BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50301852 CCOc1nn(-c2cccc(Oc3ccccc3)c2)c(=O)o1 InChI=1S/C16H14N2O4/c1-2-20-15-17-18(16(19)22-15)12-7-6-10-14(11-12)21-13-8-4-3-5-9-13/h3-11H,2H2,1H3 OPUUTKNZIZBSCJ-UHFFFAOYSA-N 50065639 CHEMBL3402828 Monoglyceride lipase Homo sapiens 676 ChEMBL 10.1016/j.bmcl.2015.02.037 10.7270/Q20Z74Z4 25752982 Patel, JZ; Ahenkorah, S; Vaara, M; Staszewski, M; Adams, Y; Laitinen, T; Navia-Paldanius, D; Parkkari, T; Savinainen, JR; Walczynski, K; Laitinen, JT; Nevalainen, TJ 3/24/2015 4/10/2016 University of Eastern Finland http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065639 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065639&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 18184758 313071465 CHEMBL3402828 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50301853 CCOc1nn(-c2cccc(Oc3ccccc3)c2)c(=O)o1 InChI=1S/C16H14N2O4/c1-2-20-15-17-18(16(19)22-15)12-7-6-10-14(11-12)21-13-8-4-3-5-9-13/h3-11H,2H2,1H3 OPUUTKNZIZBSCJ-UHFFFAOYSA-N 50065639 CHEMBL3402828 Monoglyceride lipase Homo sapiens 155 ChEMBL 10.1016/j.bmcl.2015.02.037 10.7270/Q20Z74Z4 25752982 Patel, JZ; Ahenkorah, S; Vaara, M; Staszewski, M; Adams, Y; Laitinen, T; Navia-Paldanius, D; Parkkari, T; Savinainen, JR; Walczynski, K; Laitinen, JT; Nevalainen, TJ 3/24/2015 4/10/2016 University of Eastern Finland http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065639 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065639&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 18184758 313071465 CHEMBL3402828 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50301854 CCOc1nn(-c2cccc(Oc3ccccc3)c2)c(=O)o1 InChI=1S/C16H14N2O4/c1-2-20-15-17-18(16(19)22-15)12-7-6-10-14(11-12)21-13-8-4-3-5-9-13/h3-11H,2H2,1H3 OPUUTKNZIZBSCJ-UHFFFAOYSA-N 50065639 CHEMBL3402828 Monoglyceride lipase Homo sapiens 93 ChEMBL 10.1016/j.bmcl.2015.02.037 10.7270/Q20Z74Z4 25752982 Patel, JZ; Ahenkorah, S; Vaara, M; Staszewski, M; Adams, Y; Laitinen, T; Navia-Paldanius, D; Parkkari, T; Savinainen, JR; Walczynski, K; Laitinen, JT; Nevalainen, TJ 3/24/2015 4/10/2016 University of Eastern Finland http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065639 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065639&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 18184758 313071465 CHEMBL3402828 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50301855 Clc1ccc2c(-[#6]-[#6]-c3cccnc3\[#6]-2=[#6]-2\[#6]-[#6]-[#7](-[#6]-[#6]-2)-[#6](=O)-n2cncn2)c1 InChI=1S/C22H8ClN5O/c23-18-5-6-19-17(12-18)4-3-16-2-1-9-25-21(16)20(19)15-7-10-27(11-8-15)22(29)28-14-24-13-26-28/h1-2,5-6,9,12-14H FWPVOBLFYXTULZ-UHFFFAOYSA-N 50065640 CHEMBL3401455 Monoglyceride lipase Homo sapiens 209 ChEMBL 10.1016/j.bmcl.2015.02.037 10.7270/Q20Z74Z4 25752982 Patel, JZ; Ahenkorah, S; Vaara, M; Staszewski, M; Adams, Y; Laitinen, T; Navia-Paldanius, D; Parkkari, T; Savinainen, JR; Walczynski, K; Laitinen, JT; Nevalainen, TJ 3/24/2015 4/10/2016 University of Eastern Finland http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065640 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065640&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 102596130 313071466 CHEMBL3401455 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50301856 Clc1ccc2c(-[#6]-[#6]-c3cccnc3\[#6]-2=[#6]-2\[#6]-[#6]-[#7](-[#6]-[#6]-2)-[#6](=O)-n2cncn2)c1 InChI=1S/C22H8ClN5O/c23-18-5-6-19-17(12-18)4-3-16-2-1-9-25-21(16)20(19)15-7-10-27(11-8-15)22(29)28-14-24-13-26-28/h1-2,5-6,9,12-14H