BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50432046 COc1ccc(CCOC(=O)C2(CCN(C)CC2)c2ccccc2)cc1OC InChI=1S/C23H29NO4/c1-24-14-12-23(13-15-24,19-7-5-4-6-8-19)22(25)28-16-11-18-9-10-20(26-2)21(17-18)27-3/h4-10,17H,11-16H2,1-3H3 LREPVNCKBAPXFF-UHFFFAOYSA-N 50129143 CHEMBL3629529 Muscarinic acetylcholine receptor M1 Homo sapiens 10800 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129143 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=10062&target=Muscarinic+acetylcholine+receptor+M1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129143&enzyme=Muscarinic+acetylcholine+receptor+M1&column=ki&startPg=0&Increment=50&submit=Search 122194369 321902825 CHEMBL3629529 1 MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC Muscarinic acetylcholine receptor M1 ACM1_HUMAN P11229 Q96RH1 50432047 COc1ccc(CCOC(=O)C2(CCN(C)CC2)c2ccccc2)cc1 InChI=1S/C22H27NO3/c1-23-15-13-22(14-16-23,19-6-4-3-5-7-19)21(24)26-17-12-18-8-10-20(25-2)11-9-18/h3-11H,12-17H2,1-2H3 OPURXCGDAMNMQI-UHFFFAOYSA-N 50129179 CHEMBL3629530 Muscarinic acetylcholine receptor M1 Homo sapiens 1200 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129179 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=10062&target=Muscarinic+acetylcholine+receptor+M1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129179&enzyme=Muscarinic+acetylcholine+receptor+M1&column=ki&startPg=0&Increment=50&submit=Search 122194370 104020821 CHEMBL3629530 1 MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC Muscarinic acetylcholine receptor M1 ACM1_HUMAN P11229 Q96RH1 50432048 COc1ccc(CCNC(=O)C2(CCN(C)CC2)c2ccccc2)cc1OC InChI=1S/C23H30N2O3/c1-25-15-12-23(13-16-25,19-7-5-4-6-8-19)22(26)24-14-11-18-9-10-20(27-2)21(17-18)28-3/h4-10,17H,11-16H2,1-3H3,(H,24,26) WFVHJKOXFHWPIC-UHFFFAOYSA-N 50129190 CHEMBL3629531 Muscarinic acetylcholine receptor M1 Homo sapiens >30000 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129190 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=10062&target=Muscarinic+acetylcholine+receptor+M1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129190&enzyme=Muscarinic+acetylcholine+receptor+M1&column=ki&startPg=0&Increment=50&submit=Search 122194371 104020832 CHEMBL3629531 1 MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC Muscarinic acetylcholine receptor M1 ACM1_HUMAN P11229 Q96RH1 50432049 COc1ccc(CCNC(=O)C2(CCN(C)CC2)c2ccccc2)cc1 InChI=1S/C22H28N2O2/c1-24-16-13-22(14-17-24,19-6-4-3-5-7-19)21(25)23-15-12-18-8-10-20(26-2)11-9-18/h3-11H,12-17H2,1-2H3,(H,23,25) YSGQXZGDFDFWGM-UHFFFAOYSA-N 50129247 CHEMBL3629532 Muscarinic acetylcholine receptor M1 Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129247 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=10062&target=Muscarinic+acetylcholine+receptor+M1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129247&enzyme=Muscarinic+acetylcholine+receptor+M1&column=ki&startPg=0&Increment=50&submit=Search 122194372 321902826 CHEMBL3629532 1 MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC Muscarinic acetylcholine receptor M1 ACM1_HUMAN P11229 Q96RH1 50432050 COc1ccc(CCC(=O)OCC2(CCN(C)CC2)c2ccccc2)cc1OC InChI=1S/C24H31NO4/c1-25-15-13-24(14-16-25,20-7-5-4-6-8-20)18-29-23(26)12-10-19-9-11-21(27-2)22(17-19)28-3/h4-9,11,17H,10,12-16,18H2,1-3H3 YXGVPWUJZGXZLR-UHFFFAOYSA-N 50129248 CHEMBL3629533 Muscarinic acetylcholine receptor M1 Homo sapiens 3630 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129248 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=10062&target=Muscarinic+acetylcholine+receptor+M1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129248&enzyme=Muscarinic+acetylcholine+receptor+M1&column=ki&startPg=0&Increment=50&submit=Search 