BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 308832 c1ccc2c(c1)C(=C(OC2=O)Cl)Cl InChI=1S/C9H4Cl2O2/c10-7-5-3-1-2-4-6(5)9(12)13-8(7)11/h1-4H SUGXUUGGLDCZKB-UHFFFAOYSA-N 50199883 cid_1609::3,4-dichloro-1H-isochromen-1-one::CHEMBL24983::3,4-Dichloro-isochromen-1-one::3,4-dichloroisocoumarin::3,4‐Dichloroisocoumarin (2) Rhomboid domain-containing protein Aquifex aeolicus (strain VF5) 1.1e+3 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.5b00514 10.7270/Q2668BZ8 26218717 aid1801342 Wolf, EV; Zeissler, A; Verhelst, SH 10/16/2015 2/17/2016 Technische Universität München http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199883 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7389&target=Rhomboid+domain-containing+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199883&enzyme=Rhomboid+domain-containing+protein&column=ki&startPg=0&Increment=50&submit=Search DIC 1609 104080348 CHEMBL24983 DB04459 1 MIPIKDVNPSRTFPIVNLSIIVACSLIWLYEWSLTDEVIYTFQGAVTKFELFLREWGLVPVELPQKPYTLLTHMFLHGSWGHIIGNMWFLWVFGDNVEDKLGKFRYIIFYILCGLGAALTQTFISLAFGGANVPMVGASGAISGVLGAYMKMFPHARVLALVPVFIFLTLMELPAVIFIGLWFFIQIINGIITLPFIGYGGVAWYAHIGGFITGYLLVDYFRKRSYS Peptidase S54 rhomboid domain-containing protein O67346_AQUAE O67346 308833 c1ccc2c(c1)C(=C(OC2=O)Cl)Cl InChI=1S/C9H4Cl2O2/c10-7-5-3-1-2-4-6(5)9(12)13-8(7)11/h1-4H SUGXUUGGLDCZKB-UHFFFAOYSA-N 50199883 cid_1609::3,4-dichloro-1H-isochromen-1-one::CHEMBL24983::3,4-Dichloro-isochromen-1-one::3,4-dichloroisocoumarin::3,4‐Dichloroisocoumarin (2) AN1-type domain-containing protein Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) 8.1e+3 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.5b00514 10.7270/Q2668BZ8 26218717 aid1801342 Wolf, EV; Zeissler, A; Verhelst, SH 10/16/2015 2/17/2016 Technische Universität München http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199883 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7390&target=AN1-type+domain-containing+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199883&enzyme=AN1-type+domain-containing+protein&column=ki&startPg=0&Increment=50&submit=Search DIC 1609 104080348 CHEMBL24983 DB04459 1 MLLHSFSRFKLLRGFLSLAAANYAMKHLPLFSTAVENFALFPRLPNSTQAEAFLTSRSLMLRVARCDVCGEEVTIPFKCKYCGGTFCAEHRLPENHDCDGLDEYWNVPVNVKRRLSPQPARRSRNIGLMKYGANNTVLIICTILFFISIVAPYEMVEIFALHPRLDVLLAMPWQLITSMFLHVEFWHFFVNMFVLLFFGTELERRLGDRKYLEIFFVSGLAGNVGYIAYSYAVGSFAPALGASAAIFGVMGCLAIIAPEIRIIIFPIPIPINIRTALLLFAAYDFWMMVASYMGLFYTNVANIAHLAGLAVGLYYGKRLGRRKVRYDFYF AN1-type domain-containing protein O29251_ARCFU O29251 308834 c1ccc2c(c1)C(=C(OC2=O)Cl)Cl InChI=1S/C9H4Cl2O2/c10-7-5-3-1-2-4-6(5)9(12)13-8(7)11/h1-4H SUGXUUGGLDCZKB-UHFFFAOYSA-N 50199883 cid_1609::3,4-dichloro-1H-isochromen-1-one::CHEMBL24983::3,4-Dichloro-isochromen-1-one::3,4-dichloroisocoumarin::3,4‐Dichloroisocoumarin (2) Rhomboid domain-containing protein Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) 1.6e+4 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.5b00514 10.7270/Q2668BZ8 26218717 aid1801342 Wolf, EV; Zeissler, A; Verhelst, SH 10/16/2015 2/17/2016 Technische Universität München http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199883 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7391&target=Rhomboid+domain-containing+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199883&enzyme=Rhomboid+domain-containing+protein&column=ki&startPg=0&Increment=50&submit=Search DIC 1609 104080348 CHEMBL24983 DB04459 1 MKDLRLHKYFPGTFSLIILTTLVFIYELVVGFDRAIQELAQINGLVTLGQWWRLITAIFLHMGFIHFGLNIFWLFYLGIDLEGIVGTRRFLTVFFASALVGNLLSLITLPPYVASGGASGGLFGVVGALLGIEGVLRRNIQKALINALLLFLINSIFPGVNAVAHFGGLVTGLIFGYYYGKWLRRKMLDMSYWLEVS Peptidase S54 rhomboid domain-containing protein O59166_PYRHO O59166 308835 c1ccc2c(c1)C(=C(OC2=O)Cl)Cl InChI=1S/C9H4Cl2O2/c10-7-5-3-1-2-4-6(5)9(12)13-8(7)11/h1-4H SUGXUUGGLDCZKB-UHFFFAOYSA-N 