BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50488521 OC(C1CCN(CC1)C(=O)Oc1ccc(cc1)[N+]([O-])=O)(c1ccc2OCOc2c1)c1ccc2OCOc2c1 InChI=1S/C27H24N2O9/c30-26(38-21-5-3-20(4-6-21)29(32)33)28-11-9-17(10-12-28)27(31,18-1-7-22-24(13-18)36-15-34-22)19-2-8-23-25(14-19)37-16-35-23/h1-8,13-14,17,31H,9-12,15-16H2 SEGYOKHGGFKMCX-UHFFFAOYSA-N 60622 BDBM50300355::US9133148, A::US11753371, Compound JZL-184 Fatty-acid amide hydrolase 1 Mus musculus >10000 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=60622 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3113&target=Fatty-acid+amide+hydrolase+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=60622&enzyme=Fatty-acid+amide+hydrolase+1&column=ki&startPg=0&Increment=50&submit=Search 25021165 315662699 1 MVLSEVWTALSGLSGVCLACSLLSAAVVLRWTRSQTARGAVTRARQKQRAGLETMDKAVQRFRLQNPDLDSEALLALPLLQLVQKLQSGELSPEAVLFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHASTLGLSLNEGVTSESDCVVVQVLKLQGAVPFVHTNVPQSMLSYDCSNPLFGQTMNPWKPSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKSCVYGQTAVQLSVGPMARDVDSLALCMKALLCEDLFRLDSTIPPLPFREEIYRSSRPLRVGYYETDNYTMPTPAMRRAVMETKQSLEAAGHTLVPFLPNNIPYALEVLSAGGLFSDGGCSFLQNFKGDFVDPCLGDLVLVLKLPRWFKKLLSFLLKPLFPRLAAFLNSMCPRSAEKLWELQHEIEMYRQSVIAQWKAMNLDVVLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMEHYKGYFGDMWDNILKKGMKKGIGLPVAVQCVALPWQEELCLRFMREVERLMTPEKRPS 2VYA,2WAP Fatty-acid amide hydrolase 1 FAAH1_MOUSE O08914 Q922S0 Q9DBF5 50488522 COc1ccc(cc1)[C@@H]1[C@H](C(=O)N1C1CCN(CC1)C(=O)n1cncn1)c1ccc(OC)cc1 |r| InChI=1S/C25H27N5O4/c1-33-20-7-3-17(4-8-20)22-23(18-5-9-21(34-2)10-6-18)30(24(22)31)19-11-13-28(14-12-19)25(32)29-16-26-15-27-29/h3-10,15-16,19,22-23H,11-14H2,1-2H3 IMVFDAJMJNKUIX-UHFFFAOYSA-N 50160277 CHEMBL3785536 Fatty-acid amide hydrolase 1 [30-579] Rattus norvegicus 3678 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160277 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=999&target=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160277&enzyme=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search 127034179 340134708 CHEMBL3785536 1 RWTGRQKARGAATRARQKQRASLETMDKAVQRFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSLLLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS 4HBP,3QKV,3QK5,3QJ9,3QJ8,1MT5 Fatty-acid amide hydrolase 1 FAAH1_RAT P97612 Q5BKA3 50488523 COc1ccc(cc1OC)[C@@H]1[C@H](C(=O)N1C1CCN(CC1)C(=O)n1cncn1)c1ccc(OC)c(OC)c1 |r| InChI=1S/C27H31N5O6/c1-35-20-7-5-17(13-22(20)37-3)24-25(18-6-8-21(36-2)23(14-18)38-4)32(26(24)33)19-9-11-30(12-10-19)27(34)31-16-28-15-29-31/h5-8,13-16,19,24-25H,9-12H2,1-4H3 DEZRMSYXDKDCBR-UHFFFAOYSA-N 50160278 CHEMBL3786142 Fatty-acid amide hydrolase 1 [30-579] Rattus norvegicus >10000 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160278 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=999&target=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160278&enzyme=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search 127034178 340134709 CHEMBL3786142 1 RWTGRQKARGAATRARQKQRASLETMDKAVQRFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSLLLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS 4HBP,3QKV,3QK5,3QJ9,3QJ8,1MT5 Fatty-acid amide hydrolase 1 FAAH1_RAT P97612 Q5BKA3 50488524 COc1ccc(cc1)[C@@H]1[C@H](N(C2CCN(CC2)C(=O)n2cncn2)C1=O)c1ccc(OC)c(OC)c1 |r| InChI=1S/C26H29N5O5/c1-34-20-7-4-17(5-8-20)23-24(18-6-9-21(35-2)22(14-18)36-3)31(25(23)32)19-10-12-29(13-11-19)26(33)30-16-27-15-28-30/h4-9,14-16,19,23-24H,10-13H2,1-3H3 