122194373 321902827 CHEMBL3629533 1 MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC Muscarinic acetylcholine receptor M1 ACM1_HUMAN P11229 Q96RH1 50432051 COc1ccc(CCC(=O)OCC2(CCN(C)CC2)c2ccccc2)cc1 InChI=1S/C23H29NO3/c1-24-16-14-23(15-17-24,20-6-4-3-5-7-20)18-27-22(25)13-10-19-8-11-21(26-2)12-9-19/h3-9,11-12H,10,13-18H2,1-2H3 MOXAZUHAPUILEZ-UHFFFAOYSA-N 50129249 CHEMBL3629534 Muscarinic acetylcholine receptor M1 Homo sapiens 670 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129249 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=10062&target=Muscarinic+acetylcholine+receptor+M1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129249&enzyme=Muscarinic+acetylcholine+receptor+M1&column=ki&startPg=0&Increment=50&submit=Search 122194374 321902828 CHEMBL3629534 1 MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC Muscarinic acetylcholine receptor M1 ACM1_HUMAN P11229 Q96RH1 50432052 COc1ccc(CCC(=O)NCC2(CCN(C)CC2)c2ccccc2)cc1OC InChI=1S/C24H32N2O3/c1-26-15-13-24(14-16-26,20-7-5-4-6-8-20)18-25-23(27)12-10-19-9-11-21(28-2)22(17-19)29-3/h4-9,11,17H,10,12-16,18H2,1-3H3,(H,25,27) GXZBAYCWADAORP-UHFFFAOYSA-N 50129250 CHEMBL3629535 Muscarinic acetylcholine receptor M1 Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129250 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=10062&target=Muscarinic+acetylcholine+receptor+M1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129250&enzyme=Muscarinic+acetylcholine+receptor+M1&column=ki&startPg=0&Increment=50&submit=Search 122194375 321902829 CHEMBL3629535 1 MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC Muscarinic acetylcholine receptor M1 ACM1_HUMAN P11229 Q96RH1 50432053 COc1ccc(CCC(=O)NCC2(CCN(C)CC2)c2ccccc2)cc1 InChI=1S/C23H30N2O2/c1-25-16-14-23(15-17-25,20-6-4-3-5-7-20)18-24-22(26)13-10-19-8-11-21(27-2)12-9-19/h3-9,11-12H,10,13-18H2,1-2H3,(H,24,26) SFGNFMORMGLQMU-UHFFFAOYSA-N 50129251 CHEMBL3627739 Muscarinic acetylcholine receptor M1 Homo sapiens 3440 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129251 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=10062&target=Muscarinic+acetylcholine+receptor+M1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129251&enzyme=Muscarinic+acetylcholine+receptor+M1&column=ki&startPg=0&Increment=50&submit=Search 122194376 321902830 CHEMBL3627739 1 MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC Muscarinic acetylcholine receptor M1 ACM1_HUMAN P11229 Q96RH1 50432054 COc1ccc(CCNC(=O)OCC2(CCN(C)CC2)c2ccccc2)cc1OC InChI=1S/C24H32N2O4/c1-26-15-12-24(13-16-26,20-7-5-4-6-8-20)18-30-23(27)25-14-11-19-9-10-21(28-2)22(17-19)29-3/h4-10,17H,11-16,18H2,1-3H3,(H,25,27) IIMVXAUGGZVGEA-UHFFFAOYSA-N 50129252 CHEMBL3629536 Muscarinic acetylcholine receptor M1 Homo sapiens 5090 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129252 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=10062&target=Muscarinic+acetylcholine+receptor+M1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129252&enzyme=Muscarinic+acetylcholine+receptor+M1&column=ki&startPg=0&Increment=50&submit=Search 122194377 321902831 CHEMBL3629536 1 MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC Muscarinic acetylcholine receptor M1 ACM1_HUMAN P11229 Q96RH1 50432055 COc1ccc(CCOC(=O)NCC2(CCN(C)CC2)c2ccccc2)cc1 InChI=1S/C23H30N2O3/c1-25-15-13-23(14-16-25,20-6-4-3-5-7-20)18-24-22(26)28-17-12-19-8-10-21(27-2)11-9-19/h3-11H,12-18H2,1-2H3,(H,24,26) IHSFSTYDYRRQHL-UHFFFAOYSA-N 50129257 CHEMBL3629537 Muscarinic acetylcholine receptor M1 Homo sapiens 2910 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129257 