1 |r|	InChI=1S/C27H29NO4S/c1-2-4-25(16-27(30)31)24-7-9-26(10-8-24)32-19-22-6-3-5-21(15-22)17-28(12-13-29)18-23-11-14-33-20-23/h3,5-11,14-15,20,25,29H,12-13,16-19H2,1H3,(H,30,31)	KEEDBWCPENAFLV-UHFFFAOYSA-N	50201679	CHEMBL3957744	Free fatty acid receptor 1	Homo sapiens				 12					ChEMBL	10.1021/acsmedchemlett.6b00331	10.7270/Q2K35WN3	27994752			Agarwal, S; Sasane, S; Deshmukh, P; Rami, B; Bandyopadhyay, D; Giri, P; Giri, S; Jain, M; Desai, RC	12/8/2016	8/2/2018	Cadila Healthcare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50201679	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50201679&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			134155821	375979449		CHEMBL3957744					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50527852	Cc1cc(OCCCS(C)(=O)=O)cc(C)c1-c1cccc(COc2ccc3[C@H](CC(O)=O)COc3c2)c1 |r|	InChI=1S/C29H32O7S/c1-19-12-25(34-10-5-11-37(3,32)33)13-20(2)29(19)22-7-4-6-21(14-22)17-35-24-8-9-26-23(15-28(30)31)18-36-27(26)16-24/h4,6-9,12-14,16,23H,5,10-11,15,17-18H2,1-3H3,(H,30,31)	BZCALJIHZVNMGJ-UHFFFAOYSA-N	50386790	CHEMBL1829174::CHEMBL2047159::TAK-875::US11905230, Example TAK-875	Melanocortin receptor 4	Rattus norvegicus				 27000					ChEMBL	10.1021/acsmedchemlett.6b00331	10.7270/Q2K35WN3	27994752			Agarwal, S; Sasane, S; Deshmukh, P; Rami, B; Bandyopadhyay, D; Giri, P; Giri, S; Jain, M; Desai, RC	12/8/2016	8/2/2018	Cadila Healthcare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50386790	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001133&target=Melanocortin+receptor+4&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50386790&enzyme=Melanocortin+receptor+4&column=ki&startPg=0&Increment=50&submit=Search			24857286	160865873		CHEMBL2047159CHEMBL1829174					1	MNSTHHHGMYTSLHLWNRSSHGLHGNASESLGKGHSDGGCYEQLFVSPEVFVTLGVISLLENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVNIDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVRRVGIIISCIWAACTVSGVLFIIYSDSSAVIICLITMFFTMLVLMASLYVHMFLMARLHIKRIAVLPGTGTIRQGANMKGAITLTILIGVFVVCWAPFFLHLLFYISCPQNPYCVCFMSHFNLYLILIMCNAVIDPLIYALRSQELRKTFKEIICFYPLGGICELPGRY	8QJ2,9K3K,7PIV,7PIU,7AUE	Melanocortin receptor 4	MC4R_RAT	P70596																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50527853	CC#C[C@@H](CC(O)=O)c1ccc(OCc2cccc(CN(Cc3ccsc3)CC(F)(F)F)c2)cc1 |r|	InChI=1S/C27H26F3NO3S/c1-2-4-24(14-26(32)33)23-7-9-25(10-8-23)34-17-21-6-3-5-20(13-21)15-31(19-27(28,29)30)16-22-11-12-35-18-22/h3,5-13,18,24H,14-17,19H2,1H3,(H,32,33)	MJURNQWJCOZRNA-UHFFFAOYSA-N	50201680	CHEMBL3922381	Free fatty acid receptor 1	Homo sapiens				 0.800000					ChEMBL	10.1021/acsmedchemlett.6b00331	10.7270/Q2K35WN3	27994752			Agarwal, S; Sasane, S; Deshmukh, P; Rami, B; Bandyopadhyay, D; Giri, P; Giri, S; Jain, M; Desai, RC	12/8/2016	8/2/2018	Cadila Healthcare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50201680	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50201680&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			134139282	375979450		CHEMBL3922381					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50527854	CC#C[C@@H](CC(O)=O)c1ccc(OCc2cccc(CN(Cc3ccsc3)C3CCCC3)c2)cc1 |r|	InChI=1S/C30H33NO3S/c1-2-6-27(18-30(32)33)26-11-13-29(14-12-26)34-21-24-8-5-7-23(17-24)19-31(28-9-3-4-10-28)20-25-15-16-35-22-25/h5,7-8,11-17,22,27-28H,3-4,9-10,18-21H2,1H3,(H,32,33)	