BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50619731 OC(=O)C1CN(Cc2ccc(-c3nc4ncc(Cc5ccccc5)cc4s3)c(F)c2)C1 InChI=1S/C24H20FN3O2S/c25-20-9-16(12-28-13-18(14-28)24(29)30)6-7-19(20)23-27-22-21(31-23)10-17(11-26-22)8-15-4-2-1-3-5-15/h1-7,9-11,18H,8,12-14H2,(H,29,30) PEGAKMVCMGOLBB-UHFFFAOYSA-N 50335503 1-(4-(6-benzylthiazolo[4,5-b]pyridin-2-yl)-3-fluorobenzyl)azetidine-3-carboxylic acid::CHEMBL1651855 Sphingosine 1-phosphate receptor 3 Homo sapiens >25000 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335503 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2255&target=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335503&enzyme=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search 53323419 125085605 CHEMBL1651855 1 MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMVLIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFVALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLHNLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMALLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTLASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN 7EW4,7EW3,7EW2,9WP9,9L74 Sphingosine 1-phosphate receptor 3 S1PR3_HUMAN Q99500 Q5SQD8 Q7Z5I2 50619732 OC(=O)C1CN(Cc2ccc(-c3nc4cc(Cc5ccccc5)ncc4s3)c(F)c2)C1 InChI=1S/C24H20FN3O2S/c25-20-9-16(12-28-13-17(14-28)24(29)30)6-7-19(20)23-27-21-10-18(26-11-22(21)31-23)8-15-4-2-1-3-5-15/h1-7,9-11,17H,8,12-14H2,(H,29,30) WBLGHYZRPQTGFQ-UHFFFAOYSA-N 50335504 1-(4-(5-benzylthiazolo[5,4-c]pyridin-2-yl)-3-fluorobenzyl)azetidine-3-carboxylic acid::CHEMBL1651852 Sphingosine 1-phosphate receptor 3 Homo sapiens >25000 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335504 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2255&target=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335504&enzyme=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search 53326036 125085606 CHEMBL1651852 1 MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMVLIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFVALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLHNLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMALLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTLASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN 7EW4,7EW3,7EW2,9WP9,9L74 Sphingosine 1-phosphate receptor 3 S1PR3_HUMAN Q99500 Q5SQD8 Q7Z5I2 50619733 OC(=O)C1CN(Cc2ccc(-c3nc4nc(Cc5ccccc5)ccc4s3)c(F)c2)C1 InChI=1S/C24H20FN3O2S/c25-20-11-16(12-28-13-17(14-28)24(29)30)6-8-19(20)23-27-22-21(31-23)9-7-18(26-22)10-15-4-2-1-3-5-15/h1-9,11,17H,10,12-14H2,(H,29,30) WCLORTHIBMHSSY-UHFFFAOYSA-N 50335505 1-((4-(5-benzylthiazolo[4,5-b]pyridin-2-yl)-3-fluorophenyl)methyl)azetidine-3-carboxylic acid::CHEMBL1651851 Sphingosine 1-phosphate receptor 3 Homo sapiens 10100 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335505 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2255&target=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335505&enzyme=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search 53319457 125085607 CHEMBL1651851 1 MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMVLIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFVALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLHNLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMALLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTLASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN 7EW4,7EW3,7EW2,9WP9,9L74 Sphingosine 1-phosphate receptor 3 S1PR3_HUMAN Q99500 Q5SQD8 Q7Z5I2 50619734 OC(=O)C1CN(Cc2ccc(-c3nc4cnc(Cc5ccccc5)cc4s3)c(F)c2)C1 InChI=1S/C24H20FN3O2S/c25-20-9-16(12-28-13-17(14-28)24(29)30)6-7-19(20)23-27-21-11-26-18(10-22(21)31-23)8-15-4-2-1-3-5-15/h1-7,9-11,17H,8,12-14H2,(H,29,30) SZUKHKIGVWYCCX-UHFFFAOYSA-N 50335506 1-(4-(6-benzylthiazolo[4,5-c]pyridin-2-yl)-3-fluorobenzyl)azetidine-3-carboxylic acid::CHEMBL1651856 Sphingosine 1-phosphate receptor 3 Homo sapiens 5460 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335506 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2255&target=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335506&enzyme=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search 53326037 125085608 CHEMBL1651856 1 MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMVLIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFVALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLHNLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMALLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTLASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN 7EW4,7EW3,7EW2,9WP9,9L74 Sphingosine 1-phosphate receptor 3 S1PR3_HUMAN Q99500 Q5SQD8 Q7Z5I2 50619735 OC(=O)C1CN(Cc2ccc(-c3nc4ccc(cc4s3)C3(CC3)c3ccccc3)c(F)c2)C1 InChI=1S/C27H23FN2O2S/c28-22-12-17(14-30-15-18(16-30)26(31)32)6-8-21(22)25-29-23-9-7-20(13-24(23)33-25)27(10-11-27)19-4-2-1-3-5-19/h1-9,12-13,18H,10-11,14-16H2,(H,31,32) RWWBUTGMPHDFGX-UHFFFAOYSA-N 50335507 1-((3-fluoro-4-(6-(1-phenylcyclopropyl)benzo[d]thiazol-2-yl)phenyl)methyl)azetidine-3-carboxylic acid::CHEMBL1651865 Sphingosine 1-phosphate receptor 3 Homo sapiens 4670 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335507 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2255&target=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335507&enzyme=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search 44600645 125085609 CHEMBL1651865 1 MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMVLIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFVALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLHNLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMALLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTLASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN 7EW4,7EW3,7EW2,9WP9,9L74 Sphingosine 1-phosphate receptor 3 S1PR3_HUMAN Q99500 Q5SQD8 Q7Z5I2 50619736 OC(=O)C1CN(Cc2ccc(-c3nc4ccc(Cc5ccccc5)cc4s3)c(F)c2)C1 InChI=1S/C25H21FN2O2S/c26-21-11-18(13-28-14-19(15-28)25(29)30)6-8-20(21)24-27-22-9-7-17(12-23(22)31-24)10-16-4-2-1-3-5-16/h1-9,11-12,19H,10,13-15H2,(H,29,30) YHUJYSUWHIWQKN-UHFFFAOYSA-N 50335508 1-(4-(6-benzylbenzo[d]thiazol-2-yl)-3-fluorobenzyl)azetidine-3-carboxylic acid::CHEMBL1651854 Sphingosine 1-phosphate receptor 3 Homo sapiens 3470 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335508 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2255&target=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335508&enzyme=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search 53324746 125085610 CHEMBL1651854 1 MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMVLIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFVALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLHNLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMALLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTLASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN 7EW4,7EW3,7EW2,9WP9,9L74 Sphingosine 1-phosphate receptor 3 S1PR3_HUMAN Q99500 Q5SQD8 Q7Z5I2 50619737 OC(=O)C1CN(Cc2ccc(-c3nc4cc(Cc5ccccc5)cnc4s3)c(F)c2)C1 InChI=1S/C24H20FN3O2S/c25-20-9-16(12-28-13-18(14-28)24(29)30)6-7-19(20)22-27-21-10-17(11-26-23(21)31-22)8-15-4-2-1-3-5-15/h1-7,9-11,18H,8,12-14H2,(H,29,30) QMNUVBHTCZWIBM-UHFFFAOYSA-N 50335509 1-((4-(6-benzylthiazolo[5,4-b]pyridin-2-yl)-3-fluorophenyl)methyl)azetidine-3-carboxylic acid::CHEMBL1651853 Sphingosine 1-phosphate receptor 3 Homo sapiens 2890 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335509 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2255&target=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335509&enzyme=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search 53318125 125085611 CHEMBL1651853 1 MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMVLIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFVALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLHNLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMALLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTLASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN 7EW4,7EW3,7EW2,9WP9,9L74 Sphingosine 1-phosphate receptor 3 S1PR3_HUMAN Q99500 Q5SQD8 Q7Z5I2 50619738 CC(C)(c1ccccc1)c1ccc2nc(sc2n1)-c1ccc(CN2CC(C2)C(O)=O)cc1F InChI=1S/C26H24FN3O2S/c1-26(2,18-6-4-3-5-7-18)22-11-10-21-24(29-22)33-23(28-21)19-9-8-16(12-20(19)27)13-30-14-17(15-30)25(31)32/h3-12,17H,13-15H2,1-2H3,(H,31,32) QUWSDCUDDZSZRI-UHFFFAOYSA-N 50335510 1-(3-fluoro-4-(5-(2-phenylpropan-2-yl)thiazolo[5,4-b]pyridin-2-yl)benzyl)azetidine-3-carboxylic acid::CHEMBL1651860 Sphingosine 1-phosphate