50199883 cid_1609::3,4-dichloro-1H-isochromen-1-one::CHEMBL24983::3,4-Dichloro-isochromen-1-one::3,4-dichloroisocoumarin::3,4‐Dichloroisocoumarin (2) Rhomboid domain-containing protein Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) 1.0e+3 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.5b00514 10.7270/Q2668BZ8 26218717 aid1801342 Wolf, EV; Zeissler, A; Verhelst, SH 10/16/2015 2/17/2016 Technische Universität München http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199883 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7392&target=Rhomboid+domain-containing+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199883&enzyme=Rhomboid+domain-containing+protein&column=ki&startPg=0&Increment=50&submit=Search DIC 1609 104080348 CHEMBL24983 DB04459 1 MRKRAVYFILLFNAFIFVMMTFSGVFSTRDPVLQMLLLLRYGAQYGPRVDAGDWFRLITALFVHGGILHILFNSYALYYFGLIVEDIYGTEKFLVGYFFTGIVGNLATHVFYHDTISVGASGAIFGLIGILFAAGFRKDTPFFMKPVTGVSLLPIILINVVYGFLPGTNINNAAHLGGFLSGMLLGYTMSPFSWKRRTLWRVLAIAVVLLVVLSYIFLIRQIPEIDEAIRRFKAG Peptidase S54 rhomboid domain-containing protein Q9WZ53_THEMA Q9WZ53 G4FDN6 308836 c1ccc2c(c1)C(=C(OC2=O)Cl)Cl InChI=1S/C9H4Cl2O2/c10-7-5-3-1-2-4-6(5)9(12)13-8(7)11/h1-4H SUGXUUGGLDCZKB-UHFFFAOYSA-N 50199883 cid_1609::3,4-dichloro-1H-isochromen-1-one::CHEMBL24983::3,4-Dichloro-isochromen-1-one::3,4-dichloroisocoumarin::3,4‐Dichloroisocoumarin (2) GlpG protein Vibrio cholerae 2.7e+4 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.5b00514 10.7270/Q2668BZ8 26218717 aid1801342 Wolf, EV; Zeissler, A; Verhelst, SH 10/16/2015 2/17/2016 Technische Universität München http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199883 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7393&target=GlpG+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199883&enzyme=GlpG+protein&column=ki&startPg=0&Increment=50&submit=Search DIC 1609 104080348 CHEMBL24983 DB04459 1 MHLLTTFNNPRAAQAFIDYMAAHHIEIQMMPDAGGQFTLWVIQDQHIETAQAELALFLENPYAEKYQAASWEVADQKRPQFHYASPNLLSLIKAKAGVFTLFIMALCIIIFTLQTFGAGDEVFNALHFPALAGQQWQIWRWVSHALLHFSVMHIAFNLLWWWQFGGDLEQRLGSVRLIKLFVVSAIISGAGQYWVEGANFGGLSGVVYALAGYLWILGQRAPQLGLSIPRSLMGFMLIWLVLGYVQPFMAIANTAHLAGLISGVVLAWFDSQRDQQA GlpG protein Q9KVP2_VIBCH Q9KVP2 308837 c1ccc2c(c1)C(=C(OC2=O)Cl)Cl InChI=1S/C9H4Cl2O2/c10-7-5-3-1-2-4-6(5)9(12)13-8(7)11/h1-4H SUGXUUGGLDCZKB-UHFFFAOYSA-N 50199883 cid_1609::3,4-dichloro-1H-isochromen-1-one::CHEMBL24983::3,4-Dichloro-isochromen-1-one::3,4-dichloroisocoumarin::3,4‐Dichloroisocoumarin (2) Rhomboid protease AarA Providencia stuartii 1.0e+4 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.5b00514 10.7270/Q2668BZ8 26218717 aid1801342 Wolf, EV; Zeissler, A; Verhelst, SH 10/16/2015 2/17/2016 Technische Universität München http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199883 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7394&target=Rhomboid+protease+AarA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199883&enzyme=Rhomboid+protease+AarA&column=ki&startPg=0&Increment=50&submit=Search DIC 1609 104080348 CHEMBL24983 DB04459 1 MAEQQNPFSIKSKARFSLGAIALTLTLVLLNIAVYFYQIVFASPLDSRESNLILFGANIYQLSLTGDWWRYPISMMLHSNGTHLAFNCLALFVIGIGCERAYGKFKLLAIYIISGIGAALFSAYWQYYEISNSDLWTDSTVYITIGVGASGAIMGIAAASVIYLIKVVINKPNPHPVIQRRQKYQLYNLIAMIALTLINGLQSGVDNAAHIGGAIIGALISIAYILVPHKLRVANLCITVIAASLLTMMIYLYSFSTNKHLLEEREFIYQEVYTELADANQ Rhomboid protease AarA AARA_PROST P46116 308838 c1ccc2c(c1)C(=C(OC2=O)Cl)Cl InChI=1S/C9H4Cl2O2/c10-7-5-3-1-2-4-6(5)9(12)13-8(7)11/h1-4H SUGXUUGGLDCZKB-UHFFFAOYSA-N 50199883 cid_1609::3,4-dichloro-1H-isochromen-1-one::CHEMBL24983::3,4-Dichloro-isochromen-1-one::3,4-dichloroisocoumarin::3,4‐Dichloroisocoumarin (2) Rhomboid protease GlpG Escherichia coli (strain K12) 1.9e+4 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.5b00514 10.7270/Q2668BZ8 26218717 aid1801342 