QTOTWHOJBSTHFU-UHFFFAOYSA-N	50201681	CHEMBL3951157	Free fatty acid receptor 1	Homo sapiens				 4.6					ChEMBL	10.1021/acsmedchemlett.6b00331	10.7270/Q2K35WN3	27994752			Agarwal, S; Sasane, S; Deshmukh, P; Rami, B; Bandyopadhyay, D; Giri, P; Giri, S; Jain, M; Desai, RC	12/8/2016	8/2/2018	Cadila Healthcare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50201681	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50201681&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			134147518	375979451		CHEMBL3951157					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50527855	CCS(=O)(=O)N(Cc1ccsc1)Cc1cccc(COc2ccc(cc2)[C@H](CC(O)=O)C#CC)c1 |r|	InChI=1S/C27H29NO5S2/c1-3-6-25(16-27(29)30)24-9-11-26(12-10-24)33-19-22-8-5-7-21(15-22)17-28(35(31,32)4-2)18-23-13-14-34-20-23/h5,7-15,20,25H,4,16-19H2,1-2H3,(H,29,30)	NCEYLUIGKIPDAZ-UHFFFAOYSA-N	50201682	CHEMBL3918387	Free fatty acid receptor 1	Homo sapiens				 7.0					ChEMBL	10.1021/acsmedchemlett.6b00331	10.7270/Q2K35WN3	27994752			Agarwal, S; Sasane, S; Deshmukh, P; Rami, B; Bandyopadhyay, D; Giri, P; Giri, S; Jain, M; Desai, RC	12/8/2016	8/2/2018	Cadila Healthcare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50201682	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50201682&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			134139119	375979452		CHEMBL3918387					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50527856	CC#C[C@@H](CC(O)=O)c1ccc(OCc2cccc(CN(Cc3ccsc3)C3CCS(=O)(=O)CC3)c2)cc1 |r|	InChI=1S/C30H33NO5S2/c1-2-4-27(18-30(32)33)26-7-9-29(10-8-26)36-21-24-6-3-5-23(17-24)19-31(20-25-11-14-37-22-25)28-12-15-38(34,35)16-13-28/h3,5-11,14,17,22,27-28H,12-13,15-16,18-21H2,1H3,(H,32,33)	VZDNNYHLRICBPV-UHFFFAOYSA-N	50201683	CHEMBL3933446	Free fatty acid receptor 1	Homo sapiens				 17					ChEMBL	10.1021/acsmedchemlett.6b00331	10.7270/Q2K35WN3	27994752			Agarwal, S; Sasane, S; Deshmukh, P; Rami, B; Bandyopadhyay, D; Giri, P; Giri, S; Jain, M; Desai, RC	12/8/2016	8/2/2018	Cadila Healthcare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50201683	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50201683&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			134138706	375979453		CHEMBL3933446					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50527857	Cc1cc(OCCCS(C)(=O)=O)cc(C)c1-c1cccc(COc2ccc3[C@H](CC(O)=O)COc3c2)c1 |r|	InChI=1S/C29H32O7S/c1-19-12-25(34-10-5-11-37(3,32)33)13-20(2)29(19)22-7-4-6-21(14-22)17-35-24-8-9-26-23(15-28(30)31)18-36-27(26)16-24/h4,6-9,12-14,16,23H,5,10-11,15,17-18H2,1-3H3,(H,30,31)	BZCALJIHZVNMGJ-UHFFFAOYSA-N	50386790	CHEMBL1829174::CHEMBL2047159::TAK-875::US11905230, Example TAK-875	Free fatty acid receptor 1	Homo sapiens				 1.9					ChEMBL	10.1021/acsmedchemlett.6b00331	10.7270/Q2K35WN3	27994752			Agarwal, S; Sasane, S; Deshmukh, P; Rami, B; Bandyopadhyay, D; Giri, P; Giri, S; Jain, M; Desai, RC	12/8/2016	8/2/2018	Cadila Healthcare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50386790	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50386790&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			24857286	160865873		CHEMBL2047159CHEMBL1829174					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50527858	