receptor 3 Homo sapiens 2510 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335510 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2255&target=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335510&enzyme=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search 53323421 125085612 CHEMBL1651860 1 MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMVLIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFVALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLHNLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMALLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTLASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN 7EW4,7EW3,7EW2,9WP9,9L74 Sphingosine 1-phosphate receptor 3 S1PR3_HUMAN Q99500 Q5SQD8 Q7Z5I2 50619739 OC(=O)C1CN(Cc2ccc(-c3nc4ccc(nc4s3)C3(CCC3)c3ccccc3)c(F)c2)C1 InChI=1S/C27H24FN3O2S/c28-21-13-17(14-31-15-18(16-31)26(32)33)7-8-20(21)24-29-22-9-10-23(30-25(22)34-24)27(11-4-12-27)19-5-2-1-3-6-19/h1-3,5-10,13,18H,4,11-12,14-16H2,(H,32,33) KVSCIJUANFKDHN-UHFFFAOYSA-N 50335511 1-(3-fluoro-4-(5-(1-phenylcyclobutyl)thiazolo[5,4-b]pyridin-2-yl)benzyl)azetidine-3-carboxylic acid::CHEMBL1651862 Sphingosine 1-phosphate receptor 3 Homo sapiens 1310 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335511 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2255&target=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335511&enzyme=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search 44599024 125085613 CHEMBL1651862 1 MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMVLIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFVALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLHNLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMALLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTLASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN 7EW4,7EW3,7EW2,9WP9,9L74 Sphingosine 1-phosphate receptor 3 S1PR3_HUMAN Q99500 Q5SQD8 Q7Z5I2 50619740 OC(=O)C1CN(Cc2ccc(-c3nc4cc(Cc5ccccc5)ccc4s3)c(F)c2)C1 InChI=1S/C25H21FN2O2S/c26-21-11-18(13-28-14-19(15-28)25(29)30)6-8-20(21)24-27-22-12-17(7-9-23(22)31-24)10-16-4-2-1-3-5-16/h1-9,11-12,19H,10,13-15H2,(H,29,30) PVVUFYZWSRTSJA-UHFFFAOYSA-N 50335512 1-(4-(5-benzylbenzo[d]thiazol-2-yl)-3-fluorobenzyl)azetidine-3-carboxylic acid::CHEMBL1651850 Sphingosine 1-phosphate receptor 3 Homo sapiens 1210 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335512 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2255&target=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335512&enzyme=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search 53318124 125085614 CHEMBL1651850 1 MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMVLIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFVALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLHNLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMALLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTLASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN 7EW4,7EW3,7EW2,9WP9,9L74 Sphingosine 1-phosphate receptor 3 S1PR3_HUMAN Q99500 Q5SQD8 Q7Z5I2 50619741 C[C@H](c1ccccc1)c1ccc2nc(sc2n1)-c1ccc(CN2CC(C2)C(O)=O)cc1F |r| InChI=1S/C25H22FN3O2S/c1-15(17-5-3-2-4-6-17)21-9-10-22-24(27-21)32-23(28-22)19-8-7-16(11-20(19)26)12-29-13-18(14-29)25(30)31/h2-11,15,18H,12-14H2,1H3,(H,30,31) CXOPPLGMWBBMQK-UHFFFAOYSA-N 50335513 1-((3-fluoro-4-(5-((R)-1-phenylethyl)thiazolo[5,4-b]pyridin-2-yl)phenyl)methyl)azetidine-3-carboxylic acid::CHEMBL1651859 Sphingosine 1-phosphate receptor 3 Homo sapiens 996 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335513 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2255&target=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335513&enzyme=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search 53323420 125085615 CHEMBL1651859 1 MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMVLIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFVALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLHNLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMALLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTLASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN 7EW4,7EW3,7EW2,9WP9,9L74 Sphingosine 1-phosphate receptor 3 S1PR3_HUMAN Q99500 Q5SQD8 