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=10062&target=Muscarinic+acetylcholine+receptor+M1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129257&enzyme=Muscarinic+acetylcholine+receptor+M1&column=ki&startPg=0&Increment=50&submit=Search 122194378 321902832 CHEMBL3629537 1 MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC Muscarinic acetylcholine receptor M1 ACM1_HUMAN P11229 Q96RH1 50432056 COc1ccc(CCNC(=O)NCC2(CCN(C)CC2)c2ccccc2)cc1OC InChI=1S/C24H33N3O3/c1-27-15-12-24(13-16-27,20-7-5-4-6-8-20)18-26-23(28)25-14-11-19-9-10-21(29-2)22(17-19)30-3/h4-10,17H,11-16,18H2,1-3H3,(H2,25,26,28) CWMNPHKHIXRHRR-UHFFFAOYSA-N 50129258 CHEMBL3629538 Muscarinic acetylcholine receptor M1 Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129258 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=10062&target=Muscarinic+acetylcholine+receptor+M1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129258&enzyme=Muscarinic+acetylcholine+receptor+M1&column=ki&startPg=0&Increment=50&submit=Search 122194379 321902833 CHEMBL3629538 1 MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC Muscarinic acetylcholine receptor M1 ACM1_HUMAN P11229 Q96RH1 50432057 COc1ccc(CCNC(=O)NCC2(CCN(C)CC2)c2ccccc2)cc1 InChI=1S/C23H31N3O2/c1-26-16-13-23(14-17-26,20-6-4-3-5-7-20)18-25-22(27)24-15-12-19-8-10-21(28-2)11-9-19/h3-11H,12-18H2,1-2H3,(H2,24,25,27) LLZBHPGNKFIHAD-UHFFFAOYSA-N 50129259 CHEMBL3629539 Muscarinic acetylcholine receptor M1 Homo sapiens 5400 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129259 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=10062&target=Muscarinic+acetylcholine+receptor+M1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129259&enzyme=Muscarinic+acetylcholine+receptor+M1&column=ki&startPg=0&Increment=50&submit=Search 122194380 321902834 CHEMBL3629539 1 MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC Muscarinic acetylcholine receptor M1 ACM1_HUMAN P11229 Q96RH1 50432058 COc1ccc(CCOC(=O)C2(CCN(C)CC2)c2ccccc2)cc1OC InChI=1S/C23H29NO4/c1-24-14-12-23(13-15-24,19-7-5-4-6-8-19)22(25)28-16-11-18-9-10-20(26-2)21(17-18)27-3/h4-10,17H,11-16H2,1-3H3 LREPVNCKBAPXFF-UHFFFAOYSA-N 50129143 CHEMBL3629529 Muscarinic acetylcholine receptor M3 Homo sapiens 5260 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129143 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5682&target=Muscarinic+acetylcholine+receptor+M3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129143&enzyme=Muscarinic+acetylcholine+receptor+M3&column=ki&startPg=0&Increment=50&submit=Search 122194369 321902825 CHEMBL3629529 1 MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVNPVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL 8E9W,8EA0,8E9Z,8E9Y Muscarinic acetylcholine receptor M3 ACM3_HUMAN P20309 Q0VAJ8 Q4QRI3 Q5VXY2 Q9HB60 50432059 COc1ccc(CCOC(=O)C2(CCN(C)CC2)c2ccccc2)cc1 InChI=1S/C22H27NO3/c1-23-15-13-22(14-16-23,19-6-4-3-5-7-19)21(24)26-17-12-18-8-10-20(25-2)11-9-18/h3-11H,12-17H2,1-2H3 OPURXCGDAMNMQI-UHFFFAOYSA-N 50129179 CHEMBL3629530 Muscarinic acetylcholine receptor M3 Homo sapiens 640 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129179 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5682&target=Muscarinic+acetylcholine+receptor+M3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129179&enzyme=Muscarinic+acetylcholine+receptor+M3&column=ki&startPg=0&Increment=50&submit=Search 122194370 104020821 CHEMBL3629530 1 MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVNPVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL 8E9W,8EA0,8E9Z,8E9Y Muscarinic acetylcholine receptor M3 ACM3_HUMAN P20309 Q0VAJ8 Q4QRI3 