CC#C[C@@H](CC(O)=O)c1ccc(OCc2cccc(CN(C)Cc3ccsc3)c2)cc1 |r|	InChI=1S/C26H27NO3S/c1-3-5-24(15-26(28)29)23-8-10-25(11-9-23)30-18-21-7-4-6-20(14-21)16-27(2)17-22-12-13-31-19-22/h4,6-14,19,24H,15-18H2,1-2H3,(H,28,29)	FMFKPENBJYTRTQ-UHFFFAOYSA-N	50201684	CHEMBL3894356	Free fatty acid receptor 1	Homo sapiens				 38					ChEMBL	10.1021/acsmedchemlett.6b00331	10.7270/Q2K35WN3	27994752			Agarwal, S; Sasane, S; Deshmukh, P; Rami, B; Bandyopadhyay, D; Giri, P; Giri, S; Jain, M; Desai, RC	12/8/2016	8/2/2018	Cadila Healthcare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50201684	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50201684&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			134136203	375979454		CHEMBL3894356					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50527859	COCCN(Cc1ccsc1)Cc1cccc(COc2ccc(cc2)[C@H](CC(O)=O)C#CC)c1 |r|	InChI=1S/C28H31NO4S/c1-3-5-26(17-28(30)31)25-8-10-27(11-9-25)33-20-23-7-4-6-22(16-23)18-29(13-14-32-2)19-24-12-15-34-21-24/h4,6-12,15-16,21,26H,13-14,17-20H2,1-2H3,(H,30,31)	HWZRFZIYXXSOKM-UHFFFAOYSA-N	50201685	CHEMBL3913383	Free fatty acid receptor 1	Homo sapiens				 8.6					ChEMBL	10.1021/acsmedchemlett.6b00331	10.7270/Q2K35WN3	27994752			Agarwal, S; Sasane, S; Deshmukh, P; Rami, B; Bandyopadhyay, D; Giri, P; Giri, S; Jain, M; Desai, RC	12/8/2016	8/2/2018	Cadila Healthcare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50201685	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50201685&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			134143418	375979455		CHEMBL3913383					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50527860	CC#C[C@@H](CC(O)=O)c1ccc(OCc2cccc(CN(Cc3ccsc3)C(C)C)c2)cc1 |r|	InChI=1S/C28H31NO3S/c1-4-6-26(16-28(30)31)25-9-11-27(12-10-25)32-19-23-8-5-7-22(15-23)17-29(21(2)3)18-24-13-14-33-20-24/h5,7-15,20-21,26H,16-19H2,1-3H3,(H,30,31)	SMSIQLAGVMCTRR-UHFFFAOYSA-N	50201686	CHEMBL3975239	Free fatty acid receptor 1	Homo sapiens				 8.6					ChEMBL	10.1021/acsmedchemlett.6b00331	10.7270/Q2K35WN3	27994752			Agarwal, S; Sasane, S; Deshmukh, P; Rami, B; Bandyopadhyay, D; Giri, P; Giri, S; Jain, M; Desai, RC	12/8/2016	8/2/2018	Cadila Healthcare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50201686	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50201686&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			134137874	375979456		CHEMBL3975239					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50527861	CC#C[C@@H](CC(O)=O)c1ccc(OCc2cccc(CN(CC3CC3)Cc3ccsc3)c2)cc1 |r|	InChI=1S/C29H31NO3S/c1-2-4-27(16-29(31)32)26-9-11-28(12-10-26)33-20-24-6-3-5-23(15-24)18-30(17-22-7-8-22)19-25-13-14-34-21-25/h3,5-6,9-15,21-22,27H,7-8,16-20H2,1H3,(H,31,32)	GEDSOSKHDUGLGZ-UHFFFAOYSA-N	50201687	CHEMBL3895442	Free fatty acid receptor 1	Homo sapiens				 16					ChEMBL	10.1021/acsmedchemlett.6b00331	10.7270/Q2K35WN3	27994752			Agarwal, S; Sasane, S; Deshmukh, P; Rami, B; Bandyopadhyay, D; Giri, P; Giri, S; Jain, M; Desai, RC	12/8/2016	8/2/2018	Cadila Healthcare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50201687	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50201687&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			134137248	375979457		CHEMBL3895442					