FWPVOBLFYXTULZ-UHFFFAOYSA-N 50065640 CHEMBL3401455 Monoglyceride lipase Homo sapiens 224 ChEMBL 10.1016/j.bmcl.2015.02.037 10.7270/Q20Z74Z4 25752982 Patel, JZ; Ahenkorah, S; Vaara, M; Staszewski, M; Adams, Y; Laitinen, T; Navia-Paldanius, D; Parkkari, T; Savinainen, JR; Walczynski, K; Laitinen, JT; Nevalainen, TJ 3/24/2015 4/10/2016 University of Eastern Finland http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065640 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065640&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 102596130 313071466 CHEMBL3401455 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50301857 Clc1ccc2c(-[#6]-[#6]-c3cccnc3\[#6]-2=[#6]-2\[#6]-[#6]-[#7](-[#6]-[#6]-2)-[#6](=O)-n2cncn2)c1 InChI=1S/C22H8ClN5O/c23-18-5-6-19-17(12-18)4-3-16-2-1-9-25-21(16)20(19)15-7-10-27(11-8-15)22(29)28-14-24-13-26-28/h1-2,5-6,9,12-14H FWPVOBLFYXTULZ-UHFFFAOYSA-N 50065640 CHEMBL3401455 Monoglyceride lipase Homo sapiens 257 ChEMBL 10.1016/j.bmcl.2015.02.037 10.7270/Q20Z74Z4 25752982 Patel, JZ; Ahenkorah, S; Vaara, M; Staszewski, M; Adams, Y; Laitinen, T; Navia-Paldanius, D; Parkkari, T; Savinainen, JR; Walczynski, K; Laitinen, JT; Nevalainen, TJ 3/24/2015 4/10/2016 University of Eastern Finland http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065640 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065640&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 102596130 313071466 CHEMBL3401455 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50301858 Clc1ccc2c(-[#6]-[#6]-c3cccnc3\[#6]-2=[#6]-2\[#6]-[#6]-[#7](-[#6]-[#6]-2)-[#6](=O)-n2cncn2)c1 InChI=1S/C22H8ClN5O/c23-18-5-6-19-17(12-18)4-3-16-2-1-9-25-21(16)20(19)15-7-10-27(11-8-15)22(29)28-14-24-13-26-28/h1-2,5-6,9,12-14H FWPVOBLFYXTULZ-UHFFFAOYSA-N 50065640 CHEMBL3401455 Monoglyceride lipase Homo sapiens 309 ChEMBL 10.1016/j.bmcl.2015.02.037 10.7270/Q20Z74Z4 25752982 Patel, JZ; Ahenkorah, S; Vaara, M; Staszewski, M; Adams, Y; Laitinen, T; Navia-Paldanius, D; Parkkari, T; Savinainen, JR; Walczynski, K; Laitinen, JT; Nevalainen, TJ 3/24/2015 4/10/2016 University of Eastern Finland http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065640 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065640&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 102596130 313071466 CHEMBL3401455 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50301859 Clc1ccc2c(-[#6]-[#6]-c3cccnc3\[#6]-2=[#6]-2\[#6]-[#6]-[#7](-[#6]-[#6]-2)-[#6](=O)-n2cncn2)c1 InChI=1S/C22H8ClN5O/c23-18-5-6-19-17(12-18)4-3-16-2-1-9-25-21(16)20(19)15-7-10-27(11-8-15)22(29)28-14-24-13-26-28/h1-2,5-6,9,12-14H FWPVOBLFYXTULZ-UHFFFAOYSA-N 50065640 CHEMBL3401455 Monoglyceride lipase Homo sapiens 46 ChEMBL 10.1016/j.bmcl.2015.02.037 10.7270/Q20Z74Z4 25752982 Patel, JZ; Ahenkorah, S; Vaara, M; Staszewski, M; Adams, Y; Laitinen, T; Navia-Paldanius, D; Parkkari, T; Savinainen, JR; Walczynski, K; Laitinen, JT; Nevalainen, TJ 3/24/2015 4/10/2016 University of Eastern Finland http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065640 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065640&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 102596130 313071466 CHEMBL3401455 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50301860 Clc1ccc2c(-[#6]-[#6]-c3cccnc3\[#6]-2=[#6]-2\[#6]-[#6]-[#7](-[#6]-[#6]-2)-[#6](=O)-n2nnc3ccccc23)c1 InChI=1S/C26H10ClN5O/c27-20-9-10-21-19(16-20)8-7-18-4-3-13-28-25(18)24(21)17-11-14-31(15-12-17)26(33)32-23-6-2-1-5-22(23)29-30-32/h1-6,9-10,13,16H