Q5VXY2 Q9HB60 50432060 COc1ccc(CCNC(=O)C2(CCN(C)CC2)c2ccccc2)cc1OC InChI=1S/C23H30N2O3/c1-25-15-12-23(13-16-25,19-7-5-4-6-8-19)22(26)24-14-11-18-9-10-20(27-2)21(17-18)28-3/h4-10,17H,11-16H2,1-3H3,(H,24,26) WFVHJKOXFHWPIC-UHFFFAOYSA-N 50129190 CHEMBL3629531 Muscarinic acetylcholine receptor M3 Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129190 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5682&target=Muscarinic+acetylcholine+receptor+M3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129190&enzyme=Muscarinic+acetylcholine+receptor+M3&column=ki&startPg=0&Increment=50&submit=Search 122194371 104020832 CHEMBL3629531 1 MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVNPVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL 8E9W,8EA0,8E9Z,8E9Y Muscarinic acetylcholine receptor M3 ACM3_HUMAN P20309 Q0VAJ8 Q4QRI3 Q5VXY2 Q9HB60 50432061 COc1ccc(CCNC(=O)C2(CCN(C)CC2)c2ccccc2)cc1 InChI=1S/C22H28N2O2/c1-24-16-13-22(14-17-24,19-6-4-3-5-7-19)21(25)23-15-12-18-8-10-20(26-2)11-9-18/h3-11H,12-17H2,1-2H3,(H,23,25) YSGQXZGDFDFWGM-UHFFFAOYSA-N 50129247 CHEMBL3629532 Muscarinic acetylcholine receptor M3 Homo sapiens 3290 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129247 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5682&target=Muscarinic+acetylcholine+receptor+M3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129247&enzyme=Muscarinic+acetylcholine+receptor+M3&column=ki&startPg=0&Increment=50&submit=Search 122194372 321902826 CHEMBL3629532 1 MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVNPVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL 8E9W,8EA0,8E9Z,8E9Y Muscarinic acetylcholine receptor M3 ACM3_HUMAN P20309 Q0VAJ8 Q4QRI3 Q5VXY2 Q9HB60 50432062 COc1ccc(CCC(=O)OCC2(CCN(C)CC2)c2ccccc2)cc1OC InChI=1S/C24H31NO4/c1-25-15-13-24(14-16-25,20-7-5-4-6-8-20)18-29-23(26)12-10-19-9-11-21(27-2)22(17-19)28-3/h4-9,11,17H,10,12-16,18H2,1-3H3 YXGVPWUJZGXZLR-UHFFFAOYSA-N 50129248 CHEMBL3629533 Muscarinic acetylcholine receptor M3 Homo sapiens 4600 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129248 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5682&target=Muscarinic+acetylcholine+receptor+M3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129248&enzyme=Muscarinic+acetylcholine+receptor+M3&column=ki&startPg=0&Increment=50&submit=Search 122194373 321902827 CHEMBL3629533 1 MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVNPVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL 8E9W,8EA0,8E9Z,8E9Y Muscarinic acetylcholine receptor M3 ACM3_HUMAN P20309 Q0VAJ8 Q4QRI3 Q5VXY2 Q9HB60 50432063 COc1ccc(CCC(=O)OCC2(CCN(C)CC2)c2ccccc2)cc1 InChI=1S/C23H29NO3/c1-24-16-14-23(15-17-24,20-6-4-3-5-7-20)18-27-22(25)13-10-19-8-11-21(26-2)12-9-19/h3-9,11-12H,10,13-18H2,1-2H3 MOXAZUHAPUILEZ-UHFFFAOYSA-N 50129249 CHEMBL3629534 Muscarinic acetylcholine receptor M3 Homo sapiens 370 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129249 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5682&target=Muscarinic+acetylcholine+receptor+M3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129249&enzyme=Muscarinic+acetylcholine+receptor+M3&column=ki&startPg=0&Increment=50&submit=Search 122194374 321902828 CHEMBL3629534 1 MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVNPVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL 8E9W,8EA0,8E9Z,8E9Y Muscarinic acetylcholine receptor M3 ACM3_HUMAN P20309 Q0VAJ8 Q4QRI3 Q5VXY2 Q9HB60 50432064 COc1ccc(CCC(=O)NCC2(CCN(C)CC2)c2ccccc2)cc1OC InChI=1S/C24H32N2O3/c1-26-15-13-24(14-16-26,20-7-5-4-6-8-20)18-25-23(27)12-10-19-9-11-21(28-2)22(17-19)29-3/h4-9,11,17H,10,12-16,18H2,1-3H3,(H,25,27) GXZBAYCWADAORP-UHFFFAOYSA-N 