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50527862	CC#C[C@@H](CC(O)=O)c1ccc(OCc2cccc(CN(Cc3ccsc3)C3CCCCC3)c2)cc1 |r|	InChI=1S/C31H35NO3S/c1-2-7-28(19-31(33)34)27-12-14-30(15-13-27)35-22-25-9-6-8-24(18-25)20-32(21-26-16-17-36-23-26)29-10-4-3-5-11-29/h6,8-9,12-18,23,28-29H,3-5,10-11,19-22H2,1H3,(H,33,34)	ZYXAVWUENFJJIJ-UHFFFAOYSA-N	50201688	CHEMBL3923431	Free fatty acid receptor 1	Homo sapiens				 2.0					ChEMBL	10.1021/acsmedchemlett.6b00331	10.7270/Q2K35WN3	27994752			Agarwal, S; Sasane, S; Deshmukh, P; Rami, B; Bandyopadhyay, D; Giri, P; Giri, S; Jain, M; Desai, RC	12/8/2016	8/2/2018	Cadila Healthcare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50201688	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50201688&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			134140466	375979458		CHEMBL3923431					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50527863	CC#C[C@@H](CC(O)=O)c1ccc(OCc2cccc(CN(Cc3ccsc3)Cc3ccccc3)c2)cc1 |r|	InChI=1S/C32H31NO3S/c1-2-7-30(19-32(34)35)29-12-14-31(15-13-29)36-23-27-11-6-10-26(18-27)21-33(22-28-16-17-37-24-28)20-25-8-4-3-5-9-25/h3-6,8-18,24,30H,19-23H2,1H3,(H,34,35)	MPFQBEVBFDTUQM-UHFFFAOYSA-N	50201689	CHEMBL3924534	Free fatty acid receptor 1	Homo sapiens				 4.4					ChEMBL	10.1021/acsmedchemlett.6b00331	10.7270/Q2K35WN3	27994752			Agarwal, S; Sasane, S; Deshmukh, P; Rami, B; Bandyopadhyay, D; Giri, P; Giri, S; Jain, M; Desai, RC	12/8/2016	8/2/2018	Cadila Healthcare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50201689	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50201689&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			134140675	375979459		CHEMBL3924534					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50527864	CC#C[C@@H](CC(O)=O)c1ccc(OCc2cccc(CN(Cc3ccsc3)Cc3ccsc3)c2)cc1 |r|	InChI=1S/C30H29NO3S2/c1-2-4-28(16-30(32)33)27-7-9-29(10-8-27)34-20-24-6-3-5-23(15-24)17-31(18-25-11-13-35-21-25)19-26-12-14-36-22-26/h3,5-15,21-22,28H,16-20H2,1H3,(H,32,33)	KFTDMTOUOXLREV-UHFFFAOYSA-N	50201690	CHEMBL3889768	Free fatty acid receptor 1	Homo sapiens				 2.1					ChEMBL	10.1021/acsmedchemlett.6b00331	10.7270/Q2K35WN3	27994752			Agarwal, S; Sasane, S; Deshmukh, P; Rami, B; Bandyopadhyay, D; Giri, P; Giri, S; Jain, M; Desai, RC	12/8/2016	8/2/2018	Cadila Healthcare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50201690	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50201690&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			134129919	375979460		CHEMBL3889768					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50527865	CC#C[C@@H](CC(O)=O)c1ccc(OCc2cccc(CN(Cc3ccsc3)C(C)=O)c2)cc1 |r|	InChI=1S/C27H27NO4S/c1-3-5-25(15-27(30)31)24-8-10-26(11-9-24)32-18-22-7-4-6-21(14-22)16-28(20(2)29)17-23-12-13-33-19-23/h4,6-14,19,25H,15-18H2,1-2H3,(H,30,31)	MJXQRUYHEIDCFI-UHFFFAOYSA-N	50201691	CHEMBL3921143	Free fatty acid receptor 1	Homo sapiens				 30					ChEMBL	10.1021/acsmedchemlett.6b00331	10.7270/Q2K35WN3	27994752			Agarwal, S; Sasane, S; Deshmukh, P; Rami, B; Bandyopadhyay, D; Giri, P; Giri, S; Jain, M; Desai, RC	12/8/2016	8/2/2018	Cadila Healthcare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50201691	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50201691&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			