Q7Z5I2 50619742 OC(=O)C1CN(Cc2ccc(-c3nc4ccc(nc4s3)C3(CC3)c3ccccc3)c(F)c2)C1 InChI=1S/C26H22FN3O2S/c27-20-12-16(13-30-14-17(15-30)25(31)32)6-7-19(20)23-28-21-8-9-22(29-24(21)33-23)26(10-11-26)18-4-2-1-3-5-18/h1-9,12,17H,10-11,13-15H2,(H,31,32) KCMALGDZUKTGJR-UHFFFAOYSA-N 50335514 1-((3-fluoro-4-(5-(1-phenylcyclopropyl)thiazolo[5,4-b]pyridin-2-yl)phenyl)methyl)azetidine-3-carboxylic acid::CHEMBL1651861 Sphingosine 1-phosphate receptor 3 Homo sapiens 888 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335514 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2255&target=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335514&enzyme=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search 44600476 125085616 CHEMBL1651861 1 MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMVLIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFVALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLHNLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMALLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTLASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN 7EW4,7EW3,7EW2,9WP9,9L74 Sphingosine 1-phosphate receptor 3 S1PR3_HUMAN Q99500 Q5SQD8 Q7Z5I2 50619743 C[C@@H](c1ccccc1)c1ccc2nc(sc2n1)-c1ccc(CN2CC(C2)C(O)=O)cc1F |r| InChI=1S/C25H22FN3O2S/c1-15(17-5-3-2-4-6-17)21-9-10-22-24(27-21)32-23(28-22)19-8-7-16(11-20(19)26)12-29-13-18(14-29)25(30)31/h2-11,15,18H,12-14H2,1H3,(H,30,31) CXOPPLGMWBBMQK-UHFFFAOYSA-N 50335515 1-((3-fluoro-4-(5-((S)-1-phenylethyl)thiazolo[5,4-b]pyridin-2-yl)phenyl)methyl)azetidine-3-carboxylic acid::CHEMBL1651858 Sphingosine 1-phosphate receptor 3 Homo sapiens 877 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335515 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2255&target=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335515&enzyme=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search 53319458 125085617 CHEMBL1651858 1 MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMVLIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFVALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLHNLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMALLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTLASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN 7EW4,7EW3,7EW2,9WP9,9L74 Sphingosine 1-phosphate receptor 3 S1PR3_HUMAN Q99500 Q5SQD8 Q7Z5I2 50619744 OC(=O)C1CN(Cc2ccc(-c3nc4ccc(nc4s3)C3(CCCCC3)c3ccccc3)c(F)c2)C1 InChI=1S/C29H28FN3O2S/c30-23-15-19(16-33-17-20(18-33)28(34)35)9-10-22(23)26-31-24-11-12-25(32-27(24)36-26)29(13-5-2-6-14-29)21-7-3-1-4-8-21/h1,3-4,7-12,15,20H,2,5-6,13-14,16-18H2,(H,34,35) OIQUGXZGFRNXRR-UHFFFAOYSA-N 50335516 1-((3-fluoro-4-(5-(1-phenylcyclohexyl)thiazolo[5,4-b]pyridin-2-yl)phenyl)methyl)azetidine-3-carboxylic acid::CHEMBL1651864 Sphingosine 1-phosphate receptor 3 Homo sapiens 836 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335516 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2255&target=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335516&enzyme=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search 44600643 125085618 CHEMBL1651864 1 MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMVLIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFVALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLHNLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMALLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTLASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN 7EW4,7EW3,7EW2,9WP9,9L74 Sphingosine 1-phosphate receptor 3 S1PR3_HUMAN Q99500 Q5SQD8 Q7Z5I2 50619745 OC(=O)C1CN(Cc2ccc(-c3nc4ccc(Cc5ccccc5)nc4s3)c(F)c2)C1 InChI=1S/C24H20FN3O2S/c25-20-11-16(12-28-13-17(14-28)24(29)30)6-8-19(20)22-27-21-9-7-18(26-23(21)31-22)10-15-4-2-1-3-5-15/h1-9,11,17H,10,12-14H2,(H,29,30) PXKJTYMRFSNITB-UHFFFAOYSA-N 50335517 1-(4-(5-benzylthiazolo[5,4-b]pyridin-2-yl)-3-fluorobenzyl)azetidine-3-carboxylic acid::CHEMBL1651857 Sphingosine 1-phosphate receptor 3 Homo sapiens 478 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335517 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2255&target=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335517&enzyme=Sphingosine+1-phosphate+receptor+3&column=ki&startPg=0&Increment=50&submit=Search 