Wolf, EV; Zeissler, A; Verhelst, SH 10/16/2015 2/17/2016 Technische Universität München http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199883 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7395&target=Rhomboid+protease+GlpG&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199883&enzyme=Rhomboid+protease+GlpG&column=ki&startPg=0&Increment=50&submit=Search DIC 1DIC 1609 104080348 CHEMBL24983 DB04459 1 MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPADPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLISALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAGWFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK 4QO2,4QO0,6VJ9,6VJ8,5MTF,6XRP,6XRO,5F5B,4NJP,4NJN,3UBB,2NRF,2IC8,2IRV,5MT7,2XOV,3ZOT,2O7L,8AB5,5MT6,3ZMH,3B45,5MT8,4H1D,3ZMJ,3ZMI,3ZEB,3TXT,2XOW,2MJA,2LEP Rhomboid protease GlpG GLPG_ECOLI P09391 P76691 Q2M788 Q6BF32 308839 c1ccc2c(c1)C(=C(OC2=O)Cl)Cl InChI=1S/C9H4Cl2O2/c10-7-5-3-1-2-4-6(5)9(12)13-8(7)11/h1-4H SUGXUUGGLDCZKB-UHFFFAOYSA-N 50199883 cid_1609::3,4-dichloro-1H-isochromen-1-one::CHEMBL24983::3,4-Dichloro-isochromen-1-one::3,4-dichloroisocoumarin::3,4‐Dichloroisocoumarin (2) Rhomboid protease GlpG Haemophilus influenzae 6.6e+2 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.5b00514 10.7270/Q2668BZ8 26218717 aid1801342 Wolf, EV; Zeissler, A; Verhelst, SH 10/16/2015 2/17/2016 Technische Universität München http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199883 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7396&target=Rhomboid+protease+GlpG&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199883&enzyme=Rhomboid+protease+GlpG&column=ki&startPg=0&Increment=50&submit=Search DIC 1DIC 1609 104080348 CHEMBL24983 DB04459 1 MKNFLAQQGKITLILTALCVLIYLAQQLGFEDDIMYLMHYPAYEEQDSEVWRYISHTLVHLSNLHILFNLSWFLIFGGMIERTFGSVKLLMLYVVASAITGYVQNYVSGPAFFGLSGVVYAVLGYVFIRDKLNHHLFDLPEGFFTMLLVGIALGFISPLFGVEMGNAAHISGLIVGLIWGFIDSKLRKNSLE Rhomboid family intramembrane serine protease A0A2R3FW87_HAEIF A0A2R3FW87 308840 c1ccc2c(c1)C(=C(OC2=O)Cl)Cl InChI=1S/C9H4Cl2O2/c10-7-5-3-1-2-4-6(5)9(12)13-8(7)11/h1-4H SUGXUUGGLDCZKB-UHFFFAOYSA-N 50199883 cid_1609::3,4-dichloro-1H-isochromen-1-one::CHEMBL24983::3,4-Dichloro-isochromen-1-one::3,4-dichloroisocoumarin::3,4‐Dichloroisocoumarin (2) Rhomboid protease GluP [F193S,L370F,L379S,R499W] Bacillus subtilis (strain 168) 4.1e+3 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.5b00514 10.7270/Q2668BZ8 26218717 aid1801342 Wolf, EV; Zeissler, A; Verhelst, SH 10/16/2015 2/17/2016 Technische Universität München http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199883 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7397&target=Rhomboid+protease+GluP+%5BF193S%2CL370F%2CL379S%2CR499W%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199883&enzyme=Rhomboid+protease+GluP+%5BF193S%2CL370F%2CL379S%2CR499W%5D&column=ki&startPg=0&Increment=50&submit=Search DIC 1DIC 1609 104080348 CHEMBL24983 DB04459 1 MFLLEYTYWKIAAHLVNSGYGVIQAGESDEIWLEAPDKSSHDLVRLYKHDLDFRQEMVRDIEEQAERVERVRHQLGRRRMKLLNVFFSTEAPVDDWEEIAKKTFEKGTVSVEPAIVRGTMLRDDLQAVFPSFRTEDCSEEHASFENAQMARERFLSLVLKQEEQRKTEAAVFQNGKPTFTYLFIALQILMFSLLEINGGSTNTETLVAFGAKENSLIAQGEWWRLLTPIVLHIGIAHLAFNTLALWSVGTAVERMYGSGRFLLIYLAAGITGSIASFVFSPYPSAGASGAIFGCLGALLYVALSNRKMFLRTIGTNIIVIIIINLGFGFAVSNIDNSGHIGGLIGGFFAAAALGLPKAGAFGKRLLSAVFLIALAVGFSYYGLHSPSHQESALIQQASELYQEGKYEEVTELLNGEAAQKDASADLLKILAVSDIQIGEYDQAVSLLERAVKKEPKDHASYYNLALLYAEKNELAQAEKAIQTAVKLKPKEQRYKELQWQIENNKES 6R0J Rhomboid protease GluP GLUP_BACSU P54493 308841 c1ccc2c(c1)C(=C(OC2=O)Cl)Cl InChI=1S/C9H4Cl2O2/c10-7-5-3-1-2-4-6(5)9(12)13-8(7)11/h1-4H SUGXUUGGLDCZKB-UHFFFAOYSA-N 50199883 cid_1609::3,4-dichloro-1H-isochromen-1-one::CHEMBL24983::3,4-Dichloro-isochromen-1-one::3,4-dichloroisocoumarin::3,4‐Dichloroisocoumarin (2) Rhomboid-related protein 1 Mus musculus 2.8e+4 