BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50676300 c1cc(ccc1O)Oc2ccc(cc2I)CCN InChI=1S/C14H14INO2/c15-13-9-10(7-8-16)1-6-14(13)18-12-4-2-11(17)3-5-12/h1-6,9,17H,7-8,16H2 XIINYOJWNGOUPF-UHFFFAOYSA-N 50359505 CHEMBL1182312 Trace amine-associated receptor 1 Homo sapiens 1690 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50359505 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004101&target=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50359505&enzyme=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search UJF 8JLJ,8JLN 9950514 136963529 CHEMBL1182312 1 MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNWLIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISIDRYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRGGCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNGISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFNPMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS 8JSO,8JLR,8JLQ,8JLP,8JLO,8JLN,8ZSS,8ZSP,8ZSJ,8WCA,8WC8,8W8A,8W89,8W88,8W87 Trace amine-associated receptor 1 TAAR1_HUMAN Q96RJ0 Q2M1W5 Q3MIH8 Q5VUQ1 50676301 Cc1ccc(NC(N)=NC(N)=N)cc1 |w:8.8| InChI=1S/C9H13N5/c1-6-2-4-7(5-3-6)13-9(12)14-8(10)11/h2-5H,1H3,(H6,10,11,12,13,14) ILEIGUXOYKZHRK-UHFFFAOYSA-N 50053630 N-(4-methylphenyl)imidodicarbonimidic diamide::4-Methyl-Phenyl biguanide::CHEMBL291064 Trace amine-associated receptor 1 Homo sapiens >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50053630 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004101&target=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50053630&enzyme=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 2730263 103950309 CHEMBL291064 1 MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNWLIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISIDRYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRGGCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNGISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFNPMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS 8JSO,8JLR,8JLQ,8JLP,8JLO,8JLN,8ZSS,8ZSP,8ZSJ,8WCA,8WC8,8W8A,8W89,8W88,8W87 Trace amine-associated receptor 1 TAAR1_HUMAN Q96RJ0 Q2M1W5 Q3MIH8 Q5VUQ1 50676302 NC(=N)NC(=N)NCc1ccccc1 InChI=1S/C9H13N5/c10-8(11)14-9(12)13-6-7-4-2-1-3-5-7/h1-5H,6H2,(H6,10,11,12,13,14) IBWXAMPUVRBFIS-UHFFFAOYSA-N 50227351 CHEMBL3628706 Trace amine-associated receptor 1 Homo sapiens >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227351 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004101&target=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227351&enzyme=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15006 383542710 CHEMBL3628706 1 MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNWLIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISIDRYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRGGCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNGISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFNPMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS 8JSO,8JLR,8JLQ,8JLP,8JLO,8JLN,8ZSS,8ZSP,8ZSJ,8WCA,8WC8,8W8A,8W89,8W88,8W87 Trace amine-associated receptor 1 TAAR1_HUMAN Q96RJ0 Q2M1W5 Q3MIH8 Q5VUQ1 50676303 [#7]\[#6](-[#7])=[#7]\[#6](\[#7])=[#7]\[#6]-c1cccc(Cl)c1 InChI=1S/C9H4ClN5/c10-7-3-1-2-6(4-7)5-14-9(13)15-8(11)12/h1-4H KSRINKNOKFONET-UHFFFAOYSA-N 50227824 CHEMBL4088689 Trace amine-associated receptor 1 Homo sapiens 7000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227824 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004101&target=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227824&enzyme=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 83034883 383542711 CHEMBL4088689 1 MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNWLIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISIDRYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRGGCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNGISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFNPMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS 8JSO,8JLR,8JLQ,8JLP,8JLO,8JLN,8ZSS,8ZSP,8ZSJ,8WCA,8WC8,8W8A,8W89,8W88,8W87 Trace amine-associated receptor 1 TAAR1_HUMAN Q96RJ0 Q2M1W5 Q3MIH8 Q5VUQ1 50676304 N/C(N)=N/C(N)=N/Cc1ccc(Cl)cc1 InChI=1S/C9H4ClN5/c10-7-3-1-6(2-4-7)5-14-9(13)15-8(11)12/h1-4H OTNIXDXWHBAVJR-UHFFFAOYSA-N 50227825 CHEMBL4060464 Trace amine-associated receptor 1 Homo sapiens 1800 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227825 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004101&target=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227825&enzyme=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 20868 383542712 CHEMBL4060464 1 MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNWLIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISIDRYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRGGCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNGISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFNPMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS 8JSO,8JLR,8JLQ,8JLP,8JLO,8JLN,8ZSS,8ZSP,8ZSJ,8WCA,8WC8,8W8A,8W89,8W88,8W87 Trace amine-associated receptor 1 TAAR1_HUMAN Q96RJ0 Q2M1W5 Q3MIH8 Q5VUQ1 50676305 [#7]\[#6](-[#7])=[#7]\[#6](\[#7])=[#7]\[#6]-c1cccc(F)c1 InChI=1S/C9H4FN5/c10-7-3-1-2-6(4-7)5-14-9(13)15-8(11)12/h1-4H XVFUKANHWDOJQC-UHFFFAOYSA-N 50227826 CHEMBL4069147 Trace amine-associated receptor 1 Homo sapiens 1600 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227826 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004101&target=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227826&enzyme=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 83032501 383542713 CHEMBL4069147 1 MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNWLIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISIDRYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRGGCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNGISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFNPMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS 8JSO,8JLR,8JLQ,8JLP,8JLO,8JLN,8ZSS,8ZSP,8ZSJ,8WCA,8WC8,8W8A,8W89,8W88,8W87 Trace amine-associated receptor 1 TAAR1_HUMAN Q96RJ0 Q2M1W5 Q3MIH8 Q5VUQ1 50676306 N/C(N)=N/C(N)=N/Cc1cccc(Br)c1 InChI=1S/C9H4BrN5/c10-7-3-1-2-6(4-7)5-14-9(13)15-8(11)12/h1-4H RUJHTAZRYNATNV-UHFFFAOYSA-N 50227828 CHEMBL4068661 Trace amine-associated receptor 1 Homo sapiens 4900 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227828 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004101&target=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227828&enzyme=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 23637934 383542714 CHEMBL4068661 1 MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNWLIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISIDRYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRGGCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNGISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFNPMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS 8JSO,8JLR,8JLQ,8JLP,8JLO,8JLN,8ZSS,8ZSP,8ZSJ,8WCA,8WC8,8W8A,8W89,8W88,8W87 Trace amine-associated receptor 1 TAAR1_HUMAN Q96RJ0 Q2M1W5 Q3MIH8 Q5VUQ1 50676307 [H]/N=C(\Nc1ccc(cc1)Cl)/N/C(=N\[H])/NC(C)C InChI=1S/C11H16ClN5/c1-7(2)15-10(13)17-11(14)16-9-5-3-8(12)4-6-9/h3-7H,1-2H3,(H5,13,14,15,16,17) SSOLNOMRVKKSON-UHFFFAOYSA-N 50227829 CHEBI:8455::Proguanil::CHLOROGUANIDE Trace amine-associated receptor 1 Homo sapiens >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227829 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004101&target=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227829&enzyme=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search XEW 8F4T,8ZSR,8ZXZ 6178111 383542715 1 MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNWLIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISIDRYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRGGCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNGISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFNPMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS 8JSO,8JLR,8JLQ,8JLP,8JLO,8JLN,8ZSS,8ZSP,8ZSJ,8WCA,8WC8,8W8A,8W89,8W88,8W87 Trace amine-associated receptor 1 TAAR1_HUMAN Q96RJ0 Q2M1W5 Q3MIH8 Q5VUQ1 50676308 NC(=N)N=C(N)Nc1ccccc1Cl |w:3.2| InChI=1S/C8H10ClN5/c9-5-3-1-2-4-6(5)13-8(12)14-7(10)11/h1-4H,(H6,10,11,12,13,14) MKWFJPZMYHPQIA-UHFFFAOYSA-N 50053629 2-Chloro-Phenyl biguanide::N-(2-chlorophenyl)imidodicarbonimidic diamide::CHEMBL42752 Trace amine-associated receptor 5 Mus musculus >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50053629 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007304&target=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50053629&enzyme=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search 29669 103950308 CHEMBL42752 1 MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD Trace amine-associated receptor 5 TAAR5_MOUSE Q5QD14 50676309 NC(=N)N=C(N)Nc1cccc(Cl)c1 |w:3.2| InChI=1S/C8H10ClN5/c9-5-2-1-3-6(4-5)13-8(12)14-7(10)11/h1-4H,(H6,10,11,12,13,14) DIHXJZHAIHGSAW-UHFFFAOYSA-N 50053615 m-chlorophenylbiguanidine::3-Chloro-Phenyl biguanide::N-(3-chlorophenyl)imidodicarbonimidic diamide::CHEMBL13790 Trace amine-associated receptor 5 Mus musculus >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50053615 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007304&target=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50053615&enzyme=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search 1354 103950294 CHEMBL13790 1 MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD Trace amine-associated receptor 5 TAAR5_MOUSE Q5QD14 50676310 NC(=N)N=C(N)Nc1ccc(Cl)c(Cl)c1 |w:3.2| InChI=1S/C8H9Cl2N5/c9-5-2-1-4(3-6(5)10)14-8(13)15-7(11)12/h1-3H,(H6,11,12,13,14,15) ZJAWVBLMRPEUPW-UHFFFAOYSA-N 50100977 N-(3,4-dichlorophenyl)imidodicarbonimidic diamide::3,4-dichloro-phenylbiguanide::CHEMBL41433 Trace amine-associated receptor 5 Mus musculus >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50100977 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007304&target=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50100977&enzyme=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search 151947 103997702 CHEMBL41433 1 MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD Trace amine-associated receptor 5 TAAR5_MOUSE Q5QD14 