BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50476484 CCOC(=O)c1c(C)n(Cc2ccc(C)cc2)c2ccc(OCCCN3CCCCC3)cc12 InChI=1S/C28H36N2O3/c1-4-32-28(31)27-22(3)30(20-23-11-9-21(2)10-12-23)26-14-13-24(19-25(26)27)33-18-8-17-29-15-6-5-7-16-29/h9-14,19H,4-8,15-18,20H2,1-3H3 ANWWYHFRLWJQGF-UHFFFAOYSA-N 50153182 CHEMBL3775053 Quinolone resistance protein NorA Staphylococcus aureus 6700 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153182 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153182&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127030515 340133117 CHEMBL3775053 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476485 CCOC(=O)c1c(C)n(Cc2ccccc2OC)c2ccc(OCCCN3CCCCC3)cc12 InChI=1S/C28H36N2O4/c1-4-33-28(31)27-21(2)30(20-22-11-6-7-12-26(22)32-3)25-14-13-23(19-24(25)27)34-18-10-17-29-15-8-5-9-16-29/h6-7,11-14,19H,4-5,8-10,15-18,20H2,1-3H3 YAFSZCYPMUARQI-UHFFFAOYSA-N 50153183 CHEMBL3774548 Quinolone resistance protein NorA Staphylococcus aureus 5000 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153183 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153183&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127033275 340133118 CHEMBL3774548 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476486 CCOC(=O)c1c(C)n(Cc2cccc(OC)c2)c2ccc(OCCCN3CCCCC3)cc12 InChI=1S/C28H36N2O4/c1-4-33-28(31)27-21(2)30(20-22-10-8-11-23(18-22)32-3)26-13-12-24(19-25(26)27)34-17-9-16-29-14-6-5-7-15-29/h8,10-13,18-19H,4-7,9,14-17,20H2,1-3H3 XZKRNSBNHHHWQW-UHFFFAOYSA-N 50153184 CHEMBL3774891 Quinolone resistance protein NorA Staphylococcus aureus 7300 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153184 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153184&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127033276 340133119 CHEMBL3774891 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476487 CCOC(=O)c1c(C)n(Cc2ccc(OC)cc2)c2ccc(OCCCN3CCCCC3)cc12 InChI=1S/C28H36N2O4/c1-4-33-28(31)27-21(2)30(20-22-9-11-23(32-3)12-10-22)26-14-13-24(19-25(26)27)34-18-8-17-29-15-6-5-7-16-29/h9-14,19H,4-8,15-18,20H2,1-3H3 UZZNUJZQWYCOMY-UHFFFAOYSA-N 50153185 CHEMBL3775726 Quinolone resistance protein NorA Staphylococcus aureus 7100 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153185 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153185&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127033277 340133120 CHEMBL3775726 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476488 CCOC(=O)c1c(C)n(Cc2ccccc2F)c2ccc(OCCCN3CCCCC3)cc12 InChI=1S/C27H33FN2O3/c1-3-32-27(31)26-20(2)30(19-21-10-5-6-11-24(21)28)25-13-12-22(18-23(25)26)33-17-9-16-29-14-7-4-8-15-29/h5-6,10-13,18H,3-4,7-9,14-17,19H2,1-2H3 YSTHUJSLECBTTP-UHFFFAOYSA-N 50153186 CHEMBL3774520 Quinolone resistance protein NorA Staphylococcus aureus 4800 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153186 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153186&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127033278 340133121 CHEMBL3774520 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476489 CCOC(=O)c1c(C)n(Cc2cccc(F)c2)c2ccc(OCCCN3CCCCC3)cc12 InChI=1S/C27H33FN2O3/c1-3-32-27(31)26-20(2)30(19-21-9-7-10-22(28)17-21)25-12-11-23(18-24(25)26)33-16-8-15-29-13-5-4-6-14-29/h7,9-12,17-18H,3-6,8,13-16,19H2,1-2H3 CBIXBJGWGGPVPO-UHFFFAOYSA-N 50153187 CHEMBL3775401 Quinolone resistance protein NorA Staphylococcus aureus 6100 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153187 