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.5b00514 10.7270/Q2668BZ8 26218717 aid1801342 Wolf, EV; Zeissler, A; Verhelst, SH 10/16/2015 2/17/2016 Technische Universität München http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199883 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7398&target=Rhomboid-related+protein+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199883&enzyme=Rhomboid-related+protein+1&column=ki&startPg=0&Increment=50&submit=Search DIC 1609 104080348 CHEMBL24983 DB04459 1 MDRSSLLQLIQEQQLDPENTGFIGADTFAGLVHSHELPLDPTKLDMLVALAQSNERGQVCYQELVDLISSKRSSSFKRAIANGQRALPRDGLLDEPGLSVYKRFVRYVAYEILPCEVDRRWYFYRHRTCPPPVFMASVTLAQIIVFLCYGARLNKWVLQTYHPEYMKSPLVYHPGHRARAWRFLTYMFMHVGLEQLGFNALLQLMIGVPLEMVHGVLRISLLYLAGVLAGSLTVSITDMRAPVVGGSGGVYALCSAHLANVVMNWAGMRCPYKLLRMVLALVCMSSEVGRAVWLRFSPPLPASGPQPSFMAHLAGAVVGVSMGLTILRSYEERLRDQCGWWVVLLAYGTFLLFAIFWNVFAYDLLGADIPPPP Rhomboid-related protein 1 RHBL1_MOUSE Q8VC82 308842 c1ccc2c(c1)C(=C(OC2=O)Cl)Cl InChI=1S/C9H4Cl2O2/c10-7-5-3-1-2-4-6(5)9(12)13-8(7)11/h1-4H SUGXUUGGLDCZKB-UHFFFAOYSA-N 50199883 cid_1609::3,4-dichloro-1H-isochromen-1-one::CHEMBL24983::3,4-Dichloro-isochromen-1-one::3,4-dichloroisocoumarin::3,4‐Dichloroisocoumarin (2) Rhomboid-related protein 3 Mus musculus 7.0e+4 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.5b00514 10.7270/Q2668BZ8 26218717 aid1801342 Wolf, EV; Zeissler, A; Verhelst, SH 10/16/2015 2/17/2016 Technische Universität München http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199883 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7399&target=Rhomboid-related+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199883&enzyme=Rhomboid-related+protein+3&column=ki&startPg=0&Increment=50&submit=Search DIC 1609 104080348 CHEMBL24983 DB04459 1 MGEHPSPGPAVAACAEAERIEELEPEAEERLPAAPEDHWKVLFEKFDPGSTGYISTGKFRSLLESHSSKLDPHKKEVLLALADSHADGQICYQDFVNLMSNKRSNSFRQAILQGNRRLSSKALLEEKGLSLSQRLIRHVAYETLPREIDRKWYYDSYTCCPPPWFMITITLLEVALFLYNGVLLDQFVLQVTHPRYLKNSLVYHPQLRAQAWRYVTYIFMHAGVEQLGLNVALQLLVGVPLEMVHGATRIGLVYVAGVVAGSLAVSVADMTAPVVGSSGGVYALVSAHLANIVMNWSGMKCQFKLLRMAVALICMSMEFGRAVWLRFHPSAYPPCPHPSFVAHLGGVAVGITLGVVVLRNYEQRLQDQSLWWIFVTMYTIFVLFAVFWNIFAYTLLDLKLPPAP Rhomboid-related protein 3 RHBL3_MOUSE P58873 308843 [O-][N+](=O)c1ccc2c(Cl)c(OCCCCCc3ccccc3)oc(=O)c2c1 InChI=1S/C20H18ClNO5/c21-18-16-11-10-15(22(24)25)13-17(16)19(23)27-20(18)26-12-6-2-5-9-14-7-3-1-4-8-14/h1,3-4,7-8,10-11,13H,2,5-6,9,12H2 VKSNRCDTOIDGQI-UHFFFAOYSA-N 165194 4‐Chloro‐7‐nitro‐3‐[(5‐phenylpentyl)oxy]isochromen‐1‐one (21) Rhomboid domain-containing protein Aquifex aeolicus (strain VF5) 1.7e+3 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.5b00514 10.7270/Q2668BZ8 26218717 aid1801342 Wolf, EV; Zeissler, A; Verhelst, SH 10/16/2015 2/17/2016 Technische Universität München http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=165194 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7389&target=Rhomboid+domain-containing+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=165194&enzyme=Rhomboid+domain-containing+protein&column=ki&startPg=0&Increment=50&submit=Search 118009867 311420154 1 MIPIKDVNPSRTFPIVNLSIIVACSLIWLYEWSLTDEVIYTFQGAVTKFELFLREWGLVPVELPQKPYTLLTHMFLHGSWGHIIGNMWFLWVFGDNVEDKLGKFRYIIFYILCGLGAALTQTFISLAFGGANVPMVGASGAISGVLGAYMKMFPHARVLALVPVFIFLTLMELPAVIFIGLWFFIQIINGIITLPFIGYGGVAWYAHIGGFITGYLLVDYFRKRSYS Peptidase S54 rhomboid domain-containing protein O67346_AQUAE O67346 308844 [O-][N+](=O)c1ccc2c(Cl)c(OCCCCCc3ccccc3)oc(=O)c2c1 InChI=1S/C20H18ClNO5/c21-18-16-11-10-15(22(24)25)13-17(16)19(23)27-20(18)26-12-6-2-5-9-14-7-3-1-4-8-14/h1,3-4,7-8,10-11,13H,2,5-6,9,12H2 VKSNRCDTOIDGQI-UHFFFAOYSA-N 165194 4‐Chloro‐7‐nitro‐3‐[(5‐phenylpentyl)oxy]isochromen‐1‐one (21) Rhomboid domain-containing protein Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) 2.5e+4 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.5b00514 