53322061 125085619 CHEMBL1651857 1 MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMVLIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFVALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLHNLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMALLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTLASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN 7EW4,7EW3,7EW2,9WP9,9L74 Sphingosine 1-phosphate receptor 3 S1PR3_HUMAN Q99500 Q5SQD8 Q7Z5I2 50619746 OC(=O)C1CN(Cc2ccc(-c3nc4cnc(Cc5ccccc5)cc4s3)c(F)c2)C1 InChI=1S/C24H20FN3O2S/c25-20-9-16(12-28-13-17(14-28)24(29)30)6-7-19(20)23-27-21-11-26-18(10-22(21)31-23)8-15-4-2-1-3-5-15/h1-7,9-11,17H,8,12-14H2,(H,29,30) SZUKHKIGVWYCCX-UHFFFAOYSA-N 50335506 1-(4-(6-benzylthiazolo[4,5-c]pyridin-2-yl)-3-fluorobenzyl)azetidine-3-carboxylic acid::CHEMBL1651856 Sphingosine 1-phosphate receptor 1 Homo sapiens 3980 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335506 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5970&target=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335506&enzyme=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 53326037 125085608 CHEMBL1651856 1 MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS 9VO1,9VO0,9VNZ,9VNY,7VIH,7VIG,7VIF,7VIE,7TD4,7TD3,8G94,8YIC,7EW7,7EW0,7EVZ,7EVY Sphingosine 1-phosphate receptor 1 S1PR1_HUMAN P21453 D3DT66 Q9BYY4 Q9NYN8 50619747 OC(=O)C1CN(Cc2ccc(-c3nc4ncc(Cc5ccccc5)cc4s3)c(F)c2)C1 InChI=1S/C24H20FN3O2S/c25-20-9-16(12-28-13-18(14-28)24(29)30)6-7-19(20)23-27-22-21(31-23)10-17(11-26-22)8-15-4-2-1-3-5-15/h1-7,9-11,18H,8,12-14H2,(H,29,30) PEGAKMVCMGOLBB-UHFFFAOYSA-N 50335503 1-(4-(6-benzylthiazolo[4,5-b]pyridin-2-yl)-3-fluorobenzyl)azetidine-3-carboxylic acid::CHEMBL1651855 Sphingosine 1-phosphate receptor 1 Homo sapiens 1600 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335503 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5970&target=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335503&enzyme=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 53323419 125085605 CHEMBL1651855 1 MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS 9VO1,9VO0,9VNZ,9VNY,7VIH,7VIG,7VIF,7VIE,7TD4,7TD3,8G94,8YIC,7EW7,7EW0,7EVZ,7EVY Sphingosine 1-phosphate receptor 1 S1PR1_HUMAN P21453 D3DT66 Q9BYY4 Q9NYN8 50619748 OC(=O)C1CN(Cc2ccc(-c3nc4cc(Cc5ccccc5)ncc4s3)c(F)c2)C1 InChI=1S/C24H20FN3O2S/c25-20-9-16(12-28-13-17(14-28)24(29)30)6-7-19(20)23-27-21-10-18(26-11-22(21)31-23)8-15-4-2-1-3-5-15/h1-7,9-11,17H,8,12-14H2,(H,29,30) WBLGHYZRPQTGFQ-UHFFFAOYSA-N 50335504 1-(4-(5-benzylthiazolo[5,4-c]pyridin-2-yl)-3-fluorobenzyl)azetidine-3-carboxylic acid::CHEMBL1651852 Sphingosine 1-phosphate receptor 1 Homo sapiens 429 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335504 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5970&target=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335504&enzyme=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 53326036 125085606 CHEMBL1651852 1 MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS 9VO1,9VO0,9VNZ,9VNY,7VIH,7VIG,7VIF,7VIE,7TD4,7TD3,8G94,8YIC,7EW7,7EW0,7EVZ,7EVY Sphingosine 1-phosphate receptor 1 S1PR1_HUMAN P21453 D3DT66 Q9BYY4 Q9NYN8 50619749 OC(=O)C1CN(Cc2ccc(-c3nc4ccc(Cc5ccccc5)cc4s3)c(F)c2)C1 InChI=1S/C25H21FN2O2S/c26-21-11-18(13-28-14-19(15-28)25(29)30)6-8-20(21)24-27-22-9-7-17(12-23(22)31-24)10-16-4-2-1-3-5-16/h1-9,11-12,19H,10,13-15H2,(H,29,30) YHUJYSUWHIWQKN-UHFFFAOYSA-N 50335508 1-(4-(6-benzylbenzo[d]thiazol-2-yl)-3-fluorobenzyl)azetidine-3-carboxylic acid::CHEMBL1651854 Sphingosine 1-phosphate receptor 1 Homo sapiens 221 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335508 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5970&target=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335508&enzyme=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 53324746 125085610 CHEMBL1651854 1 MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS 9VO1,9VO0,9VNZ,9VNY,7VIH,7VIG,7VIF,7VIE,7TD4,7TD3,8G94,8YIC,7EW7,7EW0,7EVZ,7EVY Sphingosine 1-phosphate receptor 1 S1PR1_HUMAN P21453 D3DT66 Q9BYY4 Q9NYN8 50619750 OC(=O)C1CN(Cc2ccc(-c3nc4ccc(Cc5ccccc5)nc4s3)c(F)c2)C1 