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153187&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127033556 340133122 CHEMBL3775401 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476490 CCOC(=O)c1c(C)n(Cc2ccc(F)cc2)c2ccc(OCCCN3CCCCC3)cc12 InChI=1S/C27H33FN2O3/c1-3-32-27(31)26-20(2)30(19-21-8-10-22(28)11-9-21)25-13-12-23(18-24(25)26)33-17-7-16-29-14-5-4-6-15-29/h8-13,18H,3-7,14-17,19H2,1-2H3 CUOLUMWSTSHDGE-UHFFFAOYSA-N 50153192 CHEMBL3775789 Quinolone resistance protein NorA Staphylococcus aureus 8700 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153192 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153192&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127033557 104041108 CHEMBL3775789 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476491 CCOC(=O)c1c(C)n(Cc2cccc(c2)C(F)(F)F)c2ccc(OCCCN3CCCCC3)cc12 InChI=1S/C28H33F3N2O3/c1-3-35-27(34)26-20(2)33(19-21-9-7-10-22(17-21)28(29,30)31)25-12-11-23(18-24(25)26)36-16-8-15-32-13-5-4-6-14-32/h7,9-12,17-18H,3-6,8,13-16,19H2,1-2H3 QQXBSCGGXLBJHW-UHFFFAOYSA-N 50153247 CHEMBL3775857 Quinolone resistance protein NorA Staphylococcus aureus 14200 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153247 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153247&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127032333 104041163 CHEMBL3775857 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476492 CCOC(=O)c1c(C)n(Cc2ccc(cc2)C(F)(F)F)c2ccc(OCCCN3CCCCC3)cc12 InChI=1S/C28H33F3N2O3/c1-3-35-27(34)26-20(2)33(19-21-8-10-22(11-9-21)28(29,30)31)25-13-12-23(18-24(25)26)36-17-7-16-32-14-5-4-6-15-32/h8-13,18H,3-7,14-17,19H2,1-2H3 UJFFXTVISBGNRS-UHFFFAOYSA-N 50153249 CHEMBL3775871 Quinolone resistance protein NorA Staphylococcus aureus 14100 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153249 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153249&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127032334 104041165 CHEMBL3775871 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476493 CCOC(=O)c1c(C)n(Cc2ccccc2[N+]([O-])=O)c2ccc(OCCCN3CCCCC3)cc12 InChI=1S/C27H33N3O5/c1-3-34-27(31)26-20(2)29(19-21-10-5-6-11-24(21)30(32)33)25-13-12-22(18-23(25)26)35-17-9-16-28-14-7-4-8-15-28/h5-6,10-13,18H,3-4,7-9,14-17,19H2,1-2H3 NQNHMIYKKHWLAC-UHFFFAOYSA-N 50153268 CHEMBL3775173 Quinolone resistance protein NorA Staphylococcus aureus 6300 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153268 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153268&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127032335 104041184 CHEMBL3775173 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476494 CCOC(=O)c1c(C)n(Cc2cccc(c2)[N+]([O-])=O)c2ccc(OCCCN3CCCCC3)cc12 InChI=1S/C27H33N3O5/c1-3-34-27(31)26-20(2)29(19-21-9-7-10-22(17-21)30(32)33)25-12-11-23(18-24(25)26)35-16-8-15-28-13-5-4-6-14-28/h7,9-12,17-18H,3-6,8,13-16,19H2,1-2H3 DXEBAOZMRXLJPT-UHFFFAOYSA-N 50153269 CHEMBL3775575 Quinolone resistance protein NorA Staphylococcus aureus 4400 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153269 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153269&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127032336 104041185 CHEMBL3775575 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476495 CCOC(=O)c1c(C)n(Cc2ccc(cc2)[N+]([O-])=O)c2ccc(OCCCN3CCCCC3)cc12 InChI=1S/C27H33N3O5/c1-3-34-27(31)26-20(2)29(19-21-8-10-22(11-9-21)30(32)33)25-13-12-23(18-24(25)26)35-17-7-16-28-14-5-4-6-15-28/h8-13,18H,3-7,14-17,19H2,1-2H3 