PXCWTDRPXPAJQI-UHFFFAOYSA-N 50065641 CHEMBL3401456 Monoglyceride lipase Homo sapiens 208 ChEMBL 10.1016/j.bmcl.2015.02.037 10.7270/Q20Z74Z4 25752982 Patel, JZ; Ahenkorah, S; Vaara, M; Staszewski, M; Adams, Y; Laitinen, T; Navia-Paldanius, D; Parkkari, T; Savinainen, JR; Walczynski, K; Laitinen, JT; Nevalainen, TJ 3/24/2015 4/10/2016 University of Eastern Finland http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065641 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065641&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 118728497 313071467 CHEMBL3401456 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50301861 Clc1ccc2c(-[#6]-[#6]-c3cccnc3\[#6]-2=[#6]-2\[#6]-[#6]-[#7](-[#6]-[#6]-2)-[#6](=O)-n2nnc3ncccc23)c1 InChI=1S/C25H9ClN6O/c26-19-7-8-20-18(15-19)6-5-17-3-1-11-27-23(17)22(20)16-9-13-31(14-10-16)25(33)32-21-4-2-12-28-24(21)29-30-32/h1-4,7-8,11-12,15H SOXQQNVGNVHSND-UHFFFAOYSA-N 50065642 CHEMBL3401457 Monoglyceride lipase Homo sapiens 98 ChEMBL 10.1016/j.bmcl.2015.02.037 10.7270/Q20Z74Z4 25752982 Patel, JZ; Ahenkorah, S; Vaara, M; Staszewski, M; Adams, Y; Laitinen, T; Navia-Paldanius, D; Parkkari, T; Savinainen, JR; Walczynski, K; Laitinen, JT; Nevalainen, TJ 3/24/2015 4/10/2016 University of Eastern Finland http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065642 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065642&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 118728498 313071468 CHEMBL3401457 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50301862 FC(F)(F)[#6](-[#8]-[#6](=O)-[#7]-1-[#6]-[#6]\[#6](-[#6]-[#6]-1)=[#6]-1/c2ccc(Cl)cc2-[#6]-[#6]-c2cccnc-12)C(F)(F)F InChI=1S/C23H6ClF6N2O2/c24-16-5-6-17-15(12-16)4-3-14-2-1-9-31-19(14)18(17)13-7-10-32(11-8-13)21(33)34-20(22(25,26)27)23(28,29)30/h1-2,5-6,9,12H QXUXBMYHRLMQRY-UHFFFAOYSA-N 50065643 CHEMBL3402819 Monoglyceride lipase Homo sapiens 645 ChEMBL 10.1016/j.bmcl.2015.02.037 10.7270/Q20Z74Z4 25752982 Patel, JZ; Ahenkorah, S; Vaara, M; Staszewski, M; Adams, Y; Laitinen, T; Navia-Paldanius, D; Parkkari, T; Savinainen, JR; Walczynski, K; Laitinen, JT; Nevalainen, TJ 3/24/2015 4/10/2016 University of Eastern Finland http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065643 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065643&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 118729361 313071469 CHEMBL3402819 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50301863 Clc1ccc2c(-[#6]-[#6]-c3cccnc3\[#6]-2=[#6]-2\[#6]-[#6]-[#7](-[#6]-[#6]-2)-[#6](=O)-[#8]-[#7]-2-[#6](=O)-[#6]-[#6]-[#6]-2=O)c1 InChI=1S/C24H6ClN3O4/c25-18-5-6-19-17(14-18)4-3-16-2-1-11-26-23(16)22(19)15-9-12-27(13-10-15)24(31)32-28-20(29)7-8-21(28)30/h1-2,5-6,11,14H FOIJTBIWPMKCCD-UHFFFAOYSA-N 50065644 CHEMBL3402820 Monoglyceride lipase Homo sapiens 2570 ChEMBL 10.1016/j.bmcl.2015.02.037 10.7270/Q20Z74Z4 25752982 Patel, JZ; Ahenkorah, S; Vaara, M; Staszewski, M; Adams, Y; Laitinen, T; Navia-Paldanius, D; Parkkari, T; Savinainen, JR; Walczynski, K; Laitinen, JT; Nevalainen, TJ 3/24/2015 4/10/2016 University of Eastern Finland http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065644 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065644&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 118729362 313071470 CHEMBL3402820 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50301864 O=[#6](-[#7]-1-[#6]-[#6]\[#6](-[#6]-[#6]-1)=[#6]-1/c2ccccc2-[#6]=[#6]-c2ccccc-12)-n1cncn1 |c:17| InChI=1S/C23H10N4O/c28-23(27-16-24-15-25-27)26-13-11-19(12-14-26)22-20-7-3-1-5-17(20)9-10-18-6-2-4-8-21(18)22/h1-8,15-16H SUACLYMUEJSXBE-UHFFFAOYSA-N 50065645 CHEMBL3402827 Monoglyceride lipase Homo sapiens 47 ChEMBL 10.1016/j.bmcl.2015.02.037 10.7270/Q20Z74Z4 25752982 Patel, JZ; Ahenkorah, S; Vaara, M; Staszewski, M; Adams, Y; Laitinen, T; Navia-Paldanius, D; Parkkari, T; Savinainen, JR; Walczynski, K; Laitinen, JT; Nevalainen, TJ 3/24/2015 4/10/2016 University of Eastern Finland http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065645 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065645&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 118729369 313071471 CHEMBL3402827 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50301865 O=C(N1CCC(CC1)C(c1ccc2OCOc2c1)c1ccc2OCOc2c1)n1cncn1 InChI=1S/C23H22N4O5/c28-23(27-12-24-11-25-27)26-7-5-15(6-8-26)22(16-1-3-18-20(9-16)31-13-29-18)17-2-4-19-21(10-17)32-14-30-19/h1-4,9-12,15,22H,5-8,13-14H2 CLSNATLUIXZPMV-UHFFFAOYSA-N 50065646 CHEMBL3087181 Monoglyceride lipase Homo sapiens 0.360000 ChEMBL 10.1016/j.bmcl.2015.02.037 10.7270/Q20Z74Z4 25752982 Patel, JZ; Ahenkorah, S; Vaara, M; Staszewski, M; Adams, Y; Laitinen, T; Navia-Paldanius, D; Parkkari, T; Savinainen, JR; Walczynski, K; Laitinen, JT; Nevalainen, TJ 3/24/2015 4/10/2016 University of Eastern Finland http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065646 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065646&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 76313567 313071472 CHEMBL3087181 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50301866 Clc1ccc2c(-[#6]-[#6]-c3cccnc3\[#6]-2=[#6]-2\[#6]-[#6]-[#7](-[#6]-[#6]-2)-[#6](=O)-n2cncn2)c1 InChI=1S/C22H8ClN5O/c23-18-5-6-19-17(12-18)4-3-16-2-1-9-25-21(16)20(19)15-7-10-27(11-8-15)22(29)28-14-24-13-26-28/h1-2,5-6,9,12-14H FWPVOBLFYXTULZ-UHFFFAOYSA-N 50065640 CHEMBL3401455 Fatty-acid amide hydrolase 1 Homo sapiens 7240 ChEMBL 10.1016/j.bmcl.2015.02.037 10.7270/Q20Z74Z4 25752982 Patel, JZ; Ahenkorah, S; Vaara, M; Staszewski, M; Adams, Y; Laitinen, T; Navia-Paldanius, D; Parkkari, T; Savinainen, JR; Walczynski, K; Laitinen, JT; Nevalainen, TJ 3/24/2015 4/10/2016 University of Eastern Finland http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065640 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=354&target=Fatty-acid+amide+hydrolase+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065640&enzyme=Fatty-acid+amide+hydrolase+1&column=ki&startPg=0&Increment=50&submit=Search 102596130 313071466 CHEMBL3401455 1 MVQYELWAALPGASGVALACCFVAAAVALRWSGRRTARGAVVRARQRQRAGLENMDRAAQRFRLQNPDLDSEALLALPLPQLVQKLHSRELAPEAVLFTYVGKAWEVNKGTNCVTSYLADCETQLSQAPRQGLLYGVPVSLKECFTYKGQDSTLGLSLNEGVPAECDSVVVHVLKLQGAVPFVHTNVPQSMFSYDCSNPLFGQTVNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSSFCGICGLKPTGNRLSKSGLKGCVYGQEAVRLSVGPMARDVESLALCLRALLCEDMFRLDPTVPPLPFREEVYTSSQPLRVGYYETDNYTMPSPAMRRAVLETKQSLEAAGHTLVPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILKLPQWLKGLLAFLVKPLLPRLSAFLSNMKSRSAGKLWELQHEIEVYRKTVIAQWRALDLDVVLTPMLAPALDLNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMKKSVGLPVAVQCVALPWQEELCLRFMREVERLMTPEKQSS Fatty-acid amide hydrolase 1 FAAH1_HUMAN O00519 D3DQ19 Q52M86 Q5TDF8 50301867 O=[#6](-[#7]-1-[#6]-[#6]\[#6](-[#6]-[#6]-1)=[#6]-1/c2ccccc2-[#6]=[#6]-c2ccccc-12)-n1cncn1 |c:17| InChI=1S/C23H10N4O/c28-23(27-16-24-15-25-27)26-13-11-19(12-14-26)22-20-7-3-1-5-17(20)9-10-18-6-2-4-8-21(18)22/h1-8,15-16H SUACLYMUEJSXBE-UHFFFAOYSA-N 