VIFSKVIAVYCQIJ-UHFFFAOYSA-N 50160279 CHEMBL3787224 Fatty-acid amide hydrolase 1 [30-579] Rattus norvegicus 725 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160279 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=999&target=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160279&enzyme=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search 127034177 340134710 CHEMBL3787224 1 RWTGRQKARGAATRARQKQRASLETMDKAVQRFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSLLLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS 4HBP,3QKV,3QK5,3QJ9,3QJ8,1MT5 Fatty-acid amide hydrolase 1 FAAH1_RAT P97612 Q5BKA3 50488525 COc1ccc(cc1)[C@@H]1[C@H](N(C2CCN(CC2)C(=O)n2cncn2)C1=O)c1ccc2OCOc2c1 |r| InChI=1S/C25H25N5O5/c1-33-19-5-2-16(3-6-19)22-23(17-4-7-20-21(12-17)35-15-34-20)30(24(22)31)18-8-10-28(11-9-18)25(32)29-14-26-13-27-29/h2-7,12-14,18,22-23H,8-11,15H2,1H3 AYQMKQZYNLGZEY-UHFFFAOYSA-N 50160280 CHEMBL3787340 Fatty-acid amide hydrolase 1 [30-579] Rattus norvegicus 2590 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160280 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=999&target=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160280&enzyme=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search 127032422 340134711 CHEMBL3787340 1 RWTGRQKARGAATRARQKQRASLETMDKAVQRFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSLLLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS 4HBP,3QKV,3QK5,3QJ9,3QJ8,1MT5 Fatty-acid amide hydrolase 1 FAAH1_RAT P97612 Q5BKA3 50488526 Fc1ccc(cc1)[C@@H]1[C@H](N(C2CCN(CC2)C(=O)OC(C(F)(F)F)C(F)(F)F)C1=O)c1ccc2OCOc2c1 |r| InChI=1S/C25H21F7N2O5/c26-15-4-1-13(2-5-15)19-20(14-3-6-17-18(11-14)38-12-37-17)34(21(19)35)16-7-9-33(10-8-16)23(36)39-22(24(27,28)29)25(30,31)32/h1-6,11,16,19-20,22H,7-10,12H2 TUYXGEIPLNTUBT-UHFFFAOYSA-N 50160281 CHEMBL3787592 Fatty-acid amide hydrolase 1 [30-579] Rattus norvegicus >50000 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160281 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=999&target=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160281&enzyme=Fatty-acid+amide+hydrolase+1+%5B30-579%5D&column=ki&startPg=0&Increment=50&submit=Search 127030394 340134712 CHEMBL3787592 1 RWTGRQKARGAATRARQKQRASLETMDKAVQRFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSLLLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMKNSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS 4HBP,3QKV,3QK5,3QJ9,3QJ8,1MT5 Fatty-acid amide hydrolase 1 FAAH1_RAT P97612 Q5BKA3 50488527 [O-][N+](=O)c1ccc(OC(=O)N2CCC(CC2)N2[C@@H]([C@H](C2=O)c2ccc(F)cc2)c2ccc3OCOc3c2)cc1 |r| InChI=1S/C28H24FN3O7/c29-19-4-1-17(2-5-19)25-26(18-3-10-23-24(15-18)38-16-37-23)31(27(25)33)20-11-13-30(14-12-20)28(34)39-22-8-6-21(7-9-22)32(35)36/h1-10,15,20,25-26H,11-14,16H2 CQUBMTHPOONKSG-UHFFFAOYSA-N 50160282 CHEMBL3785760 Fatty-acid amide hydrolase 1 Homo sapiens >10000 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160282 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=354&target=Fatty-acid+amide+hydrolase+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160282&enzyme=Fatty-acid+amide+hydrolase+1&column=ki&startPg=0&Increment=50&submit=Search 127030392 340134713 CHEMBL3785760 1 