BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
50497485	Cc1cccc(n1)CCN2CCC(CC2)C(=O)c3ccc(cc3)NS(=O)(=O)C	InChI=1S/C21H27N3O3S/c1-16-4-3-5-19(22-16)12-15-24-13-10-18(11-14-24)21(25)17-6-8-20(9-7-17)23-28(2,26)27/h3-9,18,23H,10-15H2,1-2H3	SRUISGSHWFJION-UHFFFAOYSA-N	50117930	N-(4-{1-[2-(6-Methyl-pyridin-2-yl)-ethyl]-piperidine-4-carbonyl}-phenyl)-methanesulfonamide (E-4031)::N-(4-(1-(2-(6-methylpyridin-2-yl)ethyl)piperidine-4-carbonyl)phenyl)methanesulfonamide::(4-{1-[2-(6-Methyl-pyridin-2-yl)-ethyl]-piperidine-4-carbonyl}-phenyl)-methanesulfonamide::N-(4-{1-[2-(6-Methyl-pyridin-2-yl)-ethyl]-piperidine-4-carbonyl}-phenyl)-methanesulfonamide::CHEMBL327980::E-4031::CHEMBL536480::N-(2-{1-[2-(6-Methyl-pyridin-2-yl)-ethyl]-piperidine-4-carbonyl}-phenyl)-methanesulfonamide::1-(2-(6-methylpyridin-2-yl)ethyl)-4-(4-(methylsulfonamido)benzoyl)piperidinium::US11912693, Compound E4031::US20240246972, Compound E-4031	Potassium voltage-gated channel subfamily H member 2	Homo sapiens		 70							ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50117930	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2132&target=Potassium+voltage-gated+channel+subfamily+H+member+2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50117930&enzyme=Potassium+voltage-gated+channel+subfamily+H+member+2&column=ki&startPg=0&Increment=50&submit=Search	A1L2J	8ZYP	3185	104011334		CHEMBL536480CHEMBL327980			C13776		1	MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEKDMVGSPAHDTNHRGPPTSWLAPGRAKTFRLKLPALLALTARESSVRSGGAGGAGAPGAVVVDVDLTPAAPSSESLALDEVTAMDNHVAGLGPAEERRALVGPGSPPRSAPGQLPSPRAHSLNPDASGSSCSLARTRSRESCASVRRASSADDIEAMRAGVLPPPPRHASTGAMHPLRSGLLNSTSDSDLVRYRTISKIPQITLNFVDLKGDPFLASPTSDREIIAPKIKERTHNVTEKVTQVLSLGADVLPEYKLQAPRIHRWTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLKETEEGPPATECGYACQPLAVVDLIVDIMFIVDILINFRTTYVNANEEVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEELIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNMEQPHMDSRIGWLHNLGDQIGKPYNSSGLGGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLNRSLLQHCKPFRGATKGCLRALAMKFKTTHAPPGDTLVHAGDLLTALYFISRGSIEILRGDVVVAILGKNDIFGEPLNLYARPGKSNGDVRALTYCDLHKIHRDDLLEVLDMYPEFSDHFWSSLEITFNLRDTNMIPGSPGSTELEGGFSRQRKRKLSFRRRTDKDTEQPGEVSALGPGRAGAGPSSRGRPGGPWGESPSSGPSSPESSEDEGPGRSSSPLRLVPFSSPRPPGEPPGGEPLMEDCEKSSDTCNPLSGAFSGVSNIFSFWGDSRGRQYQELPRCPAPTPSLLNIPLSSPGRRPRGDVESRLDALQRQLNRLETRLSADMATVLQLLQRQMTLVPPAYSAVTTPGPGPTSTSPLLPVSPLPTLTLDSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS	8IOB,8IO5,8IO4,5VA2,8ZYQ,8ZYP,8ZYO,8ZYN,7CN1,7CN0,5VA1,9CHS,9CHR,9CHQ,9CHP,5VA3,2L4R,4HQA,2L0W,6SYG,2N7G	Voltage-gated inwardly rectifying potassium channel KCNH2	KCNH2_HUMAN	Q12809	A5H1P7 C4PFH9 D3DX04 O75418 O75680 Q708S9 Q9BT72 Q9BUT7 Q9H3P0		Voltage-gated inwardly rectifying potassium channel KCNH2	A0A090N8Q0_HUMAN	A0A090N8Q0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																														