LTVIRQJKDFKYRD-UHFFFAOYSA-N 50153270 CHEMBL3775819 Quinolone resistance protein NorA Staphylococcus aureus 6500 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153270 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153270&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127032337 104041186 CHEMBL3775819 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476496 CCOC(=O)Cc1c(C)n(Cc2ccccc2)c2ccc(OCCCN3CCCCCC3)cc12 InChI=1S/C29H38N2O3/c1-3-33-29(32)21-26-23(2)31(22-24-12-7-6-8-13-24)28-15-14-25(20-27(26)28)34-19-11-18-30-16-9-4-5-10-17-30/h6-8,12-15,20H,3-5,9-11,16-19,21-22H2,1-2H3 VMONSNCEZWFAOW-UHFFFAOYSA-N 50153271 CHEMBL3774968 Quinolone resistance protein NorA Staphylococcus aureus 6100 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153271 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153271&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127032338 104041187 CHEMBL3774968 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476497 Cc1cc2cc(OCCCN3CCCCC3)ccc2n1Cc1ccccc1 InChI=1S/C24H30N2O/c1-20-17-22-18-23(27-16-8-15-25-13-6-3-7-14-25)11-12-24(22)26(20)19-21-9-4-2-5-10-21/h2,4-5,9-12,17-18H,3,6-8,13-16,19H2,1H3 WQWQPXUADPOHPP-UHFFFAOYSA-N 50153272 CHEMBL3775722 Quinolone resistance protein NorA Staphylococcus aureus 6600 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153272 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153272&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127030216 104041188 CHEMBL3775722 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476498 CCOC(=O)c1c(C)n(Cc2ccccc2)c2ccc(OCCN(C)C)cc12 InChI=1S/C23H28N2O3/c1-5-27-23(26)22-17(2)25(16-18-9-7-6-8-10-18)21-12-11-19(15-20(21)22)28-14-13-24(3)4/h6-12,15H,5,13-14,16H2,1-4H3 PQVHFEKLJWXGDR-UHFFFAOYSA-N 50153273 CHEMBL3775114 Quinolone resistance protein NorA Staphylococcus aureus 22500 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153273 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153273&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 24014552 104041189 CHEMBL3775114 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476502 CCOC(=O)c1c(C)n(Cc2ccccc2)c2ccc(OCCN3CCCCC3)cc12 InChI=1S/C26H32N2O3/c1-3-30-26(29)25-20(2)28(19-21-10-6-4-7-11-21)24-13-12-22(18-23(24)25)31-17-16-27-14-8-5-9-15-27/h4,6-7,10-13,18H,3,5,8-9,14-17,19H2,1-2H3 YKROVKJJRGYMEV-UHFFFAOYSA-N 50153274 CHEMBL3775322 Quinolone resistance protein NorA Staphylococcus aureus 11600 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153274 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153274&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127031175 104041190 CHEMBL3775322 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476504 CCOC(=O)c1c(C)n(Cc2ccccc2)c2ccc(OCCN3CCOCC3)cc12 InChI=1S/C25H30N2O4/c1-3-30-25(28)24-19(2)27(18-20-7-5-4-6-8-20)23-10-9-21(17-22(23)24)31-16-13-26-11-14-29-15-12-26/h4-10,17H,3,11-16,18H2,1-2H3 WMIIMMQKIICLMN-UHFFFAOYSA-N 50153275 CHEMBL3775842 Quinolone resistance protein NorA Staphylococcus aureus 16800 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153275 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153275&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127031176 104041191 CHEMBL3775842 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476505 CCOC(=O)c1c(C)n(Cc2ccccc2)c2ccc(OCCN3CCNCC3)cc12 