50129250 CHEMBL3629535 Muscarinic acetylcholine receptor M3 Homo sapiens >30000 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129250 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5682&target=Muscarinic+acetylcholine+receptor+M3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129250&enzyme=Muscarinic+acetylcholine+receptor+M3&column=ki&startPg=0&Increment=50&submit=Search 122194375 321902829 CHEMBL3629535 1 MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVNPVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL 8E9W,8EA0,8E9Z,8E9Y Muscarinic acetylcholine receptor M3 ACM3_HUMAN P20309 Q0VAJ8 Q4QRI3 Q5VXY2 Q9HB60 50432065 COc1ccc(CCC(=O)NCC2(CCN(C)CC2)c2ccccc2)cc1 InChI=1S/C23H30N2O2/c1-25-16-14-23(15-17-25,20-6-4-3-5-7-20)18-24-22(26)13-10-19-8-11-21(27-2)12-9-19/h3-9,11-12H,10,13-18H2,1-2H3,(H,24,26) SFGNFMORMGLQMU-UHFFFAOYSA-N 50129251 CHEMBL3627739 Muscarinic acetylcholine receptor M3 Homo sapiens 1540 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129251 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5682&target=Muscarinic+acetylcholine+receptor+M3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129251&enzyme=Muscarinic+acetylcholine+receptor+M3&column=ki&startPg=0&Increment=50&submit=Search 122194376 321902830 CHEMBL3627739 1 MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVNPVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL 8E9W,8EA0,8E9Z,8E9Y Muscarinic acetylcholine receptor M3 ACM3_HUMAN P20309 Q0VAJ8 Q4QRI3 Q5VXY2 Q9HB60 50432066 COc1ccc(CCNC(=O)OCC2(CCN(C)CC2)c2ccccc2)cc1OC InChI=1S/C24H32N2O4/c1-26-15-12-24(13-16-26,20-7-5-4-6-8-20)18-30-23(27)25-14-11-19-9-10-21(28-2)22(17-19)29-3/h4-10,17H,11-16,18H2,1-3H3,(H,25,27) IIMVXAUGGZVGEA-UHFFFAOYSA-N 50129252 CHEMBL3629536 Muscarinic acetylcholine receptor M3 Homo sapiens 4030 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129252 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5682&target=Muscarinic+acetylcholine+receptor+M3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129252&enzyme=Muscarinic+acetylcholine+receptor+M3&column=ki&startPg=0&Increment=50&submit=Search 122194377 321902831 CHEMBL3629536 1 MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVNPVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL 8E9W,8EA0,8E9Z,8E9Y Muscarinic acetylcholine receptor M3 ACM3_HUMAN P20309 Q0VAJ8 Q4QRI3 Q5VXY2 Q9HB60 50432067 COc1ccc(CCOC(=O)NCC2(CCN(C)CC2)c2ccccc2)cc1 InChI=1S/C23H30N2O3/c1-25-15-13-23(14-16-25,20-6-4-3-5-7-20)18-24-22(26)28-17-12-19-8-10-21(27-2)11-9-19/h3-11H,12-18H2,1-2H3,(H,24,26) IHSFSTYDYRRQHL-UHFFFAOYSA-N 50129257 CHEMBL3629537 Muscarinic acetylcholine receptor M3 Homo sapiens 2300 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129257 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5682&target=Muscarinic+acetylcholine+receptor+M3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129257&enzyme=Muscarinic+acetylcholine+receptor+M3&column=ki&startPg=0&Increment=50&submit=Search 122194378 321902832 CHEMBL3629537 1 MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVNPVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL 8E9W,8EA0,8E9Z,8E9Y Muscarinic acetylcholine receptor M3 ACM3_HUMAN P20309 Q0VAJ8 Q4QRI3 Q5VXY2 Q9HB60 50432068 COc1ccc(CCNC(=O)NCC2(CCN(C)CC2)c2ccccc2)cc1OC InChI=1S/C24H33N3O3/c1-27-15-12-24(13-16-27,20-7-5-4-6-8-20)18-26-23(28)25-14-11-19-9-10-21(29-2)22(17-19)30-3/h4-10,17H,11-16,18H2,1-3H3,(H2,25,26,28) CWMNPHKHIXRHRR-UHFFFAOYSA-N 50129258 CHEMBL3629538 Muscarinic acetylcholine receptor M3 Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129258 