50497486	OC(=O)CCc1ccc(OCc2nnc(s2)C(=O)Nc2cccc(F)c2)cc1	InChI=1S/C19H16FN3O4S/c20-13-2-1-3-14(10-13)21-18(26)19-23-22-16(28-19)11-27-15-7-4-12(5-8-15)6-9-17(24)25/h1-5,7-8,10H,6,9,11H2,(H,21,26)(H,24,25)	IHRLUSNTXLBQGV-UHFFFAOYSA-N	50171832	CHEMBL3805903	Free fatty acid receptor 1	Homo sapiens				 1190					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171832	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171832&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			127050768	104058026		CHEMBL3805903					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50497487	OC(=O)CCc1ccc(OCc2nnc(s2)C(=O)Nc2ccc(Cl)cc2)cc1	InChI=1S/C19H16ClN3O4S/c20-13-4-6-14(7-5-13)21-18(26)19-23-22-16(28-19)11-27-15-8-1-12(2-9-15)3-10-17(24)25/h1-2,4-9H,3,10-11H2,(H,21,26)(H,24,25)	SPFIFEAIAHNPKY-UHFFFAOYSA-N	50171845	CHEMBL3805971	Free fatty acid receptor 1	Homo sapiens				 3690					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171845	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171845&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			127051975	104058039		CHEMBL3805971					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50497488	Cc1ccccc1NC(=O)c1nnc(COc2ccc(CCC(O)=O)cc2)s1	InChI=1S/C20H19N3O4S/c1-13-4-2-3-5-16(13)21-19(26)20-23-22-17(28-20)12-27-15-9-6-14(7-10-15)8-11-18(24)25/h2-7,9-10H,8,11-12H2,1H3,(H,21,26)(H,24,25)	WDFOWNQAXFBUIL-UHFFFAOYSA-N	50171849	CHEMBL3805668	Free fatty acid receptor 1	Homo sapiens				 1520					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171849	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171849&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			127051660	104058043		CHEMBL3805668					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50497489	OC(=O)CCc1ccc(OCc2nnc(s2)C(=O)Nc2ccc(F)cc2)cc1	InChI=1S/C19H16FN3O4S/c20-13-4-6-14(7-5-13)21-18(26)19-23-22-16(28-19)11-27-15-8-1-12(2-9-15)3-10-17(24)25/h1-2,4-9H,3,10-11H2,(H,21,26)(H,24,25)	XUSNHDNNNUMOBX-UHFFFAOYSA-N	50171853	CHEMBL3805086	Free fatty acid receptor 1	Homo sapiens				 6640					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171853	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171853&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			127051659	346548559		CHEMBL3805086					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50497490	Cc1cccc(NC(=O)c2nnc(COc3ccc(CCC(O)=O)cc3)s2)c1	InChI=1S/C20H19N3O4S/c1-13-3-2-4-15(11-13)21-19(26)20-23-22-17(28-20)12-27-16-8-5-14(6-9-16)7-10-18(24)25/h2-6,8-9,11H,7,10,12H2,1H3,(H,21,26)(H,24,25)	ARDGJUQITBHNLR-UHFFFAOYSA-N	50171855	CHEMBL3806055	Free fatty acid receptor 1	Homo sapiens				 1770					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171855	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171855&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			127049161	346548560		CHEMBL3806055					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50497491	OC(=O)CCc1ccc(OCc2nnc(s2)C(=O)Nc2ccccc2F)cc1	InChI=1S/C19H16FN3O4S/c20-14-3-1-2-4-15(14)21-18(26)19-23-22-16(28-19)11-27-13-8-5-12(6-9-13)7-10-17(24)25/h1-6,8-9H,7,10-11H2,(H,21,26)(H,24,25)	INGBGXUKWXLGIA-UHFFFAOYSA-N	50171865	CHEMBL3805888	Free fatty acid receptor 1	Homo sapiens				 580					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171865	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171865&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			127051658	346548561		CHEMBL3805888					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50497492	COc1ccc(NC(=O)c2nnc(COc3ccc(CCC(O)=O)cc3)s2)cc1	InChI=1S/C20H19N3O5S/c1-27-15-9-5-14(6-10-15)21-19(26)20-23-22-17(29-20)12-28-16-7-2-13(3-8-16)4-11-18(24)25/h2-3,5-10H,4,11-12H2,1H3,(H,21,26)(H,24,25)	PXMGNYZJDCMNED-UHFFFAOYSA-N	50171866	CHEMBL3805143	Free fatty acid receptor 1	Homo sapiens				>10000					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171866	