134139990	375979461		CHEMBL3921143					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50527866	CC#C[C@@H](CC(O)=O)c1ccc(OCc2cccc(CNCc3ccncc3)c2)cc1 |r|	InChI=1S/C26H26N2O3/c1-2-4-24(16-26(29)30)23-7-9-25(10-8-23)31-19-22-6-3-5-21(15-22)18-28-17-20-11-13-27-14-12-20/h3,5-15,24,28H,16-19H2,1H3,(H,29,30)	YHNXYNSFGGPDBB-UHFFFAOYSA-N	50201692	CHEMBL3964251	Free fatty acid receptor 1	Homo sapiens				>1000					ChEMBL	10.1021/acsmedchemlett.6b00331	10.7270/Q2K35WN3	27994752			Agarwal, S; Sasane, S; Deshmukh, P; Rami, B; Bandyopadhyay, D; Giri, P; Giri, S; Jain, M; Desai, RC	12/8/2016	8/2/2018	Cadila Healthcare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50201692	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50201692&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			134150969	375979462		CHEMBL3964251					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50527867	CC#C[C@@H](CC([O-])=O)c1ccc(OCc2cccc(CN(Cc3ccsc3)C(C)C)c2)cc1	InChI=1S/C28H31NO3S/c1-4-6-26(16-28(30)31)25-9-11-27(12-10-25)32-19-23-8-5-7-22(15-23)17-29(21(2)3)18-24-13-14-33-20-24/h5,7-15,20-21,26H,16-19H2,1-3H3,(H,30,31)/p-1	SMSIQLAGVMCTRR-UHFFFAOYSA-M	50201670	CHEMBL3930086	Melanocortin receptor 4	Rattus norvegicus				 20000					ChEMBL	10.1021/acsmedchemlett.6b00331	10.7270/Q2K35WN3	27994752			Agarwal, S; Sasane, S; Deshmukh, P; Rami, B; Bandyopadhyay, D; Giri, P; Giri, S; Jain, M; Desai, RC	12/8/2016	8/2/2018	Cadila Healthcare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50201670	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001133&target=Melanocortin+receptor+4&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50201670&enzyme=Melanocortin+receptor+4&column=ki&startPg=0&Increment=50&submit=Search			175683512	375979446		CHEMBL3930086					1	MNSTHHHGMYTSLHLWNRSSHGLHGNASESLGKGHSDGGCYEQLFVSPEVFVTLGVISLLENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVNIDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVRRVGIIISCIWAACTVSGVLFIIYSDSSAVIICLITMFFTMLVLMASLYVHMFLMARLHIKRIAVLPGTGTIRQGANMKGAITLTILIGVFVVCWAPFFLHLLFYISCPQNPYCVCFMSHFNLYLILIMCNAVIDPLIYALRSQELRKTFKEIICFYPLGGICELPGRY	8QJ2,9K3K,7PIV,7PIU,7AUE	Melanocortin receptor 4	MC4R_RAT	P70596																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50527868	CC#C[C@@H](CC(O)=O)c1ccc(OCc2cccc(CN(CC(C)C)Cc3ccsc3)c2)cc1 |r|	InChI=1S/C29H33NO3S/c1-4-6-27(16-29(31)32)26-9-11-28(12-10-26)33-20-24-8-5-7-23(15-24)18-30(17-22(2)3)19-25-13-14-34-21-25/h5,7-15,21-22,27H,16-20H2,1-3H3,(H,31,32)	NCLNWQUEXDPBNS-UHFFFAOYSA-N	50201693	CHEMBL3904378	Free fatty acid receptor 1	Homo sapiens				 1.4					ChEMBL	10.1021/acsmedchemlett.6b00331	10.7270/Q2K35WN3	27994752			Agarwal, S; Sasane, S; Deshmukh, P; Rami, B; Bandyopadhyay, D; Giri, P; Giri, S; Jain, M; Desai, RC	12/8/2016	8/2/2018	Cadila Healthcare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50201693	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50201693&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			134136015	375979463		CHEMBL3904378					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50527869	CC#C[C@@H](CC(O)=O)c1ccc(OCc2cccc(CN(Cc3ccsc3)C3CCOCC3)c2)cc1 |r|	