50676311 [#7]\[#6](-[#7])=[#7]\[#6](\[#7])=[#7]\c1cccc(F)c1 InChI=1S/C8H4FN5/c9-5-2-1-3-6(4-5)13-8(12)14-7(10)11/h1-4H BOEJINLGPKQKGT-UHFFFAOYSA-N 50227830 CHEMBL4099661 Trace amine-associated receptor 5 Mus musculus >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227830 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007304&target=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227830&enzyme=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search 2730303 383542716 CHEMBL4099661 1 MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD Trace amine-associated receptor 5 TAAR5_MOUSE Q5QD14 50676312 [#7]\[#6](-[#7])=[#7]\[#6](\[#7])=[#7]\c1ccc(cc1)-[#7+](-[#8-])=O InChI=1S/C8H4N6O2/c9-7(10)13-8(11)12-5-1-3-6(4-2-5)14(15)16/h1-4H CWZARZFMHUEZCV-UHFFFAOYSA-N 50227833 CHEMBL4088381 Trace amine-associated receptor 5 Mus musculus >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227833 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007304&target=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227833&enzyme=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search 20322 383542717 CHEMBL4088381 1 MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD Trace amine-associated receptor 5 TAAR5_MOUSE Q5QD14 50676313 [#6]-[#8]-c1ccc(cc1)\[#7]=[#6](/[#7])\[#7]=[#6](\[#7])-[#7] InChI=1S/C9H4N5O/c1-15-7-4-2-6(3-5-7)13-9(12)14-8(10)11/h2-5H YZCDMDCHMXSQTP-UHFFFAOYSA-N 50227834 CHEMBL4077681 Trace amine-associated receptor 5 Mus musculus >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227834 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007304&target=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227834&enzyme=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search 20983 383542718 CHEMBL4077681 1 MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD Trace amine-associated receptor 5 TAAR5_MOUSE Q5QD14 50676314 NC(=N)NC(=N)NCc1ccccc1 InChI=1S/C9H13N5/c10-8(11)14-9(12)13-6-7-4-2-1-3-5-7/h1-5H,6H2,(H6,10,11,12,13,14) IBWXAMPUVRBFIS-UHFFFAOYSA-N 50227351 CHEMBL3628706 Trace amine-associated receptor 5 Mus musculus >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227351 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007304&target=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227351&enzyme=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search 15006 383542710 CHEMBL3628706 1 MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD Trace amine-associated receptor 5 TAAR5_MOUSE Q5QD14 50676315 [#7]\[#6](-[#7])=[#7]\[#6](\[#7])=[#7]\[#6]-c1cccc(Cl)c1 InChI=1S/C9H4ClN5/c10-7-3-1-2-6(4-7)5-14-9(13)15-8(11)12/h1-4H KSRINKNOKFONET-UHFFFAOYSA-N 50227824 CHEMBL4088689 Trace amine-associated receptor 5 Mus musculus >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227824 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007304&target=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227824&enzyme=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search 83034883 383542711 CHEMBL4088689 1 MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD Trace amine-associated receptor 5 TAAR5_MOUSE Q5QD14 50676316 N/C(N)=N/C(N)=N/Cc1ccc(Cl)cc1 InChI=1S/C9H4ClN5/c10-7-3-1-6(2-4-7)5-14-9(13)15-8(11)12/h1-4H OTNIXDXWHBAVJR-UHFFFAOYSA-N 50227825 CHEMBL4060464 Trace amine-associated receptor 5 Mus musculus >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227825 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007304&target=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227825&enzyme=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search 20868 383542712 CHEMBL4060464 1 MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD Trace amine-associated receptor 5 TAAR5_MOUSE Q5QD14 50676317 [#7]\[#6](-[#7])=[#7]\[#6](\[#7])=[#7]\[#6]-c1ccc(Cl)c(Cl)c1 InChI=1S/C9H3Cl2N5/c10-6-2-1-5(3-7(6)11)4-15-9(14)16-8(12)13/h1-3H FFTCFUMTVQRYPQ-UHFFFAOYSA-N 50227835 CHEMBL4096403 Trace amine-associated receptor 5 Mus musculus >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227835 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007304&target=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227835&enzyme=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search 11426470 383542719 CHEMBL4096403 1 MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD Trace amine-associated receptor 5 TAAR5_MOUSE Q5QD14 50676318 N/C(N)=N/C(N)=N/Cc1cccc(Br)c1 InChI=1S/C9H4BrN5/c10-7-3-1-2-6(4-7)5-14-9(13)15-8(11)12/h1-4H RUJHTAZRYNATNV-UHFFFAOYSA-N 50227828 CHEMBL4068661 Trace amine-associated receptor 5 Mus musculus >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227828 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007304&target=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227828&enzyme=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search 23637934 383542714 CHEMBL4068661 1 MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD Trace amine-associated receptor 5 TAAR5_MOUSE Q5QD14 50676319 COc1ccc(C/N=C(N)/N=C(N)\N)cc1 InChI=1S/C10H4N5O/c1-16-8-4-2-7(3-5-8)6-14-10(13)15-9(11)12/h2-5H VYEBHIIOUYAMST-UHFFFAOYSA-N 50227836 CHEMBL4076103 Trace amine-associated receptor 5 Mus musculus >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227836 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007304&target=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227836&enzyme=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search 548202 383542720 CHEMBL4076103 1 MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD Trace amine-associated receptor 5 TAAR5_MOUSE Q5QD14 50676320 COc1ccc(C/N=C(N)/N=C(N)\N)cc1OC InChI=1S/C11H3N5O2/c1-17-8-4-3-7(5-9(8)18-2)6-15-11(14)16-10(12)13/h3-5H SOCPRZHRFWTDAL-UHFFFAOYSA-N 50227838 CHEMBL4102503 Trace amine-associated receptor 5 Mus musculus >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227838 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007304&target=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227838&enzyme=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search 83036736 383542721 CHEMBL4102503 1 MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD Trace amine-associated receptor 5 TAAR5_MOUSE Q5QD14 50676321 N/C(N)=N/C(N)=N/C1CCCCCC1 InChI=1S/C9N5/c10-8(11)14-9(12)13-7-5-3-1-2-4-6-7 WSVYYGKEXBJNHT-UHFFFAOYSA-N 50227839 CHEMBL4094764 Trace amine-associated receptor 5 Mus musculus >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227839 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007304&target=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227839&enzyme=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search 79007014 383542722 CHEMBL4094764 1 MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD Trace amine-associated receptor 5 TAAR5_MOUSE Q5QD14 50676322 NC(=N)NC(=N)NC12CC3CC(CC(C3)C1)C2 |TLB:6:7:10:14.12.13,THB:12:11:8:14.13.15,12:13:10.11.16:8,15:13:10:16.7.8,15:7:10:14.12.13| 50227840 CHEMBL2079013 Trace amine-associated receptor 5 Mus musculus >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227840 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007304&target=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227840&enzyme=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search 4350234 383542723 CHEMBL2079013 1 MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD Trace amine-associated receptor 5 TAAR5_MOUSE Q5QD14 50676323 NC(=N)\N=C(/N)N1CCOCC1 InChI=1S/C6H13N5O/c7-5(8)10-6(9)11-1-3-12-4-2-11/h1-4H2,(H5,7,8,9,10) KJHOZAZQWVKILO-UHFFFAOYSA-N 50227841 ABOB::Moroxydine::SKF-8898A Trace amine-associated receptor 5 Mus musculus >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227841 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007304&target=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227841&enzyme=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search 137345967 383542724 1 MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD Trace amine-associated receptor 5 TAAR5_MOUSE Q5QD14 50676324 CC1(N=C(N=C(N1c2ccc(cc2)Cl)N)N)C InChI=1S/C11H14ClN5/c1-11(2)16-9(13)15-10(14)17(11)8-5-3-7(12)4-6-8/h3-6H,1-2H3,(H4,13,14,15,16) QMNFFXRFOJIOKZ-UHFFFAOYSA-N 18792 Chlorazin::1-(4-chlorophenyl)-6,6-dimethyl-1,6-dihydro-1,3,5-triazine-2,4-diamine::CHEMBL747::Cycloguanil Trace amine-associated receptor 5 Mus musculus >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=18792 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007304&target=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=18792&enzyme=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search 1CY 9049 46518846 CHEMBL747 C15270 1 MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD Trace amine-associated receptor 5 TAAR5_MOUSE Q5QD14 50676325 NC1=NC2(CCCCC2)N(C(N)=N1)c1ccc(Cl)cc1 |c:12,t:1| InChI=1S/C14H18ClN5/c15-10-4-6-11(7-5-10)20-13(17)18-12(16)19-14(20)8-2-1-3-9-14/h4-7H,1-3,8-9H2,(H4,16,17,18,19) HVLCNNIHIPOVOP-UHFFFAOYSA-N 50378363 CHEMBL574656 Trace amine-associated receptor 5 Mus musculus >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50378363 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007304&target=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50378363&enzyme=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search 4068361 160857446 CHEMBL574656 1 MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD Trace amine-associated receptor 5 TAAR5_MOUSE Q5QD14 50676326 COc1cc(cc(c1OC)OC)Cc2cnc(nc2N)N InChI=1S/C14H18N4O3/c1-19-10-5-8(6-11(20-2)12(10)21-3)4-9-7-17-14(16)18-13(9)15/h5-7H,4H2,1-3H3,(H4,15,16,17,18) IEDVJHCEMCRBQM-UHFFFAOYSA-N 18069 CHEMBL22::TMP::Trimethoprim (TMP)::5-[(3,4,5-trimethoxyphenyl)methyl]pyrimidine-2,4-diamine::Trimethoprim::US10870625, Compound TMP Trace amine-associated receptor 5 Mus musculus >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=18069 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007304&target=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=18069&enzyme=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search TOP 5578 46518184 CHEMBL22 DB00440 C01965 1 MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD Trace amine-associated receptor 5 TAAR5_MOUSE Q5QD14 50676327 NC(=N)N=C(N)Nc1ccccc1Cl |w:3.2| InChI=1S/C8H10ClN5/c9-5-3-1-2-4-6(5)13-8(12)14-7(10)11/h1-4H,(H6,10,11,12,13,14) MKWFJPZMYHPQIA-UHFFFAOYSA-N 50053629 2-Chloro-Phenyl