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171866&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			127051657	346548562		CHEMBL3805143					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50497493	OC(=O)CCc1ccc(OCc2nnc(s2)C(=O)Nc2ccccc2)cc1	InChI=1S/C19H17N3O4S/c23-17(24)11-8-13-6-9-15(10-7-13)26-12-16-21-22-19(27-16)18(25)20-14-4-2-1-3-5-14/h1-7,9-10H,8,11-12H2,(H,20,25)(H,23,24)	DSDNLUBQLDRWIG-UHFFFAOYSA-N	50171867	CHEMBL3806208	Free fatty acid receptor 1	Homo sapiens				 1060					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171867	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171867&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			127051302	346548563		CHEMBL3806208					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50497494	OC(=O)CCc1nnc(s1)C(=O)Nc1ccc(OCc2ccccc2)cc1	InChI=1S/C19H17N3O4S/c23-17(24)11-10-16-21-22-19(27-16)18(25)20-14-6-8-15(9-7-14)26-12-13-4-2-1-3-5-13/h1-9H,10-12H2,(H,20,25)(H,23,24)	IOGHRSDXRXGSGD-UHFFFAOYSA-N	50171868	CHEMBL3804883	Free fatty acid receptor 1	Homo sapiens				 17940					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171868	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171868&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			127048844	346548564		CHEMBL3804883					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50497495	OC(=O)CCc1nnc(s1)C(=O)Nc1cccc(c1)-c1ccco1	InChI=1S/C16H13N3O4S/c20-14(21)7-6-13-18-19-16(24-13)15(22)17-11-4-1-3-10(9-11)12-5-2-8-23-12/h1-5,8-9H,6-7H2,(H,17,22)(H,20,21)	MGIMSZYTYYRCRN-UHFFFAOYSA-N	50171869	CHEMBL3805303	Free fatty acid receptor 1	Homo sapiens				 1640					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171869	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171869&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			127052270	346548565		CHEMBL3805303					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50497496	OC(=O)CCc1nnc(s1)C(=O)Nc1cccc(c1)-c1ccc(F)cc1	InChI=1S/C18H14FN3O3S/c19-13-6-4-11(5-7-13)12-2-1-3-14(10-12)20-17(25)18-22-21-15(26-18)8-9-16(23)24/h1-7,10H,8-9H2,(H,20,25)(H,23,24)	LBXXTDSJYRFPFG-UHFFFAOYSA-N	50171870	CHEMBL3805879	Free fatty acid receptor 1	Homo sapiens				 1280					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171870	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171870&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			127048827	346548566		CHEMBL3805879					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50497497	OC(=O)CCc1nnc(s1)C(=O)Nc1cccc(c1)-c1cccc(Cl)c1	InChI=1S/C18H14ClN3O3S/c19-13-5-1-3-11(9-13)12-4-2-6-14(10-12)20-17(25)18-22-21-15(26-18)7-8-16(23)24/h1-6,9-10H,7-8H2,(H,20,25)(H,23,24)	BFPHGTJOAXVIST-UHFFFAOYSA-N	50171871	CHEMBL3805558	Free fatty acid receptor 1	Homo sapiens				 1690					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171871	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171871&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			127048843	346548567		CHEMBL3805558					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50497498	Cc1cccc(c1)-c1cccc(NC(=O)c2nnc(CCC(O)=O)s2)c1	InChI=1S/C19H17N3O3S/c1-12-4-2-5-13(10-12)14-6-3-7-15(11-14)20-18(25)19-22-21-16(26-19)8-9-17(23)24/h2-7,10-11H,8-9H2,1H3,(H,20,25)(H,23,24)	UAEIGMSYOHQESR-UHFFFAOYSA-N	50171872	CHEMBL3805328	Free fatty acid receptor 1	Homo sapiens				 760					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171872	