InChI=1S/C24H20FN3O2S/c25-20-11-16(12-28-13-17(14-28)24(29)30)6-8-19(20)22-27-21-9-7-18(26-23(21)31-22)10-15-4-2-1-3-5-15/h1-9,11,17H,10,12-14H2,(H,29,30) PXKJTYMRFSNITB-UHFFFAOYSA-N 50335517 1-(4-(5-benzylthiazolo[5,4-b]pyridin-2-yl)-3-fluorobenzyl)azetidine-3-carboxylic acid::CHEMBL1651857 Sphingosine 1-phosphate receptor 1 Homo sapiens 199 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335517 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5970&target=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335517&enzyme=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 53322061 125085619 CHEMBL1651857 1 MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS 9VO1,9VO0,9VNZ,9VNY,7VIH,7VIG,7VIF,7VIE,7TD4,7TD3,8G94,8YIC,7EW7,7EW0,7EVZ,7EVY Sphingosine 1-phosphate receptor 1 S1PR1_HUMAN P21453 D3DT66 Q9BYY4 Q9NYN8 50619751 OC(=O)C1CN(Cc2ccc(-c3nc4nc(Cc5ccccc5)ccc4s3)c(F)c2)C1 InChI=1S/C24H20FN3O2S/c25-20-11-16(12-28-13-17(14-28)24(29)30)6-8-19(20)23-27-22-21(31-23)9-7-18(26-22)10-15-4-2-1-3-5-15/h1-9,11,17H,10,12-14H2,(H,29,30) WCLORTHIBMHSSY-UHFFFAOYSA-N 50335505 1-((4-(5-benzylthiazolo[4,5-b]pyridin-2-yl)-3-fluorophenyl)methyl)azetidine-3-carboxylic acid::CHEMBL1651851 Sphingosine 1-phosphate receptor 1 Homo sapiens 144 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335505 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5970&target=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335505&enzyme=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 53319457 125085607 CHEMBL1651851 1 MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS 9VO1,9VO0,9VNZ,9VNY,7VIH,7VIG,7VIF,7VIE,7TD4,7TD3,8G94,8YIC,7EW7,7EW0,7EVZ,7EVY Sphingosine 1-phosphate receptor 1 S1PR1_HUMAN P21453 D3DT66 Q9BYY4 Q9NYN8 50619752 OC(=O)C1CN(Cc2ccc(-c3nc4cc(Cc5ccccc5)cnc4s3)c(F)c2)C1 InChI=1S/C24H20FN3O2S/c25-20-9-16(12-28-13-18(14-28)24(29)30)6-7-19(20)22-27-21-10-17(11-26-23(21)31-22)8-15-4-2-1-3-5-15/h1-7,9-11,18H,8,12-14H2,(H,29,30) QMNUVBHTCZWIBM-UHFFFAOYSA-N 50335509 1-((4-(6-benzylthiazolo[5,4-b]pyridin-2-yl)-3-fluorophenyl)methyl)azetidine-3-carboxylic acid::CHEMBL1651853 Sphingosine 1-phosphate receptor 1 Homo sapiens 138 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335509 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5970&target=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335509&enzyme=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 53318125 125085611 CHEMBL1651853 1 MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS 9VO1,9VO0,9VNZ,9VNY,7VIH,7VIG,7VIF,7VIE,7TD4,7TD3,8G94,8YIC,7EW7,7EW0,7EVZ,7EVY Sphingosine 1-phosphate receptor 1 S1PR1_HUMAN P21453 D3DT66 Q9BYY4 Q9NYN8 50619753 OC(=O)C1CN(Cc2ccc(-c3nc4ccc(nc4s3)C3(CCC3)c3ccccc3)c(F)c2)C1 InChI=1S/C27H24FN3O2S/c28-21-13-17(14-31-15-18(16-31)26(32)33)7-8-20(21)24-29-22-9-10-23(30-25(22)34-24)27(11-4-12-27)19-5-2-1-3-6-19/h1-3,5-10,13,18H,4,11-12,14-16H2,(H,32,33) KVSCIJUANFKDHN-UHFFFAOYSA-N 50335511 1-(3-fluoro-4-(5-(1-phenylcyclobutyl)thiazolo[5,4-b]pyridin-2-yl)benzyl)azetidine-3-carboxylic acid::CHEMBL1651862 Sphingosine 1-phosphate receptor 1 Homo sapiens 119 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335511 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5970&target=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335511&enzyme=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44599024 125085613 CHEMBL1651862 1 MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS 9VO1,9VO0,9VNZ,9VNY,7VIH,7VIG,7VIF,7VIE,7TD4,7TD3,8G94,8YIC,7EW7,7EW0,7EVZ,7EVY Sphingosine 1-phosphate receptor 1 S1PR1_HUMAN P21453 D3DT66 Q9BYY4 Q9NYN8 50619754 OC(=O)C1CN(Cc2ccc(-c3nc4cc(Cc5ccccc5)ccc4s3)c(F)c2)C1 InChI=1S/C25H21FN2O2S/c26-21-11-18(13-28-14-19(15-28)25(29)30)6-8-20(21)24-27-22-12-17(7-9-23(22)31-24)10-16-4-2-1-3-5-16/h1-9,11-12,19H,10,13-15H2,(H,29,30) PVVUFYZWSRTSJA-UHFFFAOYSA-N 50335512 1-(4-(5-benzylbenzo[d]thiazol-2-yl)-3-fluorobenzyl)azetidine-3-carboxylic acid::CHEMBL1651850 Sphingosine 1-phosphate receptor 1 Homo sapiens 41 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335512 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5970&target=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335512&enzyme=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 53318124 125085614 CHEMBL1651850 1 MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS 9VO1,9VO0,9VNZ,9VNY,7VIH,7VIG,7VIF,7VIE,7TD4,7TD3,8G94,8YIC,7EW7,7EW0,7EVZ,7EVY Sphingosine 1-phosphate receptor 1 S1PR1_HUMAN P21453 D3DT66 Q9BYY4 Q9NYN8 50619755 OC(=O)C1CN(Cc2ccc(-c3nc4ccc(cc4s3)C3(CC3)c3ccccc3)c(F)c2)C1 InChI=1S/C27H23FN2O2S/c28-22-12-17(14-30-15-18(16-30)26(31)32)6-8-21(22)25-29-23-9-7-20(13-24(23)33-25)27(10-11-27)19-4-2-1-3-5-19/h1-9,12-13,18H,10-11,14-16H2,(H,31,32) RWWBUTGMPHDFGX-UHFFFAOYSA-N 50335507 1-((3-fluoro-4-(6-(1-phenylcyclopropyl)benzo[d]thiazol-2-yl)phenyl)methyl)azetidine-3-carboxylic acid::CHEMBL1651865 Sphingosine 1-phosphate receptor 1 Homo sapiens 38 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335507 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5970&target=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335507&enzyme=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44600645 125085609 CHEMBL1651865 1 MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS 9VO1,9VO0,9VNZ,9VNY,7VIH,7VIG,7VIF,7VIE,7TD4,7TD3,8G94,8YIC,7EW7,7EW0,7EVZ,7EVY Sphingosine 1-phosphate receptor 1 S1PR1_HUMAN P21453 D3DT66 Q9BYY4 Q9NYN8 50619756 C[C@H](c1ccccc1)c1ccc2nc(sc2n1)-c1ccc(CN2CC(C2)C(O)=O)cc1F |r| InChI=1S/C25H22FN3O2S/c1-15(17-5-3-2-4-6-17)21-9-10-22-24(27-21)32-23(28-22)19-8-7-16(11-20(19)26)12-29-13-18(14-29)25(30)31/h2-11,15,18H,12-14H2,1H3,(H,30,31) CXOPPLGMWBBMQK-UHFFFAOYSA-N 50335513 1-((3-fluoro-4-(5-((R)-1-phenylethyl)thiazolo[5,4-b]pyridin-2-yl)phenyl)methyl)azetidine-3-carboxylic acid::CHEMBL1651859 Sphingosine 1-phosphate receptor 1 Homo sapiens 38 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335513 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5970&target=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335513&enzyme=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 53323420 125085615 CHEMBL1651859 1 MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS 9VO1,9VO0,9VNZ,9VNY,7VIH,7VIG,7VIF,7VIE,7TD4,7TD3,8G94,8YIC,7EW7,7EW0,7EVZ,7EVY Sphingosine 1-phosphate receptor 1 S1PR1_HUMAN P21453 D3DT66 Q9BYY4 Q9NYN8 50619757 C[C@@H](c1ccccc1)c1ccc2nc(sc2n1)-c1ccc(CN2CC(C2)C(O)=O)cc1F |r| InChI=1S/C25H22FN3O2S/c1-15(17-5-3-2-4-6-17)21-9-10-22-24(27-21)32-23(28-22)19-8-7-16(11-20(19)26)12-29-13-18(14-29)25(30)31/h2-11,15,18H,12-14H2,1H3,(H,30,31) CXOPPLGMWBBMQK-UHFFFAOYSA-N 50335515 1-((3-fluoro-4-(5-((S)-1-phenylethyl)thiazolo[5,4-b]pyridin-2-yl)phenyl)methyl)azetidine-3-carboxylic acid::CHEMBL1651858 Sphingosine 1-phosphate receptor 1 Homo sapiens 35 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335515 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5970&target=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335515&enzyme=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 53319458 125085617 CHEMBL1651858 1 MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS 9VO1,9VO0,9VNZ,9VNY,7VIH,7VIG,7VIF,7VIE,7TD4,7TD3,8G94,8YIC,7EW7,7EW0,7EVZ,7EVY Sphingosine 1-phosphate receptor 1 S1PR1_HUMAN P21453 D3DT66 Q9BYY4 Q9NYN8 50619758 OC(=O)C1CN(Cc2ccc(-c3nc4ccc(nc4s3)C3(CCCCC3)c3ccccc3)c(F)c2)C1 InChI=1S/C29H28FN3O2S/c30-23-15-19(16-33-17-20(18-33)28(34)35)9-10-22(23)26-31-24-11-12-25(32-27(24)36-26)29(13-5-2-6-14-29)21-7-3-1-4-8-21/h1,3-4,7-12,15,20H,2,5-6,13-14,16-18H2,(H,34,35) OIQUGXZGFRNXRR-UHFFFAOYSA-N 50335516 1-((3-fluoro-4-(5-(1-phenylcyclohexyl)thiazolo[5,4-b]pyridin-2-yl)phenyl)methyl)azetidine-3-carboxylic acid::CHEMBL1651864 Sphingosine 1-phosphate receptor 1 Homo sapiens 33 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335516 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5970&target=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335516&enzyme=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44600643 125085618 CHEMBL1651864 1 MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS 9VO1,9VO0,9VNZ,9VNY,7VIH,7VIG,7VIF,7VIE,7TD4,7TD3,8G94,8YIC,7EW7,7EW0,7EVZ,7EVY Sphingosine 1-phosphate receptor 1 S1PR1_HUMAN P21453 D3DT66 Q9BYY4 Q9NYN8 50619759 CC(C)(c1ccccc1)c1ccc2nc(sc2n1)-c1ccc(CN2CC(C2)C(O)=O)cc1F InChI=1S/C26H24FN3O2S/c1-26(2,18-6-4-3-5-7-18)22-11-10-21-24(29-22)33-23(28-21)19-9-8-16(12-20(19)27)13-30-14-17(15-30)25(31)32/h3-12,17H,13-15H2,1-2H3,(H,31,32) QUWSDCUDDZSZRI-UHFFFAOYSA-N 