InChI=1S/C25H31N3O3/c1-3-30-25(29)24-19(2)28(18-20-7-5-4-6-8-20)23-10-9-21(17-22(23)24)31-16-15-27-13-11-26-12-14-27/h4-10,17,26H,3,11-16,18H2,1-2H3 ASFBUILWLYEWFM-UHFFFAOYSA-N 50153276 CHEMBL3775445 Quinolone resistance protein NorA Staphylococcus aureus 15500 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153276 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153276&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127032936 104041192 CHEMBL3775445 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476508 CCOC(=O)c1c(C)n(Cc2ccccc2)c2ccc(OCCN3CCN(C)CC3)cc12 InChI=1S/C26H33N3O3/c1-4-31-26(30)25-20(2)29(19-21-8-6-5-7-9-21)24-11-10-22(18-23(24)25)32-17-16-28-14-12-27(3)13-15-28/h5-11,18H,4,12-17,19H2,1-3H3 RUSCBHSNTMGKJY-UHFFFAOYSA-N 50153277 CHEMBL3774527 Quinolone resistance protein NorA Staphylococcus aureus 10100 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153277 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153277&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127034433 104041193 CHEMBL3774527 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476513 CCOC(=O)c1c(C)n(Cc2ccccc2)c2ccc(OCCCN3CCCCC3)cc12 InChI=1S/C27H34N2O3/c1-3-31-27(30)26-21(2)29(20-22-11-6-4-7-12-22)25-14-13-23(19-24(25)26)32-18-10-17-28-15-8-5-9-16-28/h4,6-7,11-14,19H,3,5,8-10,15-18,20H2,1-2H3 HLVFZXKIQXORIX-UHFFFAOYSA-N 50153278 CHEMBL3775105 Quinolone resistance protein NorA Staphylococcus aureus 6000 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153278 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153278&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127034434 104041194 CHEMBL3775105 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476514 CCOC(=O)c1c(C)n(Cc2ccccc2)c2ccc(OCCCN3CCOCC3)cc12 InChI=1S/C26H32N2O4/c1-3-31-26(29)25-20(2)28(19-21-8-5-4-6-9-21)24-11-10-22(18-23(24)25)32-15-7-12-27-13-16-30-17-14-27/h4-6,8-11,18H,3,7,12-17,19H2,1-2H3 NPCIVSNUMDPXDA-UHFFFAOYSA-N 50153279 CHEMBL3775483 Quinolone resistance protein NorA Staphylococcus aureus 10600 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153279 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153279&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127029910 104041195 CHEMBL3775483 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476515 CCOC(=O)c1c(C)n(Cc2ccccc2)c2ccc(OCCCN3CCN(C)CC3)cc12 InChI=1S/C27H35N3O3/c1-4-32-27(31)26-21(2)30(20-22-9-6-5-7-10-22)25-12-11-23(19-24(25)26)33-18-8-13-29-16-14-28(3)15-17-29/h5-7,9-12,19H,4,8,13-18,20H2,1-3H3 QLXKNFNUTPKARI-UHFFFAOYSA-N 50153280 CHEMBL3774675 Quinolone resistance protein NorA Staphylococcus aureus 11900 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153280 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153280&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127029911 104041196 CHEMBL3774675 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476517 CCOC(=O)c1c(C)n(Cc2ccccc2)c2ccc(OCCCN3CCNCC3)cc12 InChI=1S/C26H33N3O3/c1-3-31-26(30)25-20(2)29(19-21-8-5-4-6-9-21)24-11-10-22(18-23(24)25)32-17-7-14-28-15-12-27-13-16-28/h4-6,8-11,18,27H,3,7,12-17,19H2,1-2H3 TZCZQYVTHMQXCR-UHFFFAOYSA-N 50153281 CHEMBL3775062 Quinolone resistance protein NorA Staphylococcus aureus 12500 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153281 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153281&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127029912 104041197 CHEMBL3775062 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476518 