50065645 CHEMBL3402827 Fatty-acid amide hydrolase 1 Homo sapiens 6910 ChEMBL 10.1016/j.bmcl.2015.02.037 10.7270/Q20Z74Z4 25752982 Patel, JZ; Ahenkorah, S; Vaara, M; Staszewski, M; Adams, Y; Laitinen, T; Navia-Paldanius, D; Parkkari, T; Savinainen, JR; Walczynski, K; Laitinen, JT; Nevalainen, TJ 3/24/2015 4/10/2016 University of Eastern Finland http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065645 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=354&target=Fatty-acid+amide+hydrolase+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065645&enzyme=Fatty-acid+amide+hydrolase+1&column=ki&startPg=0&Increment=50&submit=Search 118729369 313071471 CHEMBL3402827 1 MVQYELWAALPGASGVALACCFVAAAVALRWSGRRTARGAVVRARQRQRAGLENMDRAAQRFRLQNPDLDSEALLALPLPQLVQKLHSRELAPEAVLFTYVGKAWEVNKGTNCVTSYLADCETQLSQAPRQGLLYGVPVSLKECFTYKGQDSTLGLSLNEGVPAECDSVVVHVLKLQGAVPFVHTNVPQSMFSYDCSNPLFGQTVNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSSFCGICGLKPTGNRLSKSGLKGCVYGQEAVRLSVGPMARDVESLALCLRALLCEDMFRLDPTVPPLPFREEVYTSSQPLRVGYYETDNYTMPSPAMRRAVLETKQSLEAAGHTLVPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILKLPQWLKGLLAFLVKPLLPRLSAFLSNMKSRSAGKLWELQHEIEVYRKTVIAQWRALDLDVVLTPMLAPALDLNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMKKSVGLPVAVQCVALPWQEELCLRFMREVERLMTPEKQSS Fatty-acid amide hydrolase 1 FAAH1_HUMAN O00519 D3DQ19 Q52M86 Q5TDF8 50301868 O=C(N1CCC(CC1)C(c1ccc2OCOc2c1)c1ccc2OCOc2c1)n1cncn1 InChI=1S/C23H22N4O5/c28-23(27-12-24-11-25-27)26-7-5-15(6-8-26)22(16-1-3-18-20(9-16)31-13-29-18)17-2-4-19-21(10-17)32-14-30-19/h1-4,9-12,15,22H,5-8,13-14H2 CLSNATLUIXZPMV-UHFFFAOYSA-N 50065646 CHEMBL3087181 Fatty-acid amide hydrolase 1 Homo sapiens 4800 ChEMBL 10.1016/j.bmcl.2015.02.037 10.7270/Q20Z74Z4 25752982 Patel, JZ; Ahenkorah, S; Vaara, M; Staszewski, M; Adams, Y; Laitinen, T; Navia-Paldanius, D; Parkkari, T; Savinainen, JR; Walczynski, K; Laitinen, JT; Nevalainen, TJ 3/24/2015 4/10/2016 University of Eastern Finland http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065646 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=354&target=Fatty-acid+amide+hydrolase+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065646&enzyme=Fatty-acid+amide+hydrolase+1&column=ki&startPg=0&Increment=50&submit=Search 76313567 313071472 CHEMBL3087181 1 MVQYELWAALPGASGVALACCFVAAAVALRWSGRRTARGAVVRARQRQRAGLENMDRAAQRFRLQNPDLDSEALLALPLPQLVQKLHSRELAPEAVLFTYVGKAWEVNKGTNCVTSYLADCETQLSQAPRQGLLYGVPVSLKECFTYKGQDSTLGLSLNEGVPAECDSVVVHVLKLQGAVPFVHTNVPQSMFSYDCSNPLFGQTVNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSSFCGICGLKPTGNRLSKSGLKGCVYGQEAVRLSVGPMARDVESLALCLRALLCEDMFRLDPTVPPLPFREEVYTSSQPLRVGYYETDNYTMPSPAMRRAVLETKQSLEAAGHTLVPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILKLPQWLKGLLAFLVKPLLPRLSAFLSNMKSRSAGKLWELQHEIEVYRKTVIAQWRALDLDVVLTPMLAPALDLNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMKKSVGLPVAVQCVALPWQEELCLRFMREVERLMTPEKQSS Fatty-acid amide hydrolase 1 FAAH1_HUMAN O00519 D3DQ19 Q52M86 Q5TDF8 50301869 Clc1ccc2c(-[#6]-[#6]-c3cccnc3\[#6]-2=[#6]-2\[#6]-[#6]-[#7](-[#6]-[#6]-2)-[#6](=O)-n2cncn2)c1 InChI=1S/C22H8ClN5O/c23-18-5-6-19-17(12-18)4-3-16-2-1-9-25-21(16)20(19)15-7-10-27(11-8-15)22(29)28-14-24-13-26-28/h1-2,5-6,9,12-14H FWPVOBLFYXTULZ-UHFFFAOYSA-N 50065640 CHEMBL3401455 Monoacylglycerol lipase ABHD6 Homo sapiens 1780 ChEMBL 10.1016/j.bmcl.2015.02.037 10.7270/Q20Z74Z4 25752982 Patel, JZ; Ahenkorah, S; Vaara, M; Staszewski, M; Adams, Y; Laitinen, T; Navia-Paldanius, D; Parkkari, T; Savinainen, JR; Walczynski, K; Laitinen, JT; Nevalainen, TJ 