MVQYELWAALPGASGVALACCFVAAAVALRWSGRRTARGAVVRARQRQRAGLENMDRAAQRFRLQNPDLDSEALLALPLPQLVQKLHSRELAPEAVLFTYVGKAWEVNKGTNCVTSYLADCETQLSQAPRQGLLYGVPVSLKECFTYKGQDSTLGLSLNEGVPAECDSVVVHVLKLQGAVPFVHTNVPQSMFSYDCSNPLFGQTVNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSSFCGICGLKPTGNRLSKSGLKGCVYGQEAVRLSVGPMARDVESLALCLRALLCEDMFRLDPTVPPLPFREEVYTSSQPLRVGYYETDNYTMPSPAMRRAVLETKQSLEAAGHTLVPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILKLPQWLKGLLAFLVKPLLPRLSAFLSNMKSRSAGKLWELQHEIEVYRKTVIAQWRALDLDVVLTPMLAPALDLNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMKKSVGLPVAVQCVALPWQEELCLRFMREVERLMTPEKQSS Fatty-acid amide hydrolase 1 FAAH1_HUMAN O00519 D3DQ19 Q52M86 Q5TDF8 50488528 Fc1ccc(cc1)[C@H]1[C@@H](N(C2CCN(CC2)C(=O)n2cncn2)C1=O)c1ccc2OCOc2c1 |r| InChI=1S/C24H22FN5O4/c25-17-4-1-15(2-5-17)21-22(16-3-6-19-20(11-16)34-14-33-19)30(23(21)31)18-7-9-28(10-8-18)24(32)29-13-26-12-27-29/h1-6,11-13,18,21-22H,7-10,14H2 XRIROGBLGLPXQI-UHFFFAOYSA-N 50160283 CHEMBL3787346 Fatty-acid amide hydrolase 1 Homo sapiens 7740 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160283 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=354&target=Fatty-acid+amide+hydrolase+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160283&enzyme=Fatty-acid+amide+hydrolase+1&column=ki&startPg=0&Increment=50&submit=Search 127030391 340134714 CHEMBL3787346 1 MVQYELWAALPGASGVALACCFVAAAVALRWSGRRTARGAVVRARQRQRAGLENMDRAAQRFRLQNPDLDSEALLALPLPQLVQKLHSRELAPEAVLFTYVGKAWEVNKGTNCVTSYLADCETQLSQAPRQGLLYGVPVSLKECFTYKGQDSTLGLSLNEGVPAECDSVVVHVLKLQGAVPFVHTNVPQSMFSYDCSNPLFGQTVNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSSFCGICGLKPTGNRLSKSGLKGCVYGQEAVRLSVGPMARDVESLALCLRALLCEDMFRLDPTVPPLPFREEVYTSSQPLRVGYYETDNYTMPSPAMRRAVLETKQSLEAAGHTLVPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILKLPQWLKGLLAFLVKPLLPRLSAFLSNMKSRSAGKLWELQHEIEVYRKTVIAQWRALDLDVVLTPMLAPALDLNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMKKSVGLPVAVQCVALPWQEELCLRFMREVERLMTPEKQSS Fatty-acid amide hydrolase 1 FAAH1_HUMAN O00519 D3DQ19 Q52M86 Q5TDF8 50488529 Fc1ccc(cc1)[C@@H]1[C@H](N(C2CCN(CC2)C(=O)n2cncn2)C1=O)c1ccc2OCOc2c1 |r| InChI=1S/C24H22FN5O4/c25-17-4-1-15(2-5-17)21-22(16-3-6-19-20(11-16)34-14-33-19)30(23(21)31)18-7-9-28(10-8-18)24(32)29-13-26-12-27-29/h1-6,11-13,18,21-22H,7-10,14H2 XRIROGBLGLPXQI-UHFFFAOYSA-N 50160284 CHEMBL3785379 Fatty-acid amide hydrolase 1 Homo sapiens 4050 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160284 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=354&target=Fatty-acid+amide+hydrolase+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160284&enzyme=Fatty-acid+amide+hydrolase+1&column=ki&startPg=0&Increment=50&submit=Search 127032456 340134715 CHEMBL3785379 1 MVQYELWAALPGASGVALACCFVAAAVALRWSGRRTARGAVVRARQRQRAGLENMDRAAQRFRLQNPDLDSEALLALPLPQLVQKLHSRELAPEAVLFTYVGKAWEVNKGTNCVTSYLADCETQLSQAPRQGLLYGVPVSLKECFTYKGQDSTLGLSLNEGVPAECDSVVVHVLKLQGAVPFVHTNVPQSMFSYDCSNPLFGQTVNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSSFCGICGLKPTGNRLSKSGLKGCVYGQEAVRLSVGPMARDVESLALCLRALLCEDMFRLDPTVPPLPFREEVYTSSQPLRVGYYETDNYTMPSPAMRRAVLETKQSLEAAGHTLVPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILKLPQWLKGLLAFLVKPLLPRLSAFLSNMKSRSAGKLWELQHEIEVYRKTVIAQWRALDLDVVLTPMLAPALDLNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMKKSVGLPVAVQCVALPWQEELCLRFMREVERLMTPEKQSS Fatty-acid amide hydrolase 1 FAAH1_HUMAN O00519 D3DQ19 Q52M86 Q5TDF8 50488530 Fc1ccc(cc1)[C@@H]1[C@H](N(C2CCN(CC2)C(=O)n2cncn2)C1=O)c1ccc2OCOc2c1 |r| InChI=1S/C24H22FN5O4/c25-17-4-1-15(2-5-17)21-22(16-3-6-19-20(11-16)34-14-33-19)30(23(21)31)18-7-9-28(10-8-18)24(32)29-13-26-12-27-29/h1-6,11-13,18,21-22H,7-10,14H2 