10.7270/Q2668BZ8 26218717 aid1801342 Wolf, EV; Zeissler, A; Verhelst, SH 10/16/2015 2/17/2016 Technische Universität München http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=165194 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7391&target=Rhomboid+domain-containing+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=165194&enzyme=Rhomboid+domain-containing+protein&column=ki&startPg=0&Increment=50&submit=Search 118009867 311420154 1 MKDLRLHKYFPGTFSLIILTTLVFIYELVVGFDRAIQELAQINGLVTLGQWWRLITAIFLHMGFIHFGLNIFWLFYLGIDLEGIVGTRRFLTVFFASALVGNLLSLITLPPYVASGGASGGLFGVVGALLGIEGVLRRNIQKALINALLLFLINSIFPGVNAVAHFGGLVTGLIFGYYYGKWLRRKMLDMSYWLEVS Peptidase S54 rhomboid domain-containing protein O59166_PYRHO O59166 308845 [O-][N+](=O)c1ccc2c(Cl)c(OCCCCCc3ccccc3)oc(=O)c2c1 InChI=1S/C20H18ClNO5/c21-18-16-11-10-15(22(24)25)13-17(16)19(23)27-20(18)26-12-6-2-5-9-14-7-3-1-4-8-14/h1,3-4,7-8,10-11,13H,2,5-6,9,12H2 VKSNRCDTOIDGQI-UHFFFAOYSA-N 165194 4‐Chloro‐7‐nitro‐3‐[(5‐phenylpentyl)oxy]isochromen‐1‐one (21) Rhomboid domain-containing protein Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) 2.8e+4 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.5b00514 10.7270/Q2668BZ8 26218717 aid1801342 Wolf, EV; Zeissler, A; Verhelst, SH 10/16/2015 2/17/2016 Technische Universität München http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=165194 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7392&target=Rhomboid+domain-containing+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=165194&enzyme=Rhomboid+domain-containing+protein&column=ki&startPg=0&Increment=50&submit=Search 118009867 311420154 1 MRKRAVYFILLFNAFIFVMMTFSGVFSTRDPVLQMLLLLRYGAQYGPRVDAGDWFRLITALFVHGGILHILFNSYALYYFGLIVEDIYGTEKFLVGYFFTGIVGNLATHVFYHDTISVGASGAIFGLIGILFAAGFRKDTPFFMKPVTGVSLLPIILINVVYGFLPGTNINNAAHLGGFLSGMLLGYTMSPFSWKRRTLWRVLAIAVVLLVVLSYIFLIRQIPEIDEAIRRFKAG Peptidase S54 rhomboid domain-containing protein Q9WZ53_THEMA Q9WZ53 G4FDN6 308846 [O-][N+](=O)c1ccc2c(Cl)c(OCCCCCc3ccccc3)oc(=O)c2c1 InChI=1S/C20H18ClNO5/c21-18-16-11-10-15(22(24)25)13-17(16)19(23)27-20(18)26-12-6-2-5-9-14-7-3-1-4-8-14/h1,3-4,7-8,10-11,13H,2,5-6,9,12H2 VKSNRCDTOIDGQI-UHFFFAOYSA-N 165194 4‐Chloro‐7‐nitro‐3‐[(5‐phenylpentyl)oxy]isochromen‐1‐one (21) GlpG protein Vibrio cholerae 7.6e+4 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.5b00514 10.7270/Q2668BZ8 26218717 aid1801342 Wolf, EV; Zeissler, A; Verhelst, SH 10/16/2015 2/17/2016 Technische Universität München http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=165194 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7393&target=GlpG+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=165194&enzyme=GlpG+protein&column=ki&startPg=0&Increment=50&submit=Search 118009867 311420154 1 MHLLTTFNNPRAAQAFIDYMAAHHIEIQMMPDAGGQFTLWVIQDQHIETAQAELALFLENPYAEKYQAASWEVADQKRPQFHYASPNLLSLIKAKAGVFTLFIMALCIIIFTLQTFGAGDEVFNALHFPALAGQQWQIWRWVSHALLHFSVMHIAFNLLWWWQFGGDLEQRLGSVRLIKLFVVSAIISGAGQYWVEGANFGGLSGVVYALAGYLWILGQRAPQLGLSIPRSLMGFMLIWLVLGYVQPFMAIANTAHLAGLISGVVLAWFDSQRDQQA GlpG protein Q9KVP2_VIBCH Q9KVP2 308847 [O-][N+](=O)c1ccc2c(Cl)c(OCCCCCc3ccccc3)oc(=O)c2c1 InChI=1S/C20H18ClNO5/c21-18-16-11-10-15(22(24)25)13-17(16)19(23)27-20(18)26-12-6-2-5-9-14-7-3-1-4-8-14/h1,3-4,7-8,10-11,13H,2,5-6,9,12H2 VKSNRCDTOIDGQI-UHFFFAOYSA-N 165194 4‐Chloro‐7‐nitro‐3‐[(5‐phenylpentyl)oxy]isochromen‐1‐one (21) Rhomboid protease AarA Providencia stuartii 1.00e+4 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.5b00514 10.7270/Q2668BZ8 26218717 aid1801342 Wolf, EV; Zeissler, A; Verhelst, SH 10/16/2015 2/17/2016 Technische Universität München http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=165194 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7394&target=Rhomboid+protease+AarA&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=165194&enzyme=Rhomboid+protease+AarA&column=ki&startPg=0&Increment=50&submit=Search 