CCOC(=O)c1c(C)n(Cc2ccccc2)c2ccc(OCCCN)cc12 InChI=1S/C22H26N2O3/c1-3-26-22(25)21-16(2)24(15-17-8-5-4-6-9-17)20-11-10-18(14-19(20)21)27-13-7-12-23/h4-6,8-11,14H,3,7,12-13,15,23H2,1-2H3 HVWOQJZMRXDQFE-UHFFFAOYSA-N 50153282 CHEMBL3775841 Quinolone resistance protein NorA Staphylococcus aureus 12500 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153282 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153282&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127032933 104041198 CHEMBL3775841 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476519 CCOC(=O)c1c(C)n(Cc2ccccc2)c2ccc(OCCCCN)cc12 InChI=1S/C23H28N2O3/c1-3-27-23(26)22-17(2)25(16-18-9-5-4-6-10-18)21-12-11-19(15-20(21)22)28-14-8-7-13-24/h4-6,9-12,15H,3,7-8,13-14,16,24H2,1-2H3 VVWLLFFDCNQBTC-UHFFFAOYSA-N 50153283 CHEMBL3774445 Quinolone resistance protein NorA Staphylococcus aureus 6700 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153283 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153283&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127033317 104041199 CHEMBL3774445 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476522 CCOC(=O)c1c(C)n(Cc2ccccc2)c2ccc(OCC(O)CN3CCCCC3)cc12 InChI=1S/C27H34N2O4/c1-3-32-27(31)26-20(2)29(17-21-10-6-4-7-11-21)25-13-12-23(16-24(25)26)33-19-22(30)18-28-14-8-5-9-15-28/h4,6-7,10-13,16,22,30H,3,5,8-9,14-15,17-19H2,1-2H3 SXMMRJILNBBTNA-UHFFFAOYSA-N 50153284 CHEMBL3775852 Quinolone resistance protein NorA Staphylococcus aureus 5800 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153284 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153284&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 4130365 104041200 CHEMBL3775852 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476524 CCOC(=O)c1c(C)n(Cc2ccccc2)c2ccc(OCC(O)CN3CCCCCC3)cc12 InChI=1S/C28H36N2O4/c1-3-33-28(32)27-21(2)30(18-22-11-7-6-8-12-22)26-14-13-24(17-25(26)27)34-20-23(31)19-29-15-9-4-5-10-16-29/h6-8,11-14,17,23,31H,3-5,9-10,15-16,18-20H2,1-2H3 MRQMXKCLXVJFDF-UHFFFAOYSA-N 50153285 CHEMBL3774995 Quinolone resistance protein NorA Staphylococcus aureus 6800 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153285 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153285&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 3863543 104041201 CHEMBL3774995 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476527 CCOC(=O)c1c(C)n(Cc2ccccc2)c2ccc(OCC(O)CN3CCOCC3)cc12 InChI=1S/C26H32N2O5/c1-3-32-26(30)25-19(2)28(16-20-7-5-4-6-8-20)24-10-9-22(15-23(24)25)33-18-21(29)17-27-11-13-31-14-12-27/h4-10,15,21,29H,3,11-14,16-18H2,1-2H3 TUUSPLOGZLFWTK-UHFFFAOYSA-N 50153286 CHEMBL3775271 Quinolone resistance protein NorA Staphylococcus aureus 17000 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153286 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153286&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 4180540 104041202 CHEMBL3775271 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476528 CCOC(=O)c1c(C)n(Cc2ccccc2)c2ccc(OCC(O)CN)cc12 InChI=1S/C22H26N2O4/c1-3-27-22(26)21-15(2)24(13-16-7-5-4-6-8-16)20-10-9-18(11-19(20)21)28-14-17(25)12-23/h4-11,17,25H,3,12-14,23H2,1-2H3 WKWPWYCQMSTPOB-UHFFFAOYSA-N 50153287 CHEMBL3775507 Quinolone resistance protein NorA Staphylococcus aureus 17100 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153287 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153287&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127030501 