XRIROGBLGLPXQI-UHFFFAOYSA-N 50160284 CHEMBL3785379 Fatty-acid amide hydrolase 1 Homo sapiens 4050 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160284 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=354&target=Fatty-acid+amide+hydrolase+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160284&enzyme=Fatty-acid+amide+hydrolase+1&column=ki&startPg=0&Increment=50&submit=Search 127032456 340134715 CHEMBL3785379 1 MVQYELWAALPGASGVALACCFVAAAVALRWSGRRTARGAVVRARQRQRAGLENMDRAAQRFRLQNPDLDSEALLALPLPQLVQKLHSRELAPEAVLFTYVGKAWEVNKGTNCVTSYLADCETQLSQAPRQGLLYGVPVSLKECFTYKGQDSTLGLSLNEGVPAECDSVVVHVLKLQGAVPFVHTNVPQSMFSYDCSNPLFGQTVNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSSFCGICGLKPTGNRLSKSGLKGCVYGQEAVRLSVGPMARDVESLALCLRALLCEDMFRLDPTVPPLPFREEVYTSSQPLRVGYYETDNYTMPSPAMRRAVLETKQSLEAAGHTLVPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILKLPQWLKGLLAFLVKPLLPRLSAFLSNMKSRSAGKLWELQHEIEVYRKTVIAQWRALDLDVVLTPMLAPALDLNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMKKSVGLPVAVQCVALPWQEELCLRFMREVERLMTPEKQSS Fatty-acid amide hydrolase 1 FAAH1_HUMAN O00519 D3DQ19 Q52M86 Q5TDF8 50488531 Fc1ccc(cc1)[C@@H]1[C@H](N(C2CCN(CC2)C(=O)n2cncn2)C1=O)c1ccc2OCOc2c1 |r| InChI=1S/C24H22FN5O4/c25-17-4-1-15(2-5-17)21-22(16-3-6-19-20(11-16)34-14-33-19)30(23(21)31)18-7-9-28(10-8-18)24(32)29-13-26-12-27-29/h1-6,11-13,18,21-22H,7-10,14H2 XRIROGBLGLPXQI-UHFFFAOYSA-N 50160284 CHEMBL3785379 Monoglyceride lipase Rattus norvegicus 0.250000 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160284 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4873&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160284&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 127032456 340134715 CHEMBL3785379 1 MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDELAQMLKRLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDLLQHVNTVQKDYPEVPVFLLGHSMGGAISILAAAERPTHFSGMILISPLILANPESASTLKVLAAKLLNFVLPNISLGRIDSSVLSRNKSEVDLYNSDPLICHAGVKVCFGIQLLNAVSRVERAMPRLTLPFLLLQGSADRLCDSKGAYLLMESSPSQDKTLKMYEGAYHVLHKELPEVTNSVLHEINTWVSHRIAVAGARCLP Monoglyceride lipase MGLL_RAT Q8R431 Q32PZ2 50488532 Fc1ccc(cc1)[C@@H]1[C@H](N(C2CCN(CC2)C(=O)OC(C(F)(F)F)C(F)(F)F)C1=O)c1ccc2OCOc2c1 |r| InChI=1S/C25H21F7N2O5/c26-15-4-1-13(2-5-15)19-20(14-3-6-17-18(11-14)38-12-37-17)34(21(19)35)16-7-9-33(10-8-16)23(36)39-22(24(27,28)29)25(30,31)32/h1-6,11,16,19-20,22H,7-10,12H2 TUYXGEIPLNTUBT-UHFFFAOYSA-N 50160281 CHEMBL3787592 Monoglyceride lipase Homo sapiens 98 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160281 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160281&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 127030394 340134712 CHEMBL3787592 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50488533 O=C(N1CCCCC1)n1cncn1 InChI=1S/C8H12N4O/c13-8(12-7-9-6-10-12)11-4-2-1-3-5-11/h6-7H,1-5H2 MEABOVRAOKSYQQ-UHFFFAOYSA-N 50160285 CHEMBL3786786 Monoglyceride lipase Homo sapiens >10000 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160285 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160285&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 127033071 340134716 CHEMBL3786786 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50488534 Fc1ccc(cc1)[C@@H]1[C@H](NC1=O)c1ccc2OCOc2c1 |r| InChI=1S/C16H12FNO3/c17-11-4-1-9(2-5-11)14-15(18-16(14)19)10-3-6-12-13(7-10)21-8-20-12/h1-7,14-15H,8H2,(H,18,19) YGHSRIDIJVHONY-UHFFFAOYSA-N 50160286 CHEMBL3787456 Monoglyceride lipase