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171872&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			127048842	346548568		CHEMBL3805328					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50497499	OC(=O)CCc1ccc(OCc2nnc(s2)C(=O)Nc2ccc(F)c(F)c2)cc1	InChI=1S/C19H15F2N3O4S/c20-14-7-4-12(9-15(14)21)22-18(27)19-24-23-16(29-19)10-28-13-5-1-11(2-6-13)3-8-17(25)26/h1-2,4-7,9H,3,8,10H2,(H,22,27)(H,25,26)	YCKOJEXQUBDOSS-UHFFFAOYSA-N	50171873	CHEMBL3805952	Free fatty acid receptor 4	Homo sapiens				>10000					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171873	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003696&target=Free+fatty+acid+receptor+4&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171873&enzyme=Free+fatty+acid+receptor+4&column=ki&startPg=0&Increment=50&submit=Search			127050770	346548569		CHEMBL3805952					1	MSPECARAAGDAPLRSLEQANRTRFPFFSDVKGDHRLVLAAVETTVLVLIFAVSLLGNVCALVLVARRRRRGATACLVLNLFCADLLFISAIPLVLAVRWTEAWLLGPVACHLLFYVMTLSGSVTILTLAAVSLERMVCIVHLQRGVRGPGRRARAVLLALIWGYSAVAALPLCVFFRVVPQRLPGADQEISICTLIWPTIPGEISWDVSFVTLNFLVPGLVIVISYSKILQTSEHLLDARAVVTHSEITKASRKRLTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIMWSPIIITILLILIQNFKQDLVIWPSLFFWVVAFTFANSALNPILYNMTLCRNEWKKIFCCFWFPEKGAILTDTSVKRNDLSIISG	8IYS,8ID9,8ID8,8ID6,8ID4,8ID3,8H4L,8H4K,8H4I,8G59,8T3Q,8T3O	Free fatty acid receptor 4	FFAR4_HUMAN	Q5NUL3	Q495H1 Q5VY25 Q5VY26 Q7Z605 Q86SM7																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50497500	OC(=O)CCc1ccc(OCc2nnc(s2)C(=O)Nc2ccccc2F)cc1	InChI=1S/C19H16FN3O4S/c20-14-3-1-2-4-15(14)21-18(26)19-23-22-16(28-19)11-27-13-8-5-12(6-9-13)7-10-17(24)25/h1-6,8-9H,7,10-11H2,(H,21,26)(H,24,25)	INGBGXUKWXLGIA-UHFFFAOYSA-N	50171865	CHEMBL3805888	Free fatty acid receptor 4	Homo sapiens				>10000					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171865	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003696&target=Free+fatty+acid+receptor+4&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171865&enzyme=Free+fatty+acid+receptor+4&column=ki&startPg=0&Increment=50&submit=Search			127051658	346548561		CHEMBL3805888					1	MSPECARAAGDAPLRSLEQANRTRFPFFSDVKGDHRLVLAAVETTVLVLIFAVSLLGNVCALVLVARRRRRGATACLVLNLFCADLLFISAIPLVLAVRWTEAWLLGPVACHLLFYVMTLSGSVTILTLAAVSLERMVCIVHLQRGVRGPGRRARAVLLALIWGYSAVAALPLCVFFRVVPQRLPGADQEISICTLIWPTIPGEISWDVSFVTLNFLVPGLVIVISYSKILQTSEHLLDARAVVTHSEITKASRKRLTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIMWSPIIITILLILIQNFKQDLVIWPSLFFWVVAFTFANSALNPILYNMTLCRNEWKKIFCCFWFPEKGAILTDTSVKRNDLSIISG	8IYS,8ID9,8ID8,8ID6,8ID4,8ID3,8H4L,8H4K,8H4I,8G59,8T3Q,8T3O	Free fatty acid receptor 4	FFAR4_HUMAN	Q5NUL3	Q495H1 Q5VY25 Q5VY26 Q7Z605 Q86SM7																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50497501	OC(=O)CCc1nnc(s1)C(=O)Nc1cccc(c1)-c1ccc(F)cc1	InChI=1S/C18H14FN3O3S/c19-13-6-4-11(5-7-13)12-2-1-3-14(10-12)20-17(25)18-22-21-15(26-18)8-9-16(23)24/h1-7,10H,8-9H2,(H,20,25)(H,23,24)	LBXXTDSJYRFPFG-UHFFFAOYSA-N	50171870	CHEMBL3805879	Free fatty acid receptor 4	Homo sapiens				>10000					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171870	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003696&target=Free+fatty+acid+receptor+4&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171870&enzyme=Free+fatty+acid+receptor+4&column=ki&startPg=0&Increment=50&submit=Search			127048827	346548566		CHEMBL3805879					1	