biguanide::N-(2-chlorophenyl)imidodicarbonimidic diamide::CHEMBL42752 Trace amine-associated receptor 1 Mus musculus 410 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50053629 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5779&target=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50053629&enzyme=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 29669 103950308 CHEMBL42752 1 MHLCHAITNISHRNSDWSREVQASLYSLMSLIILATLVGNLIVIISISHFKQLHTPTNWLLHSMAIVDFLLGCLIMPCSMVRTVERCWYFGEILCKVHTSTDIMLSSASIFHLAFISIDRYCAVCDPLRYKAKINISTILVMILVSWSLPAVYAFGMIFLELNLKGVEELYRSQVSDLGGCSPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIYFIAKGQARSINRTNVQVGLEGKSQAPQSKETKAAKTLGIMVGVFLVCWCPFFLCTVLDPFLGYVIPPSLNDALYWFGYLNSALNPMVYAFFYPWFRRALKMVLLGKIFQKDSSRSKLFL 8JLK,8JLJ,8ZSV,8WCC,8WCB,8WC9,8WC7,8WC6,8WC5,8WC4,8WC3 Trace amine-associated receptor 1 TAAR1_MOUSE Q923Y8 Q05A85 50676328 NC(=N)N=C(N)Nc1ccc(Cl)cc1 |w:3.2| InChI=1S/C8H10ClN5/c9-5-1-3-6(4-2-5)13-8(12)14-7(10)11/h1-4H,(H6,10,11,12,13,14) HTYFFCPFVMJTKM-UHFFFAOYSA-N 50053595 4-Chlorophenylbiguanide::N-(4-chlorophenyl)imidodicarbonimidic diamide::4-Chloro-Phenyl biguanide::CHEMBL840 Trace amine-associated receptor 1 Mus musculus 2100 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50053595 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5779&target=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50053595&enzyme=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 19933 103950274 CHEMBL840 1 MHLCHAITNISHRNSDWSREVQASLYSLMSLIILATLVGNLIVIISISHFKQLHTPTNWLLHSMAIVDFLLGCLIMPCSMVRTVERCWYFGEILCKVHTSTDIMLSSASIFHLAFISIDRYCAVCDPLRYKAKINISTILVMILVSWSLPAVYAFGMIFLELNLKGVEELYRSQVSDLGGCSPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIYFIAKGQARSINRTNVQVGLEGKSQAPQSKETKAAKTLGIMVGVFLVCWCPFFLCTVLDPFLGYVIPPSLNDALYWFGYLNSALNPMVYAFFYPWFRRALKMVLLGKIFQKDSSRSKLFL 8JLK,8JLJ,8ZSV,8WCC,8WCB,8WC9,8WC7,8WC6,8WC5,8WC4,8WC3 Trace amine-associated receptor 1 TAAR1_MOUSE Q923Y8 Q05A85 50676329 Cc1ccc(NC(N)=NC(N)=N)cc1 |w:8.8| InChI=1S/C9H13N5/c1-6-2-4-7(5-3-6)13-9(12)14-8(10)11/h2-5H,1H3,(H6,10,11,12,13,14) ILEIGUXOYKZHRK-UHFFFAOYSA-N 50053630 N-(4-methylphenyl)imidodicarbonimidic diamide::4-Methyl-Phenyl biguanide::CHEMBL291064 Trace amine-associated receptor 1 Mus musculus 1700 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50053630 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5779&target=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50053630&enzyme=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 2730263 103950309 CHEMBL291064 1 MHLCHAITNISHRNSDWSREVQASLYSLMSLIILATLVGNLIVIISISHFKQLHTPTNWLLHSMAIVDFLLGCLIMPCSMVRTVERCWYFGEILCKVHTSTDIMLSSASIFHLAFISIDRYCAVCDPLRYKAKINISTILVMILVSWSLPAVYAFGMIFLELNLKGVEELYRSQVSDLGGCSPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIYFIAKGQARSINRTNVQVGLEGKSQAPQSKETKAAKTLGIMVGVFLVCWCPFFLCTVLDPFLGYVIPPSLNDALYWFGYLNSALNPMVYAFFYPWFRRALKMVLLGKIFQKDSSRSKLFL 8JLK,8JLJ,8ZSV,8WCC,8WCB,8WC9,8WC7,8WC6,8WC5,8WC4,8WC3 Trace amine-associated receptor 1 TAAR1_MOUSE Q923Y8 Q05A85 50676330 [#7]\[#6](-[#7])=[#7]\[#6](\[#7])=[#7]\[#6]-c1ccccc1Cl InChI=1S/C9H4ClN5/c10-7-4-2-1-3-6(7)5-14-9(13)15-8(11)12/h1-4H WVCPMABVTHXSNQ-UHFFFAOYSA-N 50227975 CHEMBL4087775 Trace amine-associated receptor 1 Mus musculus 410 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227975 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5779&target=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227975&enzyme=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 11971703 383542725 CHEMBL4087775 1 MHLCHAITNISHRNSDWSREVQASLYSLMSLIILATLVGNLIVIISISHFKQLHTPTNWLLHSMAIVDFLLGCLIMPCSMVRTVERCWYFGEILCKVHTSTDIMLSSASIFHLAFISIDRYCAVCDPLRYKAKINISTILVMILVSWSLPAVYAFGMIFLELNLKGVEELYRSQVSDLGGCSPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIYFIAKGQARSINRTNVQVGLEGKSQAPQSKETKAAKTLGIMVGVFLVCWCPFFLCTVLDPFLGYVIPPSLNDALYWFGYLNSALNPMVYAFFYPWFRRALKMVLLGKIFQKDSSRSKLFL 8JLK,8JLJ,8ZSV,8WCC,8WCB,8WC9,8WC7,8WC6,8WC5,8WC4,8WC3 Trace amine-associated receptor 1 TAAR1_MOUSE Q923Y8 Q05A85 50676331 [#7]\[#6](-[#7])=[#7]\[#6](\[#7])=[#7]\[#6]-c1cccc(Cl)c1 InChI=1S/C9H4ClN5/c10-7-3-1-2-6(4-7)5-14-9(13)15-8(11)12/h1-4H KSRINKNOKFONET-UHFFFAOYSA-N 50227824 CHEMBL4088689 Trace amine-associated receptor 1 Mus musculus 97 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227824 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5779&target=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227824&enzyme=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 83034883 383542711 CHEMBL4088689 1 MHLCHAITNISHRNSDWSREVQASLYSLMSLIILATLVGNLIVIISISHFKQLHTPTNWLLHSMAIVDFLLGCLIMPCSMVRTVERCWYFGEILCKVHTSTDIMLSSASIFHLAFISIDRYCAVCDPLRYKAKINISTILVMILVSWSLPAVYAFGMIFLELNLKGVEELYRSQVSDLGGCSPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIYFIAKGQARSINRTNVQVGLEGKSQAPQSKETKAAKTLGIMVGVFLVCWCPFFLCTVLDPFLGYVIPPSLNDALYWFGYLNSALNPMVYAFFYPWFRRALKMVLLGKIFQKDSSRSKLFL 8JLK,8JLJ,8ZSV,8WCC,8WCB,8WC9,8WC7,8WC6,8WC5,8WC4,8WC3 Trace amine-associated receptor 1 TAAR1_MOUSE Q923Y8 Q05A85 50676332 [#7]\[#6](-[#7])=[#7]\[#6](\[#7])=[#7]\[#6]-c1ccc(Cl)c(Cl)c1 InChI=1S/C9H3Cl2N5/c10-6-2-1-5(3-7(6)11)4-15-9(14)16-8(12)13/h1-3H FFTCFUMTVQRYPQ-UHFFFAOYSA-N 50227835 