InChI=1S/C30H33NO4S/c1-2-4-27(18-30(32)33)26-7-9-29(10-8-26)35-21-24-6-3-5-23(17-24)19-31(20-25-13-16-36-22-25)28-11-14-34-15-12-28/h3,5-10,13,16-17,22,27-28H,11-12,14-15,18-21H2,1H3,(H,32,33)	BAOQMYKUQLKZDR-UHFFFAOYSA-N	50201694	CHEMBL3914686	Free fatty acid receptor 1	Homo sapiens				 7.7					ChEMBL	10.1021/acsmedchemlett.6b00331	10.7270/Q2K35WN3	27994752			Agarwal, S; Sasane, S; Deshmukh, P; Rami, B; Bandyopadhyay, D; Giri, P; Giri, S; Jain, M; Desai, RC	12/8/2016	8/2/2018	Cadila Healthcare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50201694	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50201694&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			134142245	375979464		CHEMBL3914686					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50527870	CC#C[C@@H](CC(O)=O)c1ccc(OCc2cccc(CN(Cc3ccsc3)S(=O)(=O)C3CC3)c2)cc1 |r|	InChI=1S/C28H29NO5S2/c1-2-4-25(16-28(30)31)24-7-9-26(10-8-24)34-19-22-6-3-5-21(15-22)17-29(18-23-13-14-35-20-23)36(32,33)27-11-12-27/h3,5-10,13-15,20,25,27H,11-12,16-19H2,1H3,(H,30,31)	UIGAAZRVTFQJBH-UHFFFAOYSA-N	50201695	CHEMBL3893141	Free fatty acid receptor 1	Homo sapiens				 10.0					ChEMBL	10.1021/acsmedchemlett.6b00331	10.7270/Q2K35WN3	27994752			Agarwal, S; Sasane, S; Deshmukh, P; Rami, B; Bandyopadhyay, D; Giri, P; Giri, S; Jain, M; Desai, RC	12/8/2016	8/2/2018	Cadila Healthcare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50201695	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50201695&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			134137203	375979465		CHEMBL3893141					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50527871	CC#C[C@@H](CC([O-])=O)c1ccc(OCc2cccc(CN(Cc3ccsc3)C(C)C)c2)cc1	InChI=1S/C28H31NO3S/c1-4-6-26(16-28(30)31)25-9-11-27(12-10-25)32-19-23-8-5-7-22(15-23)17-29(21(2)3)18-24-13-14-33-20-24/h5,7-15,20-21,26H,16-19H2,1-3H3,(H,30,31)/p-1	SMSIQLAGVMCTRR-UHFFFAOYSA-M	50201670	CHEMBL3930086	Free fatty acid receptor 1	Homo sapiens				 12					ChEMBL	10.1021/acsmedchemlett.6b00331	10.7270/Q2K35WN3	27994752			Agarwal, S; Sasane, S; Deshmukh, P; Rami, B; Bandyopadhyay, D; Giri, P; Giri, S; Jain, M; Desai, RC	12/8/2016	8/2/2018	Cadila Healthcare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50201670	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50201670&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			175683512	375979446		CHEMBL3930086					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50527872	CC#C[C@@H](CC(O)=O)c1ccc(OCc2cccc(CN(Cc3ccsc3)C3CCSCC3)c2)cc1 |r|	InChI=1S/C30H33NO3S2/c1-2-4-27(18-30(32)33)26-7-9-29(10-8-26)34-21-24-6-3-5-23(17-24)19-31(20-25-11-14-36-22-25)28-12-15-35-16-13-28/h3,5-11,14,17,22,27-28H,12-13,15-16,18-21H2,1H3,(H,32,33)	QNUMUCFNQQWNJY-UHFFFAOYSA-N	50201696	CHEMBL3914418	Free fatty acid receptor 1	Homo sapiens				 7.9					ChEMBL	10.1021/acsmedchemlett.6b00331	10.7270/Q2K35WN3	27994752			Agarwal, S; Sasane, S; Deshmukh, P; Rami, B; Bandyopadhyay, D; Giri, P; Giri, S; Jain, M; Desai, RC	12/8/2016	8/2/2018	Cadila Healthcare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50201696	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50201696&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			134142149	375979466		CHEMBL3914418					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