MSPECARAAGDAPLRSLEQANRTRFPFFSDVKGDHRLVLAAVETTVLVLIFAVSLLGNVCALVLVARRRRRGATACLVLNLFCADLLFISAIPLVLAVRWTEAWLLGPVACHLLFYVMTLSGSVTILTLAAVSLERMVCIVHLQRGVRGPGRRARAVLLALIWGYSAVAALPLCVFFRVVPQRLPGADQEISICTLIWPTIPGEISWDVSFVTLNFLVPGLVIVISYSKILQTSEHLLDARAVVTHSEITKASRKRLTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIMWSPIIITILLILIQNFKQDLVIWPSLFFWVVAFTFANSALNPILYNMTLCRNEWKKIFCCFWFPEKGAILTDTSVKRNDLSIISG	8IYS,8ID9,8ID8,8ID6,8ID4,8ID3,8H4L,8H4K,8H4I,8G59,8T3Q,8T3O	Free fatty acid receptor 4	FFAR4_HUMAN	Q5NUL3	Q495H1 Q5VY25 Q5VY26 Q7Z605 Q86SM7																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50497502	Cc1cccc(c1)-c1cccc(NC(=O)c2nnc(CCC(O)=O)s2)c1	InChI=1S/C19H17N3O3S/c1-12-4-2-5-13(10-12)14-6-3-7-15(11-14)20-18(25)19-22-21-16(26-19)8-9-17(23)24/h2-7,10-11H,8-9H2,1H3,(H,20,25)(H,23,24)	UAEIGMSYOHQESR-UHFFFAOYSA-N	50171872	CHEMBL3805328	Free fatty acid receptor 4	Homo sapiens				>10000					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171872	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003696&target=Free+fatty+acid+receptor+4&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171872&enzyme=Free+fatty+acid+receptor+4&column=ki&startPg=0&Increment=50&submit=Search			127048842	346548568		CHEMBL3805328					1	MSPECARAAGDAPLRSLEQANRTRFPFFSDVKGDHRLVLAAVETTVLVLIFAVSLLGNVCALVLVARRRRRGATACLVLNLFCADLLFISAIPLVLAVRWTEAWLLGPVACHLLFYVMTLSGSVTILTLAAVSLERMVCIVHLQRGVRGPGRRARAVLLALIWGYSAVAALPLCVFFRVVPQRLPGADQEISICTLIWPTIPGEISWDVSFVTLNFLVPGLVIVISYSKILQTSEHLLDARAVVTHSEITKASRKRLTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIMWSPIIITILLILIQNFKQDLVIWPSLFFWVVAFTFANSALNPILYNMTLCRNEWKKIFCCFWFPEKGAILTDTSVKRNDLSIISG	8IYS,8ID9,8ID8,8ID6,8ID4,8ID3,8H4L,8H4K,8H4I,8G59,8T3Q,8T3O	Free fatty acid receptor 4	FFAR4_HUMAN	Q5NUL3	Q495H1 Q5VY25 Q5VY26 Q7Z605 Q86SM7																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50497503	OC(=O)CCc1ccc(OCc2nnc(s2)C(=O)Nc2ccc(F)c(F)c2)cc1	InChI=1S/C19H15F2N3O4S/c20-14-7-4-12(9-15(14)21)22-18(27)19-24-23-16(29-19)10-28-13-5-1-11(2-6-13)3-8-17(25)26/h1-2,4-7,9H,3,8,10H2,(H,22,27)(H,25,26)	YCKOJEXQUBDOSS-UHFFFAOYSA-N	50171873	CHEMBL3805952	Free fatty acid receptor 2	Homo sapiens				>10000					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171873	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003610&target=Free+fatty+acid+receptor+2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171873&enzyme=Free+fatty+acid+receptor+2&column=ki&startPg=0&Increment=50&submit=Search			127050770	346548569		CHEMBL3805952					1	MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLLLLPFKIIEAASNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLSRRPLYGVIAALVAWVMSFGHCTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVRLELCLVLFFIPMAVTIFCYWRFVWIMLSQPLVGAQRRRRAVGLAVVTLLNFLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE	9NS9,9CM7,9CM3,9CLW,9K1D,8Y6W,8T3S,8Y6Y	Free fatty acid receptor 2	FFAR2_HUMAN	O15552	B0M0J9 Q4VAZ3 Q4VAZ5 Q4VBL5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50497504	OC(=O)CCc1ccc(OCc2nnc(s2)C(=O)Nc2ccccc2F)cc1	InChI=1S/C19H16FN3O4S/c20-14-3-1-2-4-15(14)21-18(26)19-23-22-16(28-19)11-27-13-8-5-12(6-9-13)7-10-17(24)25/h1-6,8-9H,7,10-11H2,(H,21,26)(H,24,25)	INGBGXUKWXLGIA-UHFFFAOYSA-N	50171865	CHEMBL3805888	Free fatty acid receptor 2	Homo sapiens				>10000					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171865	