104041203 CHEMBL3775507 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476529 CCOC(=O)c1c(C)n(Cc2ccccc2)c2ccc(OCC(N)CO)cc12 InChI=1S/C22H26N2O4/c1-3-27-22(26)21-15(2)24(12-16-7-5-4-6-8-16)20-10-9-18(11-19(20)21)28-14-17(23)13-25/h4-11,17,25H,3,12-14,23H2,1-2H3 MUFUIHUSGVASCG-UHFFFAOYSA-N 50153288 CHEMBL3775693 Quinolone resistance protein NorA Staphylococcus aureus 10400 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153288 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153288&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127032061 104041204 CHEMBL3775693 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476530 CCOC(=O)c1c(C)n(Cc2ccccc2)c2ccc(OCC(F)CN3CCCCC3)cc12 InChI=1S/C27H33FN2O3/c1-3-32-27(31)26-20(2)30(17-21-10-6-4-7-11-21)25-13-12-23(16-24(25)26)33-19-22(28)18-29-14-8-5-9-15-29/h4,6-7,10-13,16,22H,3,5,8-9,14-15,17-19H2,1-2H3 CDRVXLQXRBVCIQ-UHFFFAOYSA-N 50153314 CHEMBL3774689 Quinolone resistance protein NorA Staphylococcus aureus 5100 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153314 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153314&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127032062 340133123 CHEMBL3774689 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476532 CCOC(=O)c1c(C)n(CCc2ccccc2)c2ccc(OCCCN3CCCCC3)cc12 InChI=1S/C28H36N2O3/c1-3-32-28(31)27-22(2)30(19-15-23-11-6-4-7-12-23)26-14-13-24(21-25(26)27)33-20-10-18-29-16-8-5-9-17-29/h4,6-7,11-14,21H,3,5,8-10,15-20H2,1-2H3 ISGYHVRWEHKUCQ-UHFFFAOYSA-N 50153315 CHEMBL3774582 Quinolone resistance protein NorA Staphylococcus aureus 13700 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153315 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153315&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127030512 340133124 CHEMBL3774582 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476533 CCOC(=O)c1c(C)n(Cc2ccccc2C)c2ccc(OCCCN3CCCCC3)cc12 InChI=1S/C28H36N2O3/c1-4-32-28(31)27-22(3)30(20-23-12-7-6-11-21(23)2)26-14-13-24(19-25(26)27)33-18-10-17-29-15-8-5-9-16-29/h6-7,11-14,19H,4-5,8-10,15-18,20H2,1-3H3 OAFKDGMLNKMNOB-UHFFFAOYSA-N 50153316 CHEMBL3775207 Quinolone resistance protein NorA Staphylococcus aureus 4800 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153316 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153316&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127030513 340133125 CHEMBL3775207 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191 50476537 CCOC(=O)c1c(C)n(Cc2cccc(C)c2)c2ccc(OCCCN3CCCCC3)cc12 InChI=1S/C28H36N2O3/c1-4-32-28(31)27-22(3)30(20-23-11-8-10-21(2)18-23)26-13-12-24(19-25(26)27)33-17-9-16-29-14-6-5-7-15-29/h8,10-13,18-19H,4-7,9,14-17,20H2,1-3H3 HWYJNEJPKKUPPM-UHFFFAOYSA-N 50153317 CHEMBL3774886 Quinolone resistance protein NorA Staphylococcus aureus 6100 ChEMBL 10.1021/acs.jmedchem.5b01219 10.7270/Q28W3G57 26757340 Lepri, S; Buonerba, F; Goracci, L; Velilla, I; Ruzziconi, R; Schindler, BD; Seo, SM; Kaatz, GW; Cruciani, G 2/11/2016 7/4/2017 University of Perugia http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50153317 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003811&target=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50153317&enzyme=Quinolone+resistance+protein+NorA&column=ki&startPg=0&Increment=50&submit=Search 127030514 340133126 CHEMBL3774886 1 MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM Quinolone resistance protein NorA NORA_STAAU P0A0J7 P21191