Homo sapiens 10000 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160286 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160286&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 127033070 340134717 CHEMBL3787456 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50488535 Fc1ccc(cc1)[C@H]1CN([C@@H]1c1ccc2OCOc2c1)C1CCN(CC1)C(=O)n1cncn1 |r| InChI=1S/C24H24FN5O3/c25-18-4-1-16(2-5-18)20-12-29(23(20)17-3-6-21-22(11-17)33-15-32-21)19-7-9-28(10-8-19)24(31)30-14-26-13-27-30/h1-6,11,13-14,19-20,23H,7-10,12,15H2 IWSLFABPEBZJJD-UHFFFAOYSA-N 50160287 CHEMBL3787453 Monoglyceride lipase Homo sapiens 376 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160287 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160287&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 127033069 340134718 CHEMBL3787453 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50488536 Fc1ccc(cc1)[C@@H]1[C@H](N(C2CCNCC2)C1=O)c1ccc2OCOc2c1 |r| InChI=1S/C21H21FN2O3/c22-15-4-1-13(2-5-15)19-20(14-3-6-17-18(11-14)27-12-26-17)24(21(19)25)16-7-9-23-10-8-16/h1-6,11,16,19-20,23H,7-10,12H2 QPVQOPSMQFJCMD-UHFFFAOYSA-N 50160288 CHEMBL3787437 Monoglyceride lipase Homo sapiens >10000 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160288 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160288&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 127034181 340134719 CHEMBL3787437 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50488537 Fc1ccc(cc1)[C@@H]1[C@H](N(C2CCN(Cc3ccccc3)CC2)C1=O)c1ccc2OCOc2c1 |r| InChI=1S/C28H27FN2O3/c29-22-9-6-20(7-10-22)26-27(21-8-11-24-25(16-21)34-18-33-24)31(28(26)32)23-12-14-30(15-13-23)17-19-4-2-1-3-5-19/h1-11,16,23,26-27H,12-15,17-18H2 BOTJIFFEHBQWCL-UHFFFAOYSA-N 50160289 CHEMBL3785148 Monoglyceride lipase Homo sapiens >10000 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160289 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160289&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 127034180 340134720 CHEMBL3785148 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50488538 COc1ccc(cc1)[C@@H]1[C@H](C(=O)N1C1CCN(CC1)C(=O)n1cncn1)c1ccc(OC)cc1 |r| InChI=1S/C25H27N5O4/c1-33-20-7-3-17(4-8-20)22-23(18-5-9-21(34-2)10-6-18)30(24(22)31)19-11-13-28(14-12-19)25(32)29-16-26-15-27-29/h3-10,15-16,19,22-23H,11-14H2,1-2H3 IMVFDAJMJNKUIX-UHFFFAOYSA-N 50160277 CHEMBL3785536 Monoglyceride lipase Homo sapiens 23 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160277 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160277&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 127034179 340134708 CHEMBL3785536 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50488539 COc1ccc(cc1OC)[C@@H]1[C@H](C(=O)N1C1CCN(CC1)C(=O)n1cncn1)c1ccc(OC)c(OC)c1 |r| InChI=1S/C27H31N5O6/c1-35-20-7-5-17(13-22(20)37-3)24-25(18-6-8-21(36-2)23(14-18)38-4)32(26(24)33)19-9-11-30(12-10-19)27(34)31-16-28-15-29-31/h5-8,13-16,19,24-25H,9-12H2,1-4H3 DEZRMSYXDKDCBR-UHFFFAOYSA-N 50160278 CHEMBL3786142 Monoglyceride lipase Homo sapiens 251 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160278 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160278&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 127034178 340134709 CHEMBL3786142 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50488540 COc1ccc(cc1)[C@@H]1[C@H](N(C2CCN(CC2)C(=O)n2cncn2)C1=O)c1ccc(OC)c(OC)c1 |r| InChI=1S/C26H29N5O5/c1-34-20-7-4-17(5-8-20)23-24(18-6-9-21(35-2)22(14-18)36-3)31(25(23)32)19-10-12-29(13-11-19)26(33)30-16-27-15-28-30/h4-9,14-16,19,23-24H,10-13H2,1-3H3 