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5682&target=Muscarinic+acetylcholine+receptor+M3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129258&enzyme=Muscarinic+acetylcholine+receptor+M3&column=ki&startPg=0&Increment=50&submit=Search 122194379 321902833 CHEMBL3629538 1 MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVNPVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL 8E9W,8EA0,8E9Z,8E9Y Muscarinic acetylcholine receptor M3 ACM3_HUMAN P20309 Q0VAJ8 Q4QRI3 Q5VXY2 Q9HB60 50432069 COc1ccc(CCNC(=O)NCC2(CCN(C)CC2)c2ccccc2)cc1 InChI=1S/C23H31N3O2/c1-26-16-13-23(14-17-26,20-6-4-3-5-7-20)18-25-22(27)24-15-12-19-8-10-21(28-2)11-9-19/h3-11H,12-18H2,1-2H3,(H2,24,25,27) LLZBHPGNKFIHAD-UHFFFAOYSA-N 50129259 CHEMBL3629539 Muscarinic acetylcholine receptor M3 Homo sapiens 3550 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129259 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5682&target=Muscarinic+acetylcholine+receptor+M3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129259&enzyme=Muscarinic+acetylcholine+receptor+M3&column=ki&startPg=0&Increment=50&submit=Search 122194380 321902834 CHEMBL3629539 1 MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVNPVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL 8E9W,8EA0,8E9Z,8E9Y Muscarinic acetylcholine receptor M3 ACM3_HUMAN P20309 Q0VAJ8 Q4QRI3 Q5VXY2 Q9HB60 50432070 COc1ccc(CCOC(=O)C2(CCN(C)CC2)c2ccccc2)cc1OC InChI=1S/C23H29NO4/c1-24-14-12-23(13-15-24,19-7-5-4-6-8-19)22(25)28-16-11-18-9-10-20(26-2)21(17-18)27-3/h4-10,17H,11-16H2,1-3H3 LREPVNCKBAPXFF-UHFFFAOYSA-N 50129143 CHEMBL3629529 Muscarinic acetylcholine receptor M5 Homo sapiens 6950 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129143 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000212&target=Muscarinic+acetylcholine+receptor+M5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129143&enzyme=Muscarinic+acetylcholine+receptor+M5&column=ki&startPg=0&Increment=50&submit=Search 122194369 321902825 CHEMBL3629529 1 MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP 9EK0,9EJZ,6OL9 Muscarinic acetylcholine receptor M5 ACM5_HUMAN P08912 Q96RG7 50432071 COc1ccc(CCOC(=O)C2(CCN(C)CC2)c2ccccc2)cc1 InChI=1S/C22H27NO3/c1-23-15-13-22(14-16-23,19-6-4-3-5-7-19)21(24)26-17-12-18-8-10-20(25-2)11-9-18/h3-11H,12-17H2,1-2H3 OPURXCGDAMNMQI-UHFFFAOYSA-N 50129179 CHEMBL3629530 Muscarinic acetylcholine receptor M5 Homo sapiens 870 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129179 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000212&target=Muscarinic+acetylcholine+receptor+M5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129179&enzyme=Muscarinic+acetylcholine+receptor+M5&column=ki&startPg=0&Increment=50&submit=Search 122194370 104020821 CHEMBL3629530 1 MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP 9EK0,9EJZ,6OL9 Muscarinic acetylcholine receptor M5 ACM5_HUMAN P08912 Q96RG7 50432072 COc1ccc(CCNC(=O)C2(CCN(C)CC2)c2ccccc2)cc1OC InChI=1S/C23H30N2O3/c1-25-15-12-23(13-16-25,19-7-5-4-6-8-19)22(26)24-14-11-18-9-10-20(27-2)21(17-18)28-3/h4-10,17H,11-16H2,1-3H3,(H,24,26) WFVHJKOXFHWPIC-UHFFFAOYSA-N 50129190 CHEMBL3629531 Muscarinic acetylcholine receptor M5 Homo sapiens >30000 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129190 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000212&target=Muscarinic+acetylcholine+receptor+M5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129190&enzyme=Muscarinic+acetylcholine+receptor+M5&column=ki&startPg=0&Increment=50&submit=Search 122194371 104020832 CHEMBL3629531 1 MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP 9EK0,9EJZ,6OL9 