118009867 311420154 1 MAEQQNPFSIKSKARFSLGAIALTLTLVLLNIAVYFYQIVFASPLDSRESNLILFGANIYQLSLTGDWWRYPISMMLHSNGTHLAFNCLALFVIGIGCERAYGKFKLLAIYIISGIGAALFSAYWQYYEISNSDLWTDSTVYITIGVGASGAIMGIAAASVIYLIKVVINKPNPHPVIQRRQKYQLYNLIAMIALTLINGLQSGVDNAAHIGGAIIGALISIAYILVPHKLRVANLCITVIAASLLTMMIYLYSFSTNKHLLEEREFIYQEVYTELADANQ Rhomboid protease AarA AARA_PROST P46116 308848 [O-][N+](=O)c1ccc2c(Cl)c(OCCCCCc3ccccc3)oc(=O)c2c1 InChI=1S/C20H18ClNO5/c21-18-16-11-10-15(22(24)25)13-17(16)19(23)27-20(18)26-12-6-2-5-9-14-7-3-1-4-8-14/h1,3-4,7-8,10-11,13H,2,5-6,9,12H2 VKSNRCDTOIDGQI-UHFFFAOYSA-N 165194 4‐Chloro‐7‐nitro‐3‐[(5‐phenylpentyl)oxy]isochromen‐1‐one (21) Rhomboid protease GlpG Haemophilus influenzae 4.6e+3 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.5b00514 10.7270/Q2668BZ8 26218717 aid1801342 Wolf, EV; Zeissler, A; Verhelst, SH 10/16/2015 2/17/2016 Technische Universität München http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=165194 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7396&target=Rhomboid+protease+GlpG&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=165194&enzyme=Rhomboid+protease+GlpG&column=ki&startPg=0&Increment=50&submit=Search 118009867 311420154 1 MKNFLAQQGKITLILTALCVLIYLAQQLGFEDDIMYLMHYPAYEEQDSEVWRYISHTLVHLSNLHILFNLSWFLIFGGMIERTFGSVKLLMLYVVASAITGYVQNYVSGPAFFGLSGVVYAVLGYVFIRDKLNHHLFDLPEGFFTMLLVGIALGFISPLFGVEMGNAAHISGLIVGLIWGFIDSKLRKNSLE Rhomboid family intramembrane serine protease A0A2R3FW87_HAEIF A0A2R3FW87 308849 [O-][N+](=O)c1ccc2c(Cl)c(OCCCCCc3ccccc3)oc(=O)c2c1 InChI=1S/C20H18ClNO5/c21-18-16-11-10-15(22(24)25)13-17(16)19(23)27-20(18)26-12-6-2-5-9-14-7-3-1-4-8-14/h1,3-4,7-8,10-11,13H,2,5-6,9,12H2 VKSNRCDTOIDGQI-UHFFFAOYSA-N 165194 4‐Chloro‐7‐nitro‐3‐[(5‐phenylpentyl)oxy]isochromen‐1‐one (21) Rhomboid protease GluP [F193S,L370F,L379S,R499W] Bacillus subtilis (strain 168) 2.5e+4 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.5b00514 10.7270/Q2668BZ8 26218717 aid1801342 Wolf, EV; Zeissler, A; Verhelst, SH 10/16/2015 2/17/2016 Technische Universität München http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=165194 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7397&target=Rhomboid+protease+GluP+%5BF193S%2CL370F%2CL379S%2CR499W%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=165194&enzyme=Rhomboid+protease+GluP+%5BF193S%2CL370F%2CL379S%2CR499W%5D&column=ki&startPg=0&Increment=50&submit=Search 118009867 311420154 1 MFLLEYTYWKIAAHLVNSGYGVIQAGESDEIWLEAPDKSSHDLVRLYKHDLDFRQEMVRDIEEQAERVERVRHQLGRRRMKLLNVFFSTEAPVDDWEEIAKKTFEKGTVSVEPAIVRGTMLRDDLQAVFPSFRTEDCSEEHASFENAQMARERFLSLVLKQEEQRKTEAAVFQNGKPTFTYLFIALQILMFSLLEINGGSTNTETLVAFGAKENSLIAQGEWWRLLTPIVLHIGIAHLAFNTLALWSVGTAVERMYGSGRFLLIYLAAGITGSIASFVFSPYPSAGASGAIFGCLGALLYVALSNRKMFLRTIGTNIIVIIIINLGFGFAVSNIDNSGHIGGLIGGFFAAAALGLPKAGAFGKRLLSAVFLIALAVGFSYYGLHSPSHQESALIQQASELYQEGKYEEVTELLNGEAAQKDASADLLKILAVSDIQIGEYDQAVSLLERAVKKEPKDHASYYNLALLYAEKNELAQAEKAIQTAVKLKPKEQRYKELQWQIENNKES 6R0J Rhomboid protease GluP GLUP_BACSU P54493 308850 [O-][N+](=O)c1ccc2c(Cl)c(OCCCCCc3ccccc3)oc(=O)c2c1 InChI=1S/C20H18ClNO5/c21-18-16-11-10-15(22(24)25)13-17(16)19(23)27-20(18)26-12-6-2-5-9-14-7-3-1-4-8-14/h1,3-4,7-8,10-11,13H,2,5-6,9,12H2 VKSNRCDTOIDGQI-UHFFFAOYSA-N 165194 4‐Chloro‐7‐nitro‐3‐[(5‐phenylpentyl)oxy]isochromen‐1‐one (21) Rhomboid-related protein 1 Mus musculus 3.9e+4 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.5b00514 10.7270/Q2668BZ8 26218717 aid1801342 Wolf, EV; Zeissler, A; Verhelst, SH 10/16/2015 2/17/2016 Technische Universität München http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=165194 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7398&target=Rhomboid-related+protein+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=165194&enzyme=Rhomboid-related+protein+1&column=ki&startPg=0&Increment=50&submit=Search 