CHEMBL4096403 Trace amine-associated receptor 1 Mus musculus 36 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227835 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5779&target=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227835&enzyme=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 11426470 383542719 CHEMBL4096403 1 MHLCHAITNISHRNSDWSREVQASLYSLMSLIILATLVGNLIVIISISHFKQLHTPTNWLLHSMAIVDFLLGCLIMPCSMVRTVERCWYFGEILCKVHTSTDIMLSSASIFHLAFISIDRYCAVCDPLRYKAKINISTILVMILVSWSLPAVYAFGMIFLELNLKGVEELYRSQVSDLGGCSPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIYFIAKGQARSINRTNVQVGLEGKSQAPQSKETKAAKTLGIMVGVFLVCWCPFFLCTVLDPFLGYVIPPSLNDALYWFGYLNSALNPMVYAFFYPWFRRALKMVLLGKIFQKDSSRSKLFL 8JLK,8JLJ,8ZSV,8WCC,8WCB,8WC9,8WC7,8WC6,8WC5,8WC4,8WC3 Trace amine-associated receptor 1 TAAR1_MOUSE Q923Y8 Q05A85 50676333 [#7]\[#6](-[#7])=[#7]\[#6](\[#7])=[#7]\[#6]-c1cccc(F)c1 InChI=1S/C9H4FN5/c10-7-3-1-2-6(4-7)5-14-9(13)15-8(11)12/h1-4H XVFUKANHWDOJQC-UHFFFAOYSA-N 50227826 CHEMBL4069147 Trace amine-associated receptor 1 Mus musculus 540 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227826 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5779&target=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227826&enzyme=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 83032501 383542713 CHEMBL4069147 1 MHLCHAITNISHRNSDWSREVQASLYSLMSLIILATLVGNLIVIISISHFKQLHTPTNWLLHSMAIVDFLLGCLIMPCSMVRTVERCWYFGEILCKVHTSTDIMLSSASIFHLAFISIDRYCAVCDPLRYKAKINISTILVMILVSWSLPAVYAFGMIFLELNLKGVEELYRSQVSDLGGCSPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIYFIAKGQARSINRTNVQVGLEGKSQAPQSKETKAAKTLGIMVGVFLVCWCPFFLCTVLDPFLGYVIPPSLNDALYWFGYLNSALNPMVYAFFYPWFRRALKMVLLGKIFQKDSSRSKLFL 8JLK,8JLJ,8ZSV,8WCC,8WCB,8WC9,8WC7,8WC6,8WC5,8WC4,8WC3 Trace amine-associated receptor 1 TAAR1_MOUSE Q923Y8 Q05A85 50676334 N/C(N)=N/C(N)=N/Cc1cccc(Br)c1 InChI=1S/C9H4BrN5/c10-7-3-1-2-6(4-7)5-14-9(13)15-8(11)12/h1-4H RUJHTAZRYNATNV-UHFFFAOYSA-N 50227828 CHEMBL4068661 Trace amine-associated receptor 1 Mus musculus 1800 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227828 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5779&target=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227828&enzyme=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 23637934 383542714 CHEMBL4068661 1 MHLCHAITNISHRNSDWSREVQASLYSLMSLIILATLVGNLIVIISISHFKQLHTPTNWLLHSMAIVDFLLGCLIMPCSMVRTVERCWYFGEILCKVHTSTDIMLSSASIFHLAFISIDRYCAVCDPLRYKAKINISTILVMILVSWSLPAVYAFGMIFLELNLKGVEELYRSQVSDLGGCSPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIYFIAKGQARSINRTNVQVGLEGKSQAPQSKETKAAKTLGIMVGVFLVCWCPFFLCTVLDPFLGYVIPPSLNDALYWFGYLNSALNPMVYAFFYPWFRRALKMVLLGKIFQKDSSRSKLFL 8JLK,8JLJ,8ZSV,8WCC,8WCB,8WC9,8WC7,8WC6,8WC5,8WC4,8WC3 Trace amine-associated receptor 1 TAAR1_MOUSE Q923Y8 Q05A85 50676335 NC(=N)N=C(N)Nc1ccc(Cl)cc1 |w:3.2| InChI=1S/C8H10ClN5/c9-5-1-3-6(4-2-5)13-8(12)14-7(10)11/h1-4H,(H6,10,11,12,13,14) HTYFFCPFVMJTKM-UHFFFAOYSA-N 50053595 4-Chlorophenylbiguanide::N-(4-chlorophenyl)imidodicarbonimidic diamide::4-Chloro-Phenyl biguanide::CHEMBL840 Trace amine-associated receptor 1 Homo sapiens >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50053595 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004101&target=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50053595&enzyme=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 19933 103950274 CHEMBL840 1 MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNWLIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISIDRYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRGGCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNGISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFNPMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS 8JSO,8JLR,8JLQ,8JLP,8JLO,8JLN,8ZSS,8ZSP,8ZSJ,8WCA,8WC8,8W8A,8W89,8W88,8W87 Trace amine-associated receptor 1 TAAR1_HUMAN Q96RJ0 Q2M1W5 Q3MIH8 Q5VUQ1 50676336 [#7]\[#6](-[#7])=[#7]\[#6](\[#7])=[#7]\[#6]-c1ccc(Cl)c(Cl)c1 InChI=1S/C9H3Cl2N5/c10-6-2-1-5(3-7(6)11)4-15-9(14)16-8(12)13/h1-3H FFTCFUMTVQRYPQ-UHFFFAOYSA-N 50227835 CHEMBL4096403 Trace amine-associated receptor 1 Homo sapiens 1200 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227835 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004101&target=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227835&enzyme=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 11426470 383542719 CHEMBL4096403 1 MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNWLIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISIDRYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRGGCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNGISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFNPMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS 8JSO,8JLR,8JLQ,8JLP,8JLO,8JLN,8ZSS,8ZSP,8ZSJ,8WCA,8WC8,8W8A,8W89,8W88,8W87 Trace amine-associated receptor 1 TAAR1_HUMAN Q96RJ0 Q2M1W5 Q3MIH8 Q5VUQ1 50676337 NC(=N)NC(N)=Nc1ccccc1 |w:6.6| InChI=1S/C8H11N5/c9-7(10)13-8(11)12-6-4-2-1-3-5-6/h1-5H,(H6,9,10,11,12,13) CUQCMXFWIMOWRP-UHFFFAOYSA-N 50053596 1-phenylbiguanide::Phenyl biguanide::N-phenylimidodicarbonimidic diamide::CHEMBL13791 Trace amine-associated receptor 5 Mus