Muscarinic acetylcholine receptor M5 ACM5_HUMAN P08912 Q96RG7 50432073 COc1ccc(CCNC(=O)C2(CCN(C)CC2)c2ccccc2)cc1 InChI=1S/C22H28N2O2/c1-24-16-13-22(14-17-24,19-6-4-3-5-7-19)21(25)23-15-12-18-8-10-20(26-2)11-9-18/h3-11H,12-17H2,1-2H3,(H,23,25) YSGQXZGDFDFWGM-UHFFFAOYSA-N 50129247 CHEMBL3629532 Muscarinic acetylcholine receptor M5 Homo sapiens 6970 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129247 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000212&target=Muscarinic+acetylcholine+receptor+M5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129247&enzyme=Muscarinic+acetylcholine+receptor+M5&column=ki&startPg=0&Increment=50&submit=Search 122194372 321902826 CHEMBL3629532 1 MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP 9EK0,9EJZ,6OL9 Muscarinic acetylcholine receptor M5 ACM5_HUMAN P08912 Q96RG7 50432074 COc1ccc(CCC(=O)OCC2(CCN(C)CC2)c2ccccc2)cc1OC InChI=1S/C24H31NO4/c1-25-15-13-24(14-16-25,20-7-5-4-6-8-20)18-29-23(26)12-10-19-9-11-21(27-2)22(17-19)28-3/h4-9,11,17H,10,12-16,18H2,1-3H3 YXGVPWUJZGXZLR-UHFFFAOYSA-N 50129248 CHEMBL3629533 Muscarinic acetylcholine receptor M5 Homo sapiens 2140 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129248 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000212&target=Muscarinic+acetylcholine+receptor+M5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129248&enzyme=Muscarinic+acetylcholine+receptor+M5&column=ki&startPg=0&Increment=50&submit=Search 122194373 321902827 CHEMBL3629533 1 MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP 9EK0,9EJZ,6OL9 Muscarinic acetylcholine receptor M5 ACM5_HUMAN P08912 Q96RG7 50432075 COc1ccc(CCC(=O)OCC2(CCN(C)CC2)c2ccccc2)cc1 InChI=1S/C23H29NO3/c1-24-16-14-23(15-17-24,20-6-4-3-5-7-20)18-27-22(25)13-10-19-8-11-21(26-2)12-9-19/h3-9,11-12H,10,13-18H2,1-2H3 MOXAZUHAPUILEZ-UHFFFAOYSA-N 50129249 CHEMBL3629534 Muscarinic acetylcholine receptor M5 Homo sapiens 380 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129249 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000212&target=Muscarinic+acetylcholine+receptor+M5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129249&enzyme=Muscarinic+acetylcholine+receptor+M5&column=ki&startPg=0&Increment=50&submit=Search 122194374 321902828 CHEMBL3629534 1 MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP 9EK0,9EJZ,6OL9 Muscarinic acetylcholine receptor M5 ACM5_HUMAN P08912 Q96RG7 50432076 COc1ccc(CCC(=O)NCC2(CCN(C)CC2)c2ccccc2)cc1OC InChI=1S/C24H32N2O3/c1-26-15-13-24(14-16-26,20-7-5-4-6-8-20)18-25-23(27)12-10-19-9-11-21(28-2)22(17-19)29-3/h4-9,11,17H,10,12-16,18H2,1-3H3,(H,25,27) GXZBAYCWADAORP-UHFFFAOYSA-N 50129250 CHEMBL3629535 Muscarinic acetylcholine receptor M5 Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129250 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000212&target=Muscarinic+acetylcholine+receptor+M5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129250&enzyme=Muscarinic+acetylcholine+receptor+M5&column=ki&startPg=0&Increment=50&submit=Search 122194375 321902829 CHEMBL3629535 1 MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP 9EK0,9EJZ,6OL9 Muscarinic acetylcholine receptor M5 ACM5_HUMAN P08912 Q96RG7 50432077 COc1ccc(CCC(=O)NCC2(CCN(C)CC2)c2ccccc2)cc1 InChI=1S/C23H30N2O2/c1-25-16-14-23(15-17-25,20-6-4-3-5-7-20)18-24-22(26)13-10-19-8-11-21(27-2)12-9-19/h3-9,11-12H,10,13-18H2,1-2H3,(H,24,26) SFGNFMORMGLQMU-UHFFFAOYSA-N 50129251 CHEMBL3627739 Muscarinic acetylcholine receptor M5 Homo sapiens 1810 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129251 