118009867 311420154 1 MDRSSLLQLIQEQQLDPENTGFIGADTFAGLVHSHELPLDPTKLDMLVALAQSNERGQVCYQELVDLISSKRSSSFKRAIANGQRALPRDGLLDEPGLSVYKRFVRYVAYEILPCEVDRRWYFYRHRTCPPPVFMASVTLAQIIVFLCYGARLNKWVLQTYHPEYMKSPLVYHPGHRARAWRFLTYMFMHVGLEQLGFNALLQLMIGVPLEMVHGVLRISLLYLAGVLAGSLTVSITDMRAPVVGGSGGVYALCSAHLANVVMNWAGMRCPYKLLRMVLALVCMSSEVGRAVWLRFSPPLPASGPQPSFMAHLAGAVVGVSMGLTILRSYEERLRDQCGWWVVLLAYGTFLLFAIFWNVFAYDLLGADIPPPP Rhomboid-related protein 1 RHBL1_MOUSE Q8VC82 308851 [O-][N+](=O)c1ccc2c(Cl)c(OCCCCCc3ccccc3)oc(=O)c2c1 InChI=1S/C20H18ClNO5/c21-18-16-11-10-15(22(24)25)13-17(16)19(23)27-20(18)26-12-6-2-5-9-14-7-3-1-4-8-14/h1,3-4,7-8,10-11,13H,2,5-6,9,12H2 VKSNRCDTOIDGQI-UHFFFAOYSA-N 165194 4‐Chloro‐7‐nitro‐3‐[(5‐phenylpentyl)oxy]isochromen‐1‐one (21) Rhomboid-related protein 3 Mus musculus 2.4e+4 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.5b00514 10.7270/Q2668BZ8 26218717 aid1801342 Wolf, EV; Zeissler, A; Verhelst, SH 10/16/2015 2/17/2016 Technische Universität München http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=165194 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7399&target=Rhomboid-related+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=165194&enzyme=Rhomboid-related+protein+3&column=ki&startPg=0&Increment=50&submit=Search 118009867 311420154 1 MGEHPSPGPAVAACAEAERIEELEPEAEERLPAAPEDHWKVLFEKFDPGSTGYISTGKFRSLLESHSSKLDPHKKEVLLALADSHADGQICYQDFVNLMSNKRSNSFRQAILQGNRRLSSKALLEEKGLSLSQRLIRHVAYETLPREIDRKWYYDSYTCCPPPWFMITITLLEVALFLYNGVLLDQFVLQVTHPRYLKNSLVYHPQLRAQAWRYVTYIFMHAGVEQLGLNVALQLLVGVPLEMVHGATRIGLVYVAGVVAGSLAVSVADMTAPVVGSSGGVYALVSAHLANIVMNWSGMKCQFKLLRMAVALICMSMEFGRAVWLRFHPSAYPPCPHPSFVAHLGGVAVGITLGVVVLRNYEQRLQDQSLWWIFVTMYTIFVLFAVFWNIFAYTLLDLKLPPAP Rhomboid-related protein 3 RHBL3_MOUSE P58873 308852 COc1cc(cc(OC)c1OC)[C@H]1[C@H](CCCC#C)OC1=O |r| InChI=1S/C17H20O5/c1-5-6-7-8-12-15(17(18)22-12)11-9-13(19-2)16(21-4)14(10-11)20-3/h1,9-10,12,15H,6-8H2,2-4H3 GLMCNOVMCJRNNZ-UHFFFAOYSA-N 165195 (4S)‐4‐(pent‐4‐yn‐1‐yl)‐3‐(3,4,5‐trimethoxyphenyl)oxetan‐2‐one (45) AN1-type domain-containing protein Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) 5.0e+3 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.5b00514 10.7270/Q2668BZ8 26218717 aid1801342 Wolf, EV; Zeissler, A; Verhelst, SH 10/16/2015 2/17/2016 Technische Universität München http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=165195 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7390&target=AN1-type+domain-containing+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=165195&enzyme=AN1-type+domain-containing+protein&column=ki&startPg=0&Increment=50&submit=Search 118009868 311420155 1 MLLHSFSRFKLLRGFLSLAAANYAMKHLPLFSTAVENFALFPRLPNSTQAEAFLTSRSLMLRVARCDVCGEEVTIPFKCKYCGGTFCAEHRLPENHDCDGLDEYWNVPVNVKRRLSPQPARRSRNIGLMKYGANNTVLIICTILFFISIVAPYEMVEIFALHPRLDVLLAMPWQLITSMFLHVEFWHFFVNMFVLLFFGTELERRLGDRKYLEIFFVSGLAGNVGYIAYSYAVGSFAPALGASAAIFGVMGCLAIIAPEIRIIIFPIPIPINIRTALLLFAAYDFWMMVASYMGLFYTNVANIAHLAGLAVGLYYGKRLGRRKVRYDFYF AN1-type domain-containing protein O29251_ARCFU O29251 308853 COc1cc(cc(OC)c1OC)[C@H]1[C@H](CCCC#C)OC1=O |r| InChI=1S/C17H20O5/c1-5-6-7-8-12-15(17(18)22-12)11-9-13(19-2)16(21-4)14(10-11)20-3/h1,9-10,12,15H,6-8H2,2-4H3 GLMCNOVMCJRNNZ-UHFFFAOYSA-N 165195 (4S)‐4‐(pent‐4‐yn‐1‐yl)‐3‐(3,4,5‐trimethoxyphenyl)oxetan‐2‐one (45) Rhomboid protease GlpG Haemophilus influenzae 6.5e+4 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.5b00514 10.7270/Q2668BZ8 26218717 aid1801342 Wolf, EV; Zeissler, A; Verhelst, SH 10/16/2015 2/17/2016 Technische Universität München http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=165195 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7396&target=Rhomboid+protease+GlpG&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=165195&enzyme=Rhomboid+protease+GlpG&column=ki&startPg=0&Increment=50&submit=Search 