50335510 1-(3-fluoro-4-(5-(2-phenylpropan-2-yl)thiazolo[5,4-b]pyridin-2-yl)benzyl)azetidine-3-carboxylic acid::CHEMBL1651860 Sphingosine 1-phosphate receptor 1 Homo sapiens 33 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335510 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5970&target=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335510&enzyme=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 53323421 125085612 CHEMBL1651860 1 MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS 9VO1,9VO0,9VNZ,9VNY,7VIH,7VIG,7VIF,7VIE,7TD4,7TD3,8G94,8YIC,7EW7,7EW0,7EVZ,7EVY Sphingosine 1-phosphate receptor 1 S1PR1_HUMAN P21453 D3DT66 Q9BYY4 Q9NYN8 50619760 OC(=O)C1CN(Cc2ccc(-c3nc4ccc(nc4s3)C3(CCCC3)c3ccccc3)c(F)c2)C1 InChI=1S/C28H26FN3O2S/c29-22-14-18(15-32-16-19(17-32)27(33)34)8-9-21(22)25-30-23-10-11-24(31-26(23)35-25)28(12-4-5-13-28)20-6-2-1-3-7-20/h1-3,6-11,14,19H,4-5,12-13,15-17H2,(H,33,34) XOISWOAQHPFMSU-UHFFFAOYSA-N 50335518 1-((3-fluoro-4-(5-(1-phenylcyclopentyl)thiazolo[5,4-b]pyridin-2-yl)phenyl)methyl)azetidine-3-carboxylic acid::CHEMBL1651863 Sphingosine 1-phosphate receptor 1 Homo sapiens 26 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335518 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5970&target=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335518&enzyme=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44600642 125085620 CHEMBL1651863 1 MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS 9VO1,9VO0,9VNZ,9VNY,7VIH,7VIG,7VIF,7VIE,7TD4,7TD3,8G94,8YIC,7EW7,7EW0,7EVZ,7EVY Sphingosine 1-phosphate receptor 1 S1PR1_HUMAN P21453 D3DT66 Q9BYY4 Q9NYN8 50619761 OC(=O)C1CN(Cc2ccc(-c3nc4ccc(nc4s3)C3(CC3)c3ccccc3)c(F)c2)C1 InChI=1S/C26H22FN3O2S/c27-20-12-16(13-30-14-17(15-30)25(31)32)6-7-19(20)23-28-21-8-9-22(29-24(21)33-23)26(10-11-26)18-4-2-1-3-5-18/h1-9,12,17H,10-11,13-15H2,(H,31,32) KCMALGDZUKTGJR-UHFFFAOYSA-N 50335514 1-((3-fluoro-4-(5-(1-phenylcyclopropyl)thiazolo[5,4-b]pyridin-2-yl)phenyl)methyl)azetidine-3-carboxylic acid::CHEMBL1651861 Sphingosine 1-phosphate receptor 1 Homo sapiens 2 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335514 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5970&target=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335514&enzyme=Sphingosine+1-phosphate+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44600476 125085616 CHEMBL1651861 1 MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS 9VO1,9VO0,9VNZ,9VNY,7VIH,7VIG,7VIF,7VIE,7TD4,7TD3,8G94,8YIC,7EW7,7EW0,7EVZ,7EVY Sphingosine 1-phosphate receptor 1 S1PR1_HUMAN P21453 D3DT66 Q9BYY4 Q9NYN8 50619762 OC(=O)C1CN(Cc2ccc(-c3nc4ccc(nc4s3)C3(CC3)c3ccccc3)c(F)c2)C1 InChI=1S/C26H22FN3O2S/c27-20-12-16(13-30-14-17(15-30)25(31)32)6-7-19(20)23-28-21-8-9-22(29-24(21)33-23)26(10-11-26)18-4-2-1-3-5-18/h1-9,12,17H,10-11,13-15H2,(H,31,32) KCMALGDZUKTGJR-UHFFFAOYSA-N 50335514 1-((3-fluoro-4-(5-(1-phenylcyclopropyl)thiazolo[5,4-b]pyridin-2-yl)phenyl)methyl)azetidine-3-carboxylic acid::CHEMBL1651861 Sphingosine 1-phosphate receptor 5 Homo sapiens 29 ChEMBL 10.1021/ml100306h 10.7270/Q2H995G4 24900288 Cee, VJ; Frohn, M; Lanman, BA; Golden, J; Muller, K; Neira, S; Pickrell, A; Arnett, H; Buys, J; Gore, A; Fiorino, M; Horner, M; Itano, A; Lee, MR; McElvain, M; Middleton, S; Schrag, M; Rivenzon-Segal, D; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J; Wong, M 12/28/2011 8/22/2011 TBA http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50335514 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2257&target=Sphingosine+1-phosphate+receptor+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50335514&enzyme=Sphingosine+1-phosphate+receptor+5&column=ki&startPg=0&Increment=50&submit=Search 44600476 125085616 CHEMBL1651861 1 MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFIVLENLAVLLVLGRHPRFHAPMFLLLGSLTLSDLLAGAAYAANILLSGPLTLKLSPALWFAREGGVFVALTASVLSLLAIALERSLTMARRGPAPVSSRGRTLAMAAAAWGVSLLLGLLPALGWNCLGRLDACSTVLPLYAKAYVLFCVLAFVGILAAICALYARIYCQVRANARRLPARPGTAGTTSTRARRKPRSLALLRTLSVVLLAFVACWGPLFLLLLLDVACPARTCPVLLQADPFLGLAMANSLLNPIIYTLTNRDLRHALLRLVCCGRHSCGRDPSGSQQSASAAEASGGLRRCLPPGLDGSFSGSERSSPQRDGLDTSGSTGSPGAPTAARTLVSEPAAD 7YXA Sphingosine 1-phosphate receptor 5 S1PR5_HUMAN Q9H228 Q6NW11