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003610&target=Free+fatty+acid+receptor+2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171865&enzyme=Free+fatty+acid+receptor+2&column=ki&startPg=0&Increment=50&submit=Search			127051658	346548561		CHEMBL3805888					1	MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLLLLPFKIIEAASNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLSRRPLYGVIAALVAWVMSFGHCTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVRLELCLVLFFIPMAVTIFCYWRFVWIMLSQPLVGAQRRRRAVGLAVVTLLNFLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE	9NS9,9CM7,9CM3,9CLW,9K1D,8Y6W,8T3S,8Y6Y	Free fatty acid receptor 2	FFAR2_HUMAN	O15552	B0M0J9 Q4VAZ3 Q4VAZ5 Q4VBL5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50497505	OC(=O)CCc1nnc(s1)C(=O)Nc1cccc(c1)-c1ccc(F)cc1	InChI=1S/C18H14FN3O3S/c19-13-6-4-11(5-7-13)12-2-1-3-14(10-12)20-17(25)18-22-21-15(26-18)8-9-16(23)24/h1-7,10H,8-9H2,(H,20,25)(H,23,24)	LBXXTDSJYRFPFG-UHFFFAOYSA-N	50171870	CHEMBL3805879	Free fatty acid receptor 2	Homo sapiens				>10000					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171870	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003610&target=Free+fatty+acid+receptor+2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171870&enzyme=Free+fatty+acid+receptor+2&column=ki&startPg=0&Increment=50&submit=Search			127048827	346548566		CHEMBL3805879					1	MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLLLLPFKIIEAASNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLSRRPLYGVIAALVAWVMSFGHCTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVRLELCLVLFFIPMAVTIFCYWRFVWIMLSQPLVGAQRRRRAVGLAVVTLLNFLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE	9NS9,9CM7,9CM3,9CLW,9K1D,8Y6W,8T3S,8Y6Y	Free fatty acid receptor 2	FFAR2_HUMAN	O15552	B0M0J9 Q4VAZ3 Q4VAZ5 Q4VBL5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50497506	Cc1cccc(c1)-c1cccc(NC(=O)c2nnc(CCC(O)=O)s2)c1	InChI=1S/C19H17N3O3S/c1-12-4-2-5-13(10-12)14-6-3-7-15(11-14)20-18(25)19-22-21-16(26-19)8-9-17(23)24/h2-7,10-11H,8-9H2,1H3,(H,20,25)(H,23,24)	UAEIGMSYOHQESR-UHFFFAOYSA-N	50171872	CHEMBL3805328	Free fatty acid receptor 2	Homo sapiens				>10000					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171872	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003610&target=Free+fatty+acid+receptor+2&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171872&enzyme=Free+fatty+acid+receptor+2&column=ki&startPg=0&Increment=50&submit=Search			127048842	346548568		CHEMBL3805328					1	MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLLLLPFKIIEAASNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLSRRPLYGVIAALVAWVMSFGHCTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVRLELCLVLFFIPMAVTIFCYWRFVWIMLSQPLVGAQRRRRAVGLAVVTLLNFLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE	9NS9,9CM7,9CM3,9CLW,9K1D,8Y6W,8T3S,8Y6Y	Free fatty acid receptor 2	FFAR2_HUMAN	O15552	B0M0J9 Q4VAZ3 Q4VAZ5 Q4VBL5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50497507	OC(=O)CCc1ccc(OCc2nnc(s2)C(=O)Nc2ccc(F)c(F)c2)cc1	InChI=1S/C19H15F2N3O4S/c20-14-7-4-12(9-15(14)21)22-18(27)19-24-23-16(29-19)10-28-13-5-1-11(2-6-13)3-8-17(25)26/h1-2,4-7,9H,3,8,10H2,(H,22,27)(H,25,26)	YCKOJEXQUBDOSS-UHFFFAOYSA-N	50171873	CHEMBL3805952	Free fatty acid receptor 3	Homo sapiens				>10000					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171873	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003609&target=Free+fatty+acid+receptor+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171873&enzyme=Free+fatty+acid+receptor+3&column=ki&startPg=0&Increment=50&submit=Search			