118009868 311420155 1 MKNFLAQQGKITLILTALCVLIYLAQQLGFEDDIMYLMHYPAYEEQDSEVWRYISHTLVHLSNLHILFNLSWFLIFGGMIERTFGSVKLLMLYVVASAITGYVQNYVSGPAFFGLSGVVYAVLGYVFIRDKLNHHLFDLPEGFFTMLLVGIALGFISPLFGVEMGNAAHISGLIVGLIWGFIDSKLRKNSLE Rhomboid family intramembrane serine protease A0A2R3FW87_HAEIF A0A2R3FW87 308854 CCCCC[C@H]1[C@H](CCCC#C)OC1=O |r| InChI=1S/C13H20O2/c1-3-5-7-9-11-12(15-13(11)14)10-8-6-4-2/h2,11-12H,3,5-10H2,1H3 DNYYDSGOXHBAHD-UHFFFAOYSA-N 165196 (4S)‐4‐(pent‐4‐yn‐1‐yl)‐3‐pentyloxetan‐2‐one (47) Rhomboid domain-containing protein Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) 2.7e+4 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.5b00514 10.7270/Q2668BZ8 26218717 aid1801342 Wolf, EV; Zeissler, A; Verhelst, SH 10/16/2015 2/17/2016 Technische Universität München http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=165196 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7392&target=Rhomboid+domain-containing+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=165196&enzyme=Rhomboid+domain-containing+protein&column=ki&startPg=0&Increment=50&submit=Search 118009869 311420156 1 MRKRAVYFILLFNAFIFVMMTFSGVFSTRDPVLQMLLLLRYGAQYGPRVDAGDWFRLITALFVHGGILHILFNSYALYYFGLIVEDIYGTEKFLVGYFFTGIVGNLATHVFYHDTISVGASGAIFGLIGILFAAGFRKDTPFFMKPVTGVSLLPIILINVVYGFLPGTNINNAAHLGGFLSGMLLGYTMSPFSWKRRTLWRVLAIAVVLLVVLSYIFLIRQIPEIDEAIRRFKAG Peptidase S54 rhomboid domain-containing protein Q9WZ53_THEMA Q9WZ53 G4FDN6 308855 CCCC[C@H]1[C@H](CCCC#C)OC1=O |r| InChI=1S/C12H18O2/c1-3-5-7-9-11-10(8-6-4-2)12(13)14-11/h1,10-11H,4-9H2,2H3 QYQXKJPVOQJNRW-UHFFFAOYSA-N 165197 (4S)‐3‐butyl‐4‐(pent‐4‐yn‐1‐yl)oxetan‐2‐one (48) Rhomboid domain-containing protein Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) 4.8e+4 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.5b00514 10.7270/Q2668BZ8 26218717 aid1801342 Wolf, EV; Zeissler, A; Verhelst, SH 10/16/2015 2/17/2016 Technische Universität München http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=165197 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7392&target=Rhomboid+domain-containing+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=165197&enzyme=Rhomboid+domain-containing+protein&column=ki&startPg=0&Increment=50&submit=Search 118009870 311420157 1 MRKRAVYFILLFNAFIFVMMTFSGVFSTRDPVLQMLLLLRYGAQYGPRVDAGDWFRLITALFVHGGILHILFNSYALYYFGLIVEDIYGTEKFLVGYFFTGIVGNLATHVFYHDTISVGASGAIFGLIGILFAAGFRKDTPFFMKPVTGVSLLPIILINVVYGFLPGTNINNAAHLGGFLSGMLLGYTMSPFSWKRRTLWRVLAIAVVLLVVLSYIFLIRQIPEIDEAIRRFKAG Peptidase S54 rhomboid domain-containing protein Q9WZ53_THEMA Q9WZ53 G4FDN6 308856 CCCC[C@H]1[C@H](CCCC#C)OC1=O |r| InChI=1S/C12H18O2/c1-3-5-7-9-11-10(8-6-4-2)12(13)14-11/h1,10-11H,4-9H2,2H3 QYQXKJPVOQJNRW-UHFFFAOYSA-N 165197 (4S)‐3‐butyl‐4‐(pent‐4‐yn‐1‐yl)oxetan‐2‐one (48) Rhomboid protease GlpG Escherichia coli (strain K12) 4.4e+4 7.4000 37.00 C Curated from the literature by BindingDB 10.1021/acschembio.5b00514 10.7270/Q2668BZ8 26218717 aid1801342 Wolf, EV; Zeissler, A; Verhelst, SH 10/16/2015 2/17/2016 Technische Universität München http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=165197 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7395&target=Rhomboid+protease+GlpG&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=165197&enzyme=Rhomboid+protease+GlpG&column=ki&startPg=0&Increment=50&submit=Search 118009870 311420157 1 MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPADPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLISALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAGWFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK 4QO2,4QO0,6VJ9,6VJ8,5MTF,6XRP,6XRO,5F5B,4NJP,4NJN,3UBB,2NRF,2IC8,2IRV,5MT7,2XOV,3ZOT,2O7L,8AB5,5MT6,3ZMH,3B45,5MT8,4H1D,3ZMJ,3ZMI,3ZEB,3TXT,2XOW,2MJA,2LEP Rhomboid protease GlpG GLPG_ECOLI P09391 P76691 Q2M788 Q6BF32