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000212&target=Muscarinic+acetylcholine+receptor+M5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129251&enzyme=Muscarinic+acetylcholine+receptor+M5&column=ki&startPg=0&Increment=50&submit=Search 122194376 321902830 CHEMBL3627739 1 MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP 9EK0,9EJZ,6OL9 Muscarinic acetylcholine receptor M5 ACM5_HUMAN P08912 Q96RG7 50432078 COc1ccc(CCNC(=O)OCC2(CCN(C)CC2)c2ccccc2)cc1OC InChI=1S/C24H32N2O4/c1-26-15-12-24(13-16-26,20-7-5-4-6-8-20)18-30-23(27)25-14-11-19-9-10-21(28-2)22(17-19)29-3/h4-10,17H,11-16,18H2,1-3H3,(H,25,27) IIMVXAUGGZVGEA-UHFFFAOYSA-N 50129252 CHEMBL3629536 Muscarinic acetylcholine receptor M5 Homo sapiens 5410 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129252 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000212&target=Muscarinic+acetylcholine+receptor+M5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129252&enzyme=Muscarinic+acetylcholine+receptor+M5&column=ki&startPg=0&Increment=50&submit=Search 122194377 321902831 CHEMBL3629536 1 MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP 9EK0,9EJZ,6OL9 Muscarinic acetylcholine receptor M5 ACM5_HUMAN P08912 Q96RG7 50432079 COc1ccc(CCOC(=O)NCC2(CCN(C)CC2)c2ccccc2)cc1 InChI=1S/C23H30N2O3/c1-25-15-13-23(14-16-25,20-6-4-3-5-7-20)18-24-22(26)28-17-12-19-8-10-21(27-2)11-9-19/h3-11H,12-18H2,1-2H3,(H,24,26) IHSFSTYDYRRQHL-UHFFFAOYSA-N 50129257 CHEMBL3629537 Muscarinic acetylcholine receptor M5 Homo sapiens 2050 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129257 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000212&target=Muscarinic+acetylcholine+receptor+M5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129257&enzyme=Muscarinic+acetylcholine+receptor+M5&column=ki&startPg=0&Increment=50&submit=Search 122194378 321902832 CHEMBL3629537 1 MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP 9EK0,9EJZ,6OL9 Muscarinic acetylcholine receptor M5 ACM5_HUMAN P08912 Q96RG7 50432080 COc1ccc(CCNC(=O)NCC2(CCN(C)CC2)c2ccccc2)cc1OC InChI=1S/C24H33N3O3/c1-27-15-12-24(13-16-27,20-7-5-4-6-8-20)18-26-23(28)25-14-11-19-9-10-21(29-2)22(17-19)30-3/h4-10,17H,11-16,18H2,1-3H3,(H2,25,26,28) CWMNPHKHIXRHRR-UHFFFAOYSA-N 50129258 CHEMBL3629538 Muscarinic acetylcholine receptor M5 Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129258 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000212&target=Muscarinic+acetylcholine+receptor+M5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129258&enzyme=Muscarinic+acetylcholine+receptor+M5&column=ki&startPg=0&Increment=50&submit=Search 122194379 321902833 CHEMBL3629538 1 MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP 9EK0,9EJZ,6OL9 Muscarinic acetylcholine receptor M5 ACM5_HUMAN P08912 Q96RG7 50432081 COc1ccc(CCNC(=O)NCC2(CCN(C)CC2)c2ccccc2)cc1 InChI=1S/C23H31N3O2/c1-26-16-13-23(14-17-26,20-6-4-3-5-7-20)18-25-22(27)24-15-12-19-8-10-21(28-2)11-9-19/h3-11H,12-18H2,1-2H3,(H2,24,25,27) LLZBHPGNKFIHAD-UHFFFAOYSA-N 50129259 CHEMBL3629539 Muscarinic acetylcholine receptor M5 Homo sapiens 4300 ChEMBL 10.1016/j.bmcl.2015.10.029 10.7270/Q2S75J4G 26494260 Lee, NR; Zhang, X; Darna, M; Dwoskin, LP; Zheng, G 10/31/2015 12/16/2016 University of Kentucky http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50129259 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000212&target=Muscarinic+acetylcholine+receptor+M5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50129259&enzyme=Muscarinic+acetylcholine+receptor+M5&column=ki&startPg=0&Increment=50&submit=Search 122194380 321902834 CHEMBL3629539 1 MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP 9EK0,9EJZ,6OL9 Muscarinic acetylcholine receptor M5 ACM5_HUMAN P08912 Q96RG7