VIFSKVIAVYCQIJ-UHFFFAOYSA-N 50160279 CHEMBL3787224 Monoglyceride lipase Homo sapiens 61 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160279 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160279&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 127034177 340134710 CHEMBL3787224 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50488541 COc1ccc(cc1)[C@@H]1[C@H](N(C2CCN(CC2)C(=O)n2cncn2)C1=O)c1ccc2OCOc2c1 |r| InChI=1S/C25H25N5O5/c1-33-19-5-2-16(3-6-19)22-23(17-4-7-20-21(12-17)35-15-34-20)30(24(22)31)18-8-10-28(11-9-18)25(32)29-14-26-13-27-29/h2-7,12-14,18,22-23H,8-11,15H2,1H3 AYQMKQZYNLGZEY-UHFFFAOYSA-N 50160280 CHEMBL3787340 Monoglyceride lipase Homo sapiens 13 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160280 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160280&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 127032422 340134711 CHEMBL3787340 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50488542 Fc1ccc(cc1)[C@@H]1[C@H](N(C2CCN(CC2)C(=O)n2ccnc2)C1=O)c1ccc2OCOc2c1 |r| InChI=1S/C25H23FN4O4/c26-18-4-1-16(2-5-18)22-23(17-3-6-20-21(13-17)34-15-33-20)30(24(22)31)19-7-10-28(11-8-19)25(32)29-12-9-27-14-29/h1-6,9,12-14,19,22-23H,7-8,10-11,15H2 WCCUFVDQOJTSAT-UHFFFAOYSA-N 50160290 CHEMBL3786806 Monoglyceride lipase Homo sapiens >10000 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160290 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160290&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 127030393 340134721 CHEMBL3786806 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50488543 [O-][N+](=O)c1ccc(OC(=O)N2CCC(CC2)N2[C@@H]([C@H](C2=O)c2ccc(F)cc2)c2ccc3OCOc3c2)cc1 |r| InChI=1S/C28H24FN3O7/c29-19-4-1-17(2-5-19)25-26(18-3-10-23-24(15-18)38-16-37-23)31(27(25)33)20-11-13-30(14-12-20)28(34)39-22-8-6-21(7-9-22)32(35)36/h1-10,15,20,25-26H,11-14,16H2 CQUBMTHPOONKSG-UHFFFAOYSA-N 50160282 CHEMBL3785760 Monoglyceride lipase Homo sapiens 1.4 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160282 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160282&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 127030392 340134713 CHEMBL3785760 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50488544 Fc1ccc(cc1)[C@H]1[C@@H](N(C2CCN(CC2)C(=O)n2cncn2)C1=O)c1ccc2OCOc2c1 |r| InChI=1S/C24H22FN5O4/c25-17-4-1-15(2-5-17)21-22(16-3-6-19-20(11-16)34-14-33-19)30(23(21)31)18-7-9-28(10-8-18)24(32)29-13-26-12-27-29/h1-6,11-13,18,21-22H,7-10,14H2 XRIROGBLGLPXQI-UHFFFAOYSA-N 50160283 CHEMBL3787346 Monoglyceride lipase Homo sapiens 31 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160283 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160283&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 127030391 340134714 CHEMBL3787346 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50488545 Fc1ccc(cc1)[C@@H]1[C@H](N(C2CCN(CC2)C(=O)n2cncn2)C1=O)c1ccc2OCOc2c1 |r| InChI=1S/C24H22FN5O4/c25-17-4-1-15(2-5-17)21-22(16-3-6-19-20(11-16)34-14-33-19)30(23(21)31)18-7-9-28(10-8-18)24(32)29-13-26-12-27-29/h1-6,11-13,18,21-22H,7-10,14H2 XRIROGBLGLPXQI-UHFFFAOYSA-N 50160284 CHEMBL3785379 Monoglyceride lipase Homo sapiens 4.6 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160284 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160284&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 127032456 340134715 CHEMBL3785379 