127050770	346548569		CHEMBL3805952					1	MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLQRRPVAVDVLLLNLTASDLLLLLFLPFRMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHPLWYKTRPRLGQAGLVSVACWLLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFRKDQLAILLPVRLEMAVVLFVVPLIITSYCYSRLVWILGRGGSHRRQRRVAGLLAATLLNFLVCFGPYNVSHVVGYICGESPAWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES		Free fatty acid receptor 3	FFAR3_HUMAN	O14843	B2RWM8 Q14CM7																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50497508	OC(=O)CCc1ccc(OCc2nnc(s2)C(=O)Nc2ccccc2F)cc1	InChI=1S/C19H16FN3O4S/c20-14-3-1-2-4-15(14)21-18(26)19-23-22-16(28-19)11-27-13-8-5-12(6-9-13)7-10-17(24)25/h1-6,8-9H,7,10-11H2,(H,21,26)(H,24,25)	INGBGXUKWXLGIA-UHFFFAOYSA-N	50171865	CHEMBL3805888	Free fatty acid receptor 3	Homo sapiens				>10000					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171865	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003609&target=Free+fatty+acid+receptor+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171865&enzyme=Free+fatty+acid+receptor+3&column=ki&startPg=0&Increment=50&submit=Search			127051658	346548561		CHEMBL3805888					1	MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLQRRPVAVDVLLLNLTASDLLLLLFLPFRMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHPLWYKTRPRLGQAGLVSVACWLLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFRKDQLAILLPVRLEMAVVLFVVPLIITSYCYSRLVWILGRGGSHRRQRRVAGLLAATLLNFLVCFGPYNVSHVVGYICGESPAWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES		Free fatty acid receptor 3	FFAR3_HUMAN	O14843	B2RWM8 Q14CM7																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50497509	OC(=O)CCc1nnc(s1)C(=O)Nc1cccc(c1)-c1ccc(F)cc1	InChI=1S/C18H14FN3O3S/c19-13-6-4-11(5-7-13)12-2-1-3-14(10-12)20-17(25)18-22-21-15(26-18)8-9-16(23)24/h1-7,10H,8-9H2,(H,20,25)(H,23,24)	LBXXTDSJYRFPFG-UHFFFAOYSA-N	50171870	CHEMBL3805879	Free fatty acid receptor 3	Homo sapiens				>10000					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171870	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003609&target=Free+fatty+acid+receptor+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171870&enzyme=Free+fatty+acid+receptor+3&column=ki&startPg=0&Increment=50&submit=Search			127048827	346548566		CHEMBL3805879					1	MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLQRRPVAVDVLLLNLTASDLLLLLFLPFRMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHPLWYKTRPRLGQAGLVSVACWLLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFRKDQLAILLPVRLEMAVVLFVVPLIITSYCYSRLVWILGRGGSHRRQRRVAGLLAATLLNFLVCFGPYNVSHVVGYICGESPAWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES		Free fatty acid receptor 3	FFAR3_HUMAN	O14843	B2RWM8 Q14CM7																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50497510	Cc1cccc(c1)-c1cccc(NC(=O)c2nnc(CCC(O)=O)s2)c1	InChI=1S/C19H17N3O3S/c1-12-4-2-5-13(10-12)14-6-3-7-15(11-14)20-18(25)19-22-21-16(26-19)8-9-17(23)24/h2-7,10-11H,8-9H2,1H3,(H,20,25)(H,23,24)	UAEIGMSYOHQESR-UHFFFAOYSA-N	50171872	CHEMBL3805328	Free fatty acid receptor 3	Homo sapiens				>10000					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171872	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003609&target=Free+fatty+acid+receptor+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171872&enzyme=Free+fatty+acid+receptor+3&column=ki&startPg=0&Increment=50&submit=Search			