3/24/2015 4/10/2016 University of Eastern Finland http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065640 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006783&target=Monoacylglycerol+lipase+ABHD6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065640&enzyme=Monoacylglycerol+lipase+ABHD6&column=ki&startPg=0&Increment=50&submit=Search 102596130 313071466 CHEMBL3401455 1 MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD Monoacylglycerol lipase ABHD6 ABHD6_HUMAN Q9BV23 B2R7Y9 Q6ZMF7 50301870 O=[#6](-[#7]-1-[#6]-[#6]\[#6](-[#6]-[#6]-1)=[#6]-1/c2ccccc2-[#6]=[#6]-c2ccccc-12)-n1cncn1 |c:17| InChI=1S/C23H10N4O/c28-23(27-16-24-15-25-27)26-13-11-19(12-14-26)22-20-7-3-1-5-17(20)9-10-18-6-2-4-8-21(18)22/h1-8,15-16H SUACLYMUEJSXBE-UHFFFAOYSA-N 50065645 CHEMBL3402827 Monoacylglycerol lipase ABHD6 Homo sapiens 750 ChEMBL 10.1016/j.bmcl.2015.02.037 10.7270/Q20Z74Z4 25752982 Patel, JZ; Ahenkorah, S; Vaara, M; Staszewski, M; Adams, Y; Laitinen, T; Navia-Paldanius, D; Parkkari, T; Savinainen, JR; Walczynski, K; Laitinen, JT; Nevalainen, TJ 3/24/2015 4/10/2016 University of Eastern Finland http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065645 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006783&target=Monoacylglycerol+lipase+ABHD6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065645&enzyme=Monoacylglycerol+lipase+ABHD6&column=ki&startPg=0&Increment=50&submit=Search 118729369 313071471 CHEMBL3402827 1 MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD Monoacylglycerol lipase ABHD6 ABHD6_HUMAN Q9BV23 B2R7Y9 Q6ZMF7 50301871 CCCCCCCCCCC[C@@H](C[C@@H]1OC(=O)[C@H]1CCCCCC)OC(=O)[C@H](CC(C)C)NC=O |r| InChI=1S/C29H53NO5/c1-5-7-9-11-12-13-14-15-16-18-24(34-29(33)26(30-22-31)20-23(3)4)21-27-25(28(32)35-27)19-17-10-8-6-2/h22-27H,5-21H2,1-4H3,(H,30,31) AHLBNYSZXLDEJQ-UHFFFAOYSA-N 24567 Tetrahydrolipstatin::CHEMBL175247::Xenical::(2S)-1-[(2S,3S)-3-hexyl-4-oxooxetan-2-yl]tridecan-2-yl (2S)-2-formamido-4-methylpentanoate::THLP::Orlistat::US9328123, Orlistat Monoacylglycerol lipase ABHD6 Homo sapiens 48 ChEMBL 10.1016/j.bmcl.2015.02.037 10.7270/Q20Z74Z4 25752982 Patel, JZ; Ahenkorah, S; Vaara, M; Staszewski, M; Adams, Y; Laitinen, T; Navia-Paldanius, D; Parkkari, T; Savinainen, JR; Walczynski, K; Laitinen, JT; Nevalainen, TJ 3/24/2015 4/10/2016 University of Eastern Finland http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=24567 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006783&target=Monoacylglycerol+lipase+ABHD6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=24567&enzyme=Monoacylglycerol+lipase+ABHD6&column=ki&startPg=0&Increment=50&submit=Search 3034010 56269518 CHEMBL175247 DB01083 C06049 1 MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD Monoacylglycerol lipase ABHD6 ABHD6_HUMAN Q9BV23 B2R7Y9 Q6ZMF7 50301872 CCCCCCCCCCC[C@@H](C[C@@H]1OC(=O)[C@H]1CCCCCC)OC(=O)[C@H](CC(C)C)NC=O |r| InChI=1S/C29H53NO5/c1-5-7-9-11-12-13-14-15-16-18-24(34-29(33)26(30-22-31)20-23(3)4)21-27-25(28(32)35-27)19-17-10-8-6-2/h22-27H,5-21H2,1-4H3,(H,30,31) AHLBNYSZXLDEJQ-UHFFFAOYSA-N 24567 Tetrahydrolipstatin::CHEMBL175247::Xenical::(2S)-1-[(2S,3S)-3-hexyl-4-oxooxetan-2-yl]tridecan-2-yl (2S)-2-formamido-4-methylpentanoate::THLP::Orlistat::US9328123, Orlistat Lysophosphatidylserine lipase ABHD12 Homo sapiens 190 ChEMBL 10.1016/j.bmcl.2015.02.037 10.7270/Q20Z74Z4 25752982 