musculus >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50053596 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007304&target=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50053596&enzyme=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search 4780 103950275 CHEMBL13791 1 MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD Trace amine-associated receptor 5 TAAR5_MOUSE Q5QD14 50676338 NC(=N)N=C(N)Nc1ccc(Cl)cc1 |w:3.2| InChI=1S/C8H10ClN5/c9-5-1-3-6(4-2-5)13-8(12)14-7(10)11/h1-4H,(H6,10,11,12,13,14) HTYFFCPFVMJTKM-UHFFFAOYSA-N 50053595 4-Chlorophenylbiguanide::N-(4-chlorophenyl)imidodicarbonimidic diamide::4-Chloro-Phenyl biguanide::CHEMBL840 Trace amine-associated receptor 5 Mus musculus >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50053595 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007304&target=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50053595&enzyme=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search 19933 103950274 CHEMBL840 1 MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD Trace amine-associated receptor 5 TAAR5_MOUSE Q5QD14 50676343 Cc1ccc(NC(N)=NC(N)=N)cc1 |w:8.8| InChI=1S/C9H13N5/c1-6-2-4-7(5-3-6)13-9(12)14-8(10)11/h2-5H,1H3,(H6,10,11,12,13,14) ILEIGUXOYKZHRK-UHFFFAOYSA-N 50053630 N-(4-methylphenyl)imidodicarbonimidic diamide::4-Methyl-Phenyl biguanide::CHEMBL291064 Trace amine-associated receptor 5 Mus musculus >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50053630 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007304&target=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50053630&enzyme=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search 2730263 103950309 CHEMBL291064 1 MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD Trace amine-associated receptor 5 TAAR5_MOUSE Q5QD14 50676347 [#7]\[#6](-[#7])=[#7]\[#6](\[#7])=[#7]\[#6]-c1ccccc1Cl InChI=1S/C9H4ClN5/c10-7-4-2-1-3-6(7)5-14-9(13)15-8(11)12/h1-4H WVCPMABVTHXSNQ-UHFFFAOYSA-N 50227975 CHEMBL4087775 Trace amine-associated receptor 5 Mus musculus >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227975 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007304&target=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227975&enzyme=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search 11971703 383542725 CHEMBL4087775 1 MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD Trace amine-associated receptor 5 TAAR5_MOUSE Q5QD14 50676355 [#7]\[#6](-[#7])=[#7]\[#6](\[#7])=[#7]\[#6]-c1cccc(F)c1 InChI=1S/C9H4FN5/c10-7-3-1-2-6(4-7)5-14-9(13)15-8(11)12/h1-4H XVFUKANHWDOJQC-UHFFFAOYSA-N 50227826 CHEMBL4069147 Trace amine-associated receptor 5 Mus musculus >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227826 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007304&target=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227826&enzyme=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search 83032501 383542713 CHEMBL4069147 1 MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD Trace amine-associated receptor 5 TAAR5_MOUSE Q5QD14 50676357 N/C(N)=N/C(N)=N/C1CCCC1 InChI=1S/C7N5/c8-6(9)12-7(10)11-5-3-1-2-4-5 CNHGVRNMZJHMDO-UHFFFAOYSA-N 50227979 CHEMBL4084561 Trace amine-associated receptor 5 Mus musculus >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227979 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007304&target=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227979&enzyme=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search 25093 383542726 CHEMBL4084561 1 MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD Trace amine-associated receptor 5 TAAR5_MOUSE Q5QD14 50676359 [H]/N=C(\Nc1ccc(cc1)Cl)/N/C(=N\[H])/NC(C)C InChI=1S/C11H16ClN5/c1-7(2)15-10(13)17-11(14)16-9-5-3-8(12)4-6-9/h3-7H,1-2H3,(H5,13,14,15,16,17) SSOLNOMRVKKSON-UHFFFAOYSA-N 50227829 CHEBI:8455::Proguanil::CHLOROGUANIDE Trace amine-associated receptor 5 Mus musculus >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227829 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007304&target=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227829&enzyme=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search XEW 6178111 383542715 1 MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD Trace amine-associated receptor 5 TAAR5_MOUSE Q5QD14 50676361 CCc1nc(N)nc(N)c1-c1ccc(Cl)cc1 InChI=1S/C12H13ClN4/c1-2-9-10(11(14)17-12(15)16-9)7-3-5-8(13)6-4-7/h3-6H,2H2,1H3,(H4,14,15,16,17) WKSAUQYGYAYLPV-UHFFFAOYSA-N 18512 cid_4993::CHEMBL36::5-(4-chlorophenyl)-6-ethylpyrimidine-2,4-diamine::Pyrimethamine (Pyr)::US11530198, Example Pyrimethamine Trace amine-associated receptor 5 Mus musculus >10000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=18512 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007304&target=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=18512&enzyme=Trace+amine-associated+receptor+5&column=ki&startPg=0&Increment=50&submit=Search 4993 46518585 CHEMBL36 DB00205 C07391 1 MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD Trace amine-associated receptor 5 TAAR5_MOUSE Q5QD14 50676365 [#7]\[#6](-[#7])=[#7]\[#6](\[#7])=[#7]\[#6]-c1ccccc1Cl