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50488546 Fc1ccc(cc1)[C@@H]1[C@H](N(C2CCN(CC2)C(=O)n2cncn2)C1=O)c1ccc2OCOc2c1 |r| InChI=1S/C24H22FN5O4/c25-17-4-1-15(2-5-17)21-22(16-3-6-19-20(11-16)34-14-33-19)30(23(21)31)18-7-9-28(10-8-18)24(32)29-13-26-12-27-29/h1-6,11-13,18,21-22H,7-10,14H2 XRIROGBLGLPXQI-UHFFFAOYSA-N 50160284 CHEMBL3785379 Monoglyceride lipase Homo sapiens 4.60 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160284 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160284&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 127032456 340134715 CHEMBL3785379 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50488547 OC(C1CCN(CC1)C(=O)Oc1ccc(cc1)[N+]([O-])=O)(c1ccc2OCOc2c1)c1ccc2OCOc2c1 InChI=1S/C27H24N2O9/c30-26(38-21-5-3-20(4-6-21)29(32)33)28-11-9-17(10-12-28)27(31,18-1-7-22-24(13-18)36-15-34-22)19-2-8-23-25(14-19)37-16-35-23/h1-8,13-14,17,31H,9-12,15-16H2 SEGYOKHGGFKMCX-UHFFFAOYSA-N 60622 BDBM50300355::US9133148, A::US11753371, Compound JZL-184 Monoglyceride lipase Homo sapiens 285 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=60622 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=60622&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 25021165 315662699 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50488548 Fc1ccc(cc1)[C@@H]1[C@H](N(C2CCN(CC2)C(=O)n2cncn2)C1=O)c1ccc2OCOc2c1 |r| InChI=1S/C24H22FN5O4/c25-17-4-1-15(2-5-17)21-22(16-3-6-19-20(11-16)34-14-33-19)30(23(21)31)18-7-9-28(10-8-18)24(32)29-13-26-12-27-29/h1-6,11-13,18,21-22H,7-10,14H2 XRIROGBLGLPXQI-UHFFFAOYSA-N 50160284 CHEMBL3785379 Cannabinoid receptor 1 Homo sapiens >10000 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160284 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2136&target=Cannabinoid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160284&enzyme=Cannabinoid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 127032456 340134715 CHEMBL3785379 1 MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL 7WV9,9ERX,9EGO,9DGI,9B65,9B54,8GHV,8GAG,6N4B,8WU1,8IKH,8IKG Cannabinoid receptor 1 CNR1_HUMAN P21554 B2R9T4 E1P512 Q13949 Q495Z0 Q4PLI4 Q4VBM6 Q5JVL5 Q5UB37 Q9UNN0 50488549 Fc1ccc(cc1)[C@@H]1[C@H](N(C2CCN(CC2)C(=O)n2cncn2)C1=O)c1ccc2OCOc2c1 |r| InChI=1S/C24H22FN5O4/c25-17-4-1-15(2-5-17)21-22(16-3-6-19-20(11-16)34-14-33-19)30(23(21)31)18-7-9-28(10-8-18)24(32)29-13-26-12-27-29/h1-6,11-13,18,21-22H,7-10,14H2 XRIROGBLGLPXQI-UHFFFAOYSA-N 50160284 CHEMBL3785379 Cannabinoid receptor 2 Homo sapiens >10000 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160284 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2137&target=Cannabinoid+receptor+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160284&enzyme=Cannabinoid+receptor+2&column=ki&startPg=0&Increment=50&submit=Search 127032456 340134715 CHEMBL3785379 1 MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC 8GUS,8GUR,8GUQ,6PT0,6KPF,8GUT,8X3L,5ZTY,6KPC,2KI9 Cannabinoid receptor 2 CNR2_HUMAN P34972 C6ES44 Q4VBK8 Q5JRH7 Q6B0G7 Q6NSY0 50488551 OC(C1CCN(CC1)C(=O)Oc1ccc(cc1)[N+]([O-])=O)(c1ccc2OCOc2c1)c1ccc2OCOc2c1 InChI=1S/C27H24N2O9/c30-26(38-21-5-3-20(4-6-21)29(32)33)28-11-9-17(10-12-28)27(31,18-1-7-22-24(13-18)36-15-34-22)19-2-8-23-25(14-19)37-16-35-23/h1-8,13-14,17,31H,9-12,15-16H2 SEGYOKHGGFKMCX-UHFFFAOYSA-N 60622 BDBM50300355::US9133148, A::US11753371, Compound JZL-184 Monoglyceride lipase Homo sapiens 4440 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=60622 