Patel, JZ; Ahenkorah, S; Vaara, M; Staszewski, M; Adams, Y; Laitinen, T; Navia-Paldanius, D; Parkkari, T; Savinainen, JR; Walczynski, K; Laitinen, JT; Nevalainen, TJ 3/24/2015 4/10/2016 University of Eastern Finland http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=24567 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003958&target=Lysophosphatidylserine+lipase+ABHD12&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=24567&enzyme=Lysophosphatidylserine+lipase+ABHD12&column=ki&startPg=0&Increment=50&submit=Search 3034010 56269518 CHEMBL175247 DB01083 C06049 1 MRKRTEPVALEHERCAAAGSSSSGSAAAALDADCRLKQNLRLTGPAAAEPRCAADAGMKRALGRRKGVWLRLRKILFCVLGLYIAIPFLIKLCPGIQAKLIFLNFVRVPYFIDLKKPQDQGLNHTCNYYLQPEEDVTIGVWHTVPAVWWKNAQGKDQMWYEDALASSHPIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPSERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIREEAKSHPFSVIYRYFPGFDWFFLDPITSSGIKFANDENVKHISCPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQFVPFHSDLGYRHKYIYKSPELPRILREFLGKSEPEHQH Lysophosphatidylserine lipase ABHD12 ABD12_HUMAN Q8N2K0 A6NED4 A6NJ90 A8K450 B4DE71 Q5T710 Q5T711 Q96CR1 Q9BX05 Q9NPX7 Q9UFV6 50301873 CCCCC/C=C\C/C=C\C/C=C\C/C=C\CCCC[P@](=O)(OC)F InChI=1S/C21H36FO2P/c1-3-4-5-6-7-8-9-10-11-12-13-14-15-16-17-18-19-20-21-25(22,23)24-2/h7-8,10-11,13-14,16-17H,3-6,9,12,15,18-21H2,1-2H3 KWKZCGMJGHHOKJ-UHFFFAOYSA-N 50132713 Methyl arachidonoyl fluorophophonate::methyl -icosa-5,8,11,14-tetraenylphosphonofluoridate::methyl(5Z,8Z,11Z,14Z)-icosa-5,8,11,14-tetraenylphosphonofluoridate::methyl ((5Z,8Z,11Z,14Z)-2-Icosa-5,8,11,14-tetraenyl)phosphonofluoridoate::methylarachidonyl fluorophosphonate::Arachidonic acid derivative::methyl (5Z,8Z,11Z,14Z)-icosa-5,8,11,14-tetraenylphosphonofluoridate::CHEMBL113262 Monoglyceride lipase Homo sapiens 25 ChEMBL 10.1016/j.bmcl.2015.02.037 10.7270/Q20Z74Z4 25752982 Patel, JZ; Ahenkorah, S; Vaara, M; Staszewski, M; Adams, Y; Laitinen, T; Navia-Paldanius, D; Parkkari, T; Savinainen, JR; Walczynski, K; Laitinen, JT; Nevalainen, TJ 3/24/2015 4/10/2016 University of Eastern Finland http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132713 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132713&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search MAY 1MT5,4PKB,4X95,4X97,9IOP 10429254 104023689 CHEMBL113262 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50301874 CCOc1nn(-c2cccc(Oc3ccccc3)c2)c(=O)o1 InChI=1S/C16H14N2O4/c1-2-20-15-17-18(16(19)22-15)12-7-6-10-14(11-12)21-13-8-4-3-5-9-13/h3-11H,2H2,1H3 OPUUTKNZIZBSCJ-UHFFFAOYSA-N 50065639 CHEMBL3402828 Monoglyceride lipase Homo sapiens 91 ChEMBL 10.1016/j.bmcl.2015.02.037 10.7270/Q20Z74Z4 25752982 Patel, JZ; Ahenkorah, S; Vaara, M; Staszewski, M; Adams, Y; Laitinen, T; Navia-Paldanius, D; Parkkari, T; Savinainen, JR; Walczynski, K; Laitinen, JT; Nevalainen, TJ 3/24/2015 4/10/2016 University of Eastern Finland http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50065639 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50065639&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search 18184758 313071465 CHEMBL3402828 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50301875 CCCCC/C=C\C/C=C\C/C=C\C/C=C\CCCC[P@](=O)(OC)F InChI=1S/C21H36FO2P/c1-3-4-5-6-7-8-9-10-11-12-13-14-15-16-17-18-19-20-21-25(22,23)24-2/h7-8,10-11,13-14,16-17H,3-6,9,12,15,18-21H2,1-2H3 KWKZCGMJGHHOKJ-UHFFFAOYSA-N 50132713 Methyl arachidonoyl fluorophophonate::methyl -icosa-5,8,11,14-tetraenylphosphonofluoridate::methyl(5Z,8Z,11Z,14Z)-icosa-5,8,11,14-tetraenylphosphonofluoridate::methyl ((5Z,8Z,11Z,14Z)-2-Icosa-5,8,11,14-tetraenyl)phosphonofluoridoate::methylarachidonyl fluorophosphonate::Arachidonic acid derivative::methyl (5Z,8Z,11Z,14Z)-icosa-5,8,11,14-tetraenylphosphonofluoridate::CHEMBL113262 Monoglyceride lipase Homo sapiens 25 ChEMBL 10.1016/j.bmcl.2015.02.037 10.7270/Q20Z74Z4 25752982 Patel, JZ; Ahenkorah, S; Vaara, M; Staszewski, M; Adams, Y; Laitinen, T; Navia-Paldanius, D; Parkkari, T; Savinainen, JR; Walczynski, K; Laitinen, JT; Nevalainen, TJ 3/24/2015 4/10/2016 University of Eastern Finland http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132713 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132713&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search MAY 1MT5,4PKB,4X95,4X97,9IOP 10429254 104023689 CHEMBL113262 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50301876 CCCCC/C=C\C/C=C\C/C=C\C/C=C\CCCC[P@](=O)(OC)F InChI=1S/C21H36FO2P/c1-3-4-5-6-7-8-9-10-11-12-13-14-15-16-17-18-19-20-21-25(22,23)24-2/h7-8,10-11,13-14,16-17H,3-6,9,12,15,18-21H2,1-2H3 KWKZCGMJGHHOKJ-UHFFFAOYSA-N 50132713 Methyl arachidonoyl fluorophophonate::methyl -icosa-5,8,11,14-tetraenylphosphonofluoridate::methyl(5Z,8Z,11Z,14Z)-icosa-5,8,11,14-tetraenylphosphonofluoridate::methyl ((5Z,8Z,11Z,14Z)-2-Icosa-5,8,11,14-tetraenyl)phosphonofluoridoate::methylarachidonyl fluorophosphonate::Arachidonic acid derivative::methyl (5Z,8Z,11Z,14Z)-icosa-5,8,11,14-tetraenylphosphonofluoridate::CHEMBL113262 Monoglyceride lipase Homo sapiens 28 ChEMBL 10.1016/j.bmcl.2015.02.037 10.7270/Q20Z74Z4 25752982 Patel, JZ; Ahenkorah, S; Vaara, M; Staszewski, M; Adams, Y; Laitinen, T; Navia-Paldanius, D; Parkkari, T; Savinainen, JR; Walczynski, K; Laitinen, JT; Nevalainen, TJ 3/24/2015 4/10/2016 University of Eastern Finland http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132713 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132713&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search MAY 1MT5,4PKB,4X95,4X97,9IOP 10429254 104023689 CHEMBL113262 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5 50301877 CCCCC/C=C\C/C=C\C/C=C\C/C=C\CCCC[P@](=O)(OC)F InChI=1S/C21H36FO2P/c1-3-4-5-6-7-8-9-10-11-12-13-14-15-16-17-18-19-20-21-25(22,23)24-2/h7-8,10-11,13-14,16-17H,3-6,9,12,15,18-21H2,1-2H3 KWKZCGMJGHHOKJ-UHFFFAOYSA-N 50132713 Methyl arachidonoyl fluorophophonate::methyl -icosa-5,8,11,14-tetraenylphosphonofluoridate::methyl(5Z,8Z,11Z,14Z)-icosa-5,8,11,14-tetraenylphosphonofluoridate::methyl ((5Z,8Z,11Z,14Z)-2-Icosa-5,8,11,14-tetraenyl)phosphonofluoridoate::methylarachidonyl fluorophosphonate::Arachidonic acid derivative::methyl (5Z,8Z,11Z,14Z)-icosa-5,8,11,14-tetraenylphosphonofluoridate::CHEMBL113262 Monoglyceride lipase Homo sapiens 26 ChEMBL 10.1016/j.bmcl.2015.02.037 10.7270/Q20Z74Z4 25752982 Patel, JZ; Ahenkorah, S; Vaara, M; Staszewski, M; Adams, Y; Laitinen, T; Navia-Paldanius, D; Parkkari, T; Savinainen, JR; Walczynski, K; Laitinen, JT; Nevalainen, TJ 3/24/2015 4/10/2016 University of Eastern Finland http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50132713 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2965&target=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50132713&enzyme=Monoglyceride+lipase&column=ki&startPg=0&Increment=50&submit=Search MAY 1MT5,4PKB,4X95,4X97,9IOP 10429254 104023689 CHEMBL113262 1 MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP 4UUQ,3JWE,3JW8,6BQ0,6AX1 Monoglyceride lipase MGLL_HUMAN Q99685 B3KRC2 B7Z9D1 Q6IBG9 Q96AA5