InChI=1S/C9H4ClN5/c10-7-4-2-1-3-6(7)5-14-9(13)15-8(11)12/h1-4H WVCPMABVTHXSNQ-UHFFFAOYSA-N 50227975 CHEMBL4087775 Trace amine-associated receptor 1 Homo sapiens 3000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227975 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004101&target=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227975&enzyme=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 11971703 383542725 CHEMBL4087775 1 MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNWLIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISIDRYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRGGCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNGISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFNPMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS 8JSO,8JLR,8JLQ,8JLP,8JLO,8JLN,8ZSS,8ZSP,8ZSJ,8WCA,8WC8,8W8A,8W89,8W88,8W87 Trace amine-associated receptor 1 TAAR1_HUMAN Q96RJ0 Q2M1W5 Q3MIH8 Q5VUQ1 50676367 NC(=N)NC(=N)NCc1ccccc1 InChI=1S/C9H13N5/c10-8(11)14-9(12)13-6-7-4-2-1-3-5-7/h1-5H,6H2,(H6,10,11,12,13,14) IBWXAMPUVRBFIS-UHFFFAOYSA-N 50227351 CHEMBL3628706 Trace amine-associated receptor 1 Mus musculus 780 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227351 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5779&target=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227351&enzyme=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15006 383542710 CHEMBL3628706 1 MHLCHAITNISHRNSDWSREVQASLYSLMSLIILATLVGNLIVIISISHFKQLHTPTNWLLHSMAIVDFLLGCLIMPCSMVRTVERCWYFGEILCKVHTSTDIMLSSASIFHLAFISIDRYCAVCDPLRYKAKINISTILVMILVSWSLPAVYAFGMIFLELNLKGVEELYRSQVSDLGGCSPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIYFIAKGQARSINRTNVQVGLEGKSQAPQSKETKAAKTLGIMVGVFLVCWCPFFLCTVLDPFLGYVIPPSLNDALYWFGYLNSALNPMVYAFFYPWFRRALKMVLLGKIFQKDSSRSKLFL 8JLK,8JLJ,8ZSV,8WCC,8WCB,8WC9,8WC7,8WC6,8WC5,8WC4,8WC3 Trace amine-associated receptor 1 TAAR1_MOUSE Q923Y8 Q05A85 50676370 N/C(N)=N/C(N)=N/Cc1ccc(Cl)cc1 InChI=1S/C9H4ClN5/c10-7-3-1-6(2-4-7)5-14-9(13)15-8(11)12/h1-4H OTNIXDXWHBAVJR-UHFFFAOYSA-N 50227825 CHEMBL4060464 Trace amine-associated receptor 1 Mus musculus 780 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227825 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5779&target=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227825&enzyme=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 20868 383542712 CHEMBL4060464 1 MHLCHAITNISHRNSDWSREVQASLYSLMSLIILATLVGNLIVIISISHFKQLHTPTNWLLHSMAIVDFLLGCLIMPCSMVRTVERCWYFGEILCKVHTSTDIMLSSASIFHLAFISIDRYCAVCDPLRYKAKINISTILVMILVSWSLPAVYAFGMIFLELNLKGVEELYRSQVSDLGGCSPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIYFIAKGQARSINRTNVQVGLEGKSQAPQSKETKAAKTLGIMVGVFLVCWCPFFLCTVLDPFLGYVIPPSLNDALYWFGYLNSALNPMVYAFFYPWFRRALKMVLLGKIFQKDSSRSKLFL 8JLK,8JLJ,8ZSV,8WCC,8WCB,8WC9,8WC7,8WC6,8WC5,8WC4,8WC3 Trace amine-associated receptor 1 TAAR1_MOUSE Q923Y8 Q05A85 50676378 [H]/N=C(\Nc1ccc(cc1)Cl)/N/C(=N\[H])/NC(C)C InChI=1S/C11H16ClN5/c1-7(2)15-10(13)17-11(14)16-9-5-3-8(12)4-6-9/h3-7H,1-2H3,(H5,13,14,15,16,17) SSOLNOMRVKKSON-UHFFFAOYSA-N 50227829 CHEBI:8455::Proguanil::CHLOROGUANIDE Trace amine-associated receptor 1 Mus musculus 5400 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227829 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5779&target=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227829&enzyme=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search XEW 8F4T,8ZSR,8ZXZ 6178111 383542715 1 MHLCHAITNISHRNSDWSREVQASLYSLMSLIILATLVGNLIVIISISHFKQLHTPTNWLLHSMAIVDFLLGCLIMPCSMVRTVERCWYFGEILCKVHTSTDIMLSSASIFHLAFISIDRYCAVCDPLRYKAKINISTILVMILVSWSLPAVYAFGMIFLELNLKGVEELYRSQVSDLGGCSPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIYFIAKGQARSINRTNVQVGLEGKSQAPQSKETKAAKTLGIMVGVFLVCWCPFFLCTVLDPFLGYVIPPSLNDALYWFGYLNSALNPMVYAFFYPWFRRALKMVLLGKIFQKDSSRSKLFL 8JLK,8JLJ,8ZSV,8WCC,8WCB,8WC9,8WC7,8WC6,8WC5,8WC4,8WC3 Trace amine-associated receptor 1 TAAR1_MOUSE Q923Y8 Q05A85 50676402 NC(=N)N=C(N)Nc1ccccc1Cl |w:3.2| InChI=1S/C8H10ClN5/c9-5-3-1-2-4-6(5)13-8(12)14-7(10)11/h1-4H,(H6,10,11,12,13,14) MKWFJPZMYHPQIA-UHFFFAOYSA-N 50053629 2-Chloro-Phenyl biguanide::N-(2-chlorophenyl)imidodicarbonimidic diamide::CHEMBL42752 Trace amine-associated receptor 1 Homo sapiens 1000 ChEMBL 10.1016/j.ejmech.2016.10.058 10.7270/Q2C24ZPS 27823885 Tonelli, M; Espinoza, S; Gainetdinov, RR; Cichero, E 2/15/2017 4/25/2019 University of Genoa http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50053629 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004101&target=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50053629&enzyme=Trace+amine-associated+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 29669 103950308 CHEMBL42752 1 MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNWLIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISIDRYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRGGCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNGISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFNPMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS 8JSO,8JLR,8JLQ,8JLP,8JLO,8JLN,8ZSS,8ZSP,8ZSJ,8WCA,8WC8,8W8A,8W89,8W88,8W87 Trace amine-associated receptor 1 TAAR1_HUMAN Q96RJ0 Q2M1W5 Q3MIH8 Q5VUQ1