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=60622&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 25021165 315662699 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50488552 Fc1ccc(cc1)[C@@H]1[C@H](N(C2CCN(CC2)C(=O)n2cncn2)C1=O)c1ccc2OCOc2c1 |r| InChI=1S/C24H22FN5O4/c25-17-4-1-15(2-5-17)21-22(16-3-6-19-20(11-16)34-14-33-19)30(23(21)31)18-7-9-28(10-8-18)24(32)29-13-26-12-27-29/h1-6,11-13,18,21-22H,7-10,14H2 XRIROGBLGLPXQI-UHFFFAOYSA-N 50160284 CHEMBL3785379 Monoglyceride lipase Homo sapiens 196 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160284 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160284&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 127032456 340134715 CHEMBL3785379 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50488553 Fc1ccc(cc1)[C@@H]1[C@H](N(C2CCN(CC2)C(=O)n2cncn2)C1=O)c1ccc2OCOc2c1 |r| InChI=1S/C24H22FN5O4/c25-17-4-1-15(2-5-17)21-22(16-3-6-19-20(11-16)34-14-33-19)30(23(21)31)18-7-9-28(10-8-18)24(32)29-13-26-12-27-29/h1-6,11-13,18,21-22H,7-10,14H2 XRIROGBLGLPXQI-UHFFFAOYSA-N 50160284 CHEMBL3785379 Monoglyceride lipase Homo sapiens 195 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160284 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160284&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 127032456 340134715 CHEMBL3785379 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50488554 Fc1ccc(cc1)[C@H]1[C@@H](N(C2CCN(CC2)C(=O)n2cncn2)C1=O)c1ccc2OCOc2c1 |r| InChI=1S/C24H22FN5O4/c25-17-4-1-15(2-5-17)21-22(16-3-6-19-20(11-16)34-14-33-19)30(23(21)31)18-7-9-28(10-8-18)24(32)29-13-26-12-27-29/h1-6,11-13,18,21-22H,7-10,14H2 XRIROGBLGLPXQI-UHFFFAOYSA-N 50160283 CHEMBL3787346 Monoglyceride lipase Homo sapiens 729 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160283 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160283&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 127030391 340134714 CHEMBL3787346 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50488555 Fc1ccc(cc1)[C@@H]1[C@H](N(C2CCN(CC2)C(=O)n2cncn2)C1=O)c1ccc2OCOc2c1 |r| InChI=1S/C24H22FN5O4/c25-17-4-1-15(2-5-17)21-22(16-3-6-19-20(11-16)34-14-33-19)30(23(21)31)18-7-9-28(10-8-18)24(32)29-13-26-12-27-29/h1-6,11-13,18,21-22H,7-10,14H2 XRIROGBLGLPXQI-UHFFFAOYSA-N 50160284 CHEMBL3785379 Monoglyceride lipase Rattus norvegicus 10.0 ChEMBL 10.1021/acs.jmedchem.5b01812 10.7270/Q21R6SC7 26888301 Brindisi, M; Maramai, S; Gemma, S; Brogi, S; Grillo, A; Di Cesare Mannelli, L; Gabellieri, E; Lamponi, S; Saponara, S; Gorelli, B; Tedesco, D; Bonfiglio, T; Landry, C; Jung, KM; Armirotti, A; Luongo, L; Ligresti, A; Piscitelli, F; Bertucci, C; Dehouck, MP; Campiani, G; Maione, S; Ghelardini, C; Pittaluga, A; Piomelli, D; Di Marzo, V; Butini, S 3/24/2016 7/26/2017 University of Siena http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50160284 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4873&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50160284&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 127032456 340134715 CHEMBL3785379 1 MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDELAQMLKRLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDLLQHVNTVQKDYPEVPVFLLGHSMGGAISILAAAERPTHFSGMILISPLILANPESASTLKVLAAKLLNFVLPNISLGRIDSSVLSRNKSEVDLYNSDPLICHAGVKVCFGIQLLNAVSRVERAMPRLTLPFLLLQGSADRLCDSKGAYLLMESSPSQDKTLKMYEGAYHVLHKELPEVTNSVLHEINTWVSHRIAVAGARCLP Monoglyceride lipase MGLL_RAT Q8R431 Q32PZ2