127048842	346548568		CHEMBL3805328					1	MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLQRRPVAVDVLLLNLTASDLLLLLFLPFRMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHPLWYKTRPRLGQAGLVSVACWLLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFRKDQLAILLPVRLEMAVVLFVVPLIITSYCYSRLVWILGRGGSHRRQRRVAGLLAATLLNFLVCFGPYNVSHVVGYICGESPAWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES		Free fatty acid receptor 3	FFAR3_HUMAN	O14843	B2RWM8 Q14CM7																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50497511	OC(=O)CCc1ccc(OCc2nnc(s2)C(=O)Nc2cccc(Cl)c2)cc1	InChI=1S/C19H16ClN3O4S/c20-13-2-1-3-14(10-13)21-18(26)19-23-22-16(28-19)11-27-15-7-4-12(5-8-15)6-9-17(24)25/h1-5,7-8,10H,6,9,11H2,(H,21,26)(H,24,25)	RPISYXBMNDONPQ-UHFFFAOYSA-N	50171874	CHEMBL3805377	Free fatty acid receptor 1	Homo sapiens				 10620					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171874	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171874&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			127049498	346548570		CHEMBL3805377					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50497512	Cc1ccc(NC(=O)c2nnc(COc3ccc(CCC(O)=O)cc3)s2)cc1	InChI=1S/C20H19N3O4S/c1-13-2-7-15(8-3-13)21-19(26)20-23-22-17(28-20)12-27-16-9-4-14(5-10-16)6-11-18(24)25/h2-5,7-10H,6,11-12H2,1H3,(H,21,26)(H,24,25)	BBNPGAUNMABYSN-UHFFFAOYSA-N	50171875	CHEMBL3805246	Free fatty acid receptor 1	Homo sapiens				 4300					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171875	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171875&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			127050771	346548571		CHEMBL3805246					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50497513	OC(=O)CCc1ccc(OCc2nnc(s2)C(=O)Nc2ccc(F)c(F)c2)cc1	InChI=1S/C19H15F2N3O4S/c20-14-7-4-12(9-15(14)21)22-18(27)19-24-23-16(29-19)10-28-13-5-1-11(2-6-13)3-8-17(25)26/h1-2,4-7,9H,3,8,10H2,(H,22,27)(H,25,26)	YCKOJEXQUBDOSS-UHFFFAOYSA-N	50171873	CHEMBL3805952	Free fatty acid receptor 1	Homo sapiens				 580					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171873	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171873&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			127050770	346548569		CHEMBL3805952					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50497514	COc1cccc(NC(=O)c2nnc(COc3ccc(CCC(O)=O)cc3)s2)c1	InChI=1S/C20H19N3O5S/c1-27-16-4-2-3-14(11-16)21-19(26)20-23-22-17(29-20)12-28-15-8-5-13(6-9-15)7-10-18(24)25/h2-6,8-9,11H,7,10,12H2,1H3,(H,21,26)(H,24,25)	VMBYOAHINYELHI-UHFFFAOYSA-N	50171876	CHEMBL3805670	Free fatty acid receptor 1	Homo sapiens				 4680					ChEMBL	10.1016/j.bmc.2016.04.065	10.7270/Q2SB47PK	27229618			Krasavin, M; Lukin, A; Zhurilo, N; Kovalenko, A; Zahanich, I; Zozulya, S; Moore, D; Tikhonova, IG	6/9/2016	9/4/2017	Saint Petersburg State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50171876	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=488&target=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50171876&enzyme=Free+fatty+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			127050769	346548572		CHEMBL3805670					1	MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK	9K1C,8T3V	Free fatty acid receptor 1	FFAR1_HUMAN	O14842	Q0VAS2 Q4VBL4																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
