BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50105066 CCOC(=O)CCc1oc2ccc(Cl)c(C(=O)Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)c2c1C InChI=1S/C32H30ClN3O6/c1-3-40-28(37)13-12-25-19(2)29-27(41-25)11-10-22(33)30(29)32(39)42-26-14-15-34-18-21(26)31(38)36-17-16-35(20-8-9-20)23-6-4-5-7-24(23)36/h4-7,10-11,14-15,18,20H,3,8-9,12-13,16-17H2,1-2H3 XMQDPHTYQDWLIH-UHFFFAOYSA-N 50019462 CHEMBL3290735 G-protein coupled bile acid receptor 1 Mus musculus 72 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019462 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019462&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90644444 103930412 CHEMBL3290735 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50105067 CCOC(=O)CNC(=O)c1oc2cc(Cl)c(cc2c1C)C(=O)Oc1ccncc1C(=O)N1CCN(C2CC2)c2ccccc12 InChI=1S/C32H29ClN4O7/c1-3-42-28(38)17-35-30(39)29-18(2)20-14-21(23(33)15-27(20)43-29)32(41)44-26-10-11-34-16-22(26)31(40)37-13-12-36(19-8-9-19)24-6-4-5-7-25(24)37/h4-7,10-11,14-16,19H,3,8-9,12-13,17H2,1-2H3,(H,35,39) XDFHPGCORBLBSQ-UHFFFAOYSA-N 50019463 CHEMBL3290727 G-protein coupled bile acid receptor 1 Homo sapiens 78 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019463 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019463&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90644445 103930413 CHEMBL3290727 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105068 COC(=O)CCc1coc2cc(Cl)c(cc12)C(=O)Oc1ccncc1C(=O)N1CCN(C2CC2)c2ccccc12 InChI=1S/C30H26ClN3O6/c1-38-28(35)9-6-18-17-39-27-15-23(31)21(14-20(18)27)30(37)40-26-10-11-32-16-22(26)29(36)34-13-12-33(19-7-8-19)24-4-2-3-5-25(24)34/h2-5,10-11,14-17,19H,6-9,12-13H2,1H3 QYYBCTHIUVFMLW-UHFFFAOYSA-N 50019464 CHEMBL3290722 G-protein coupled bile acid receptor 1 Mus musculus 82 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019464 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019464&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90644446 103930414 CHEMBL3290722 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50105069 CCOC(=O)CNC(=O)CCc1oc2ccc(Cl)c(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)c2c1C InChI=1S/C33H33ClN4O6/c1-3-42-30(40)19-36-29(39)13-12-26-20(2)31-28(43-26)11-10-23(34)32(31)44-27-14-15-35-18-22(27)33(41)38-17-16-37(21-8-9-21)24-6-4-5-7-25(24)38/h4-7,10-11,14-15,18,21H,3,8-9,12-13,16-17,19H2,1-2H3,(H,36,39) LCPHXJRRBBZJNX-UHFFFAOYSA-N 50019465 CHEMBL3290737 G-protein coupled bile acid receptor 1 Mus musculus 85 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019465 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019465&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90644447 103930415 CHEMBL3290737 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50105070 Cc1c(CCC(O)=O)oc2ccc(Cl)c(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)c12 InChI=1S/C29H26ClN3O5/c1-17-23(10-11-26(34)35)37-25-9-8-20(30)28(27(17)25)38-24-12-13-31-16-19(24)29(36)33-15-14-32(18-6-7-18)21-4-2-3-5-22(21)33/h2-5,8-9,12-13,16,18H,6-7,10-11,14-15H2,1H3,(H,34,35) KBEYTIZTXJACDD-UHFFFAOYSA-N 50019466 CHEMBL3290736 G-protein coupled bile acid receptor 1 Mus musculus 101 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019466 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019466&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90644448 103930416 CHEMBL3290736 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50105071 CCOC(=O)CNC(=O)CCc1coc2cc(Cl)c(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12 InChI=1S/C32H31ClN4O6/c1-2-41-31(39)18-35-30(38)10-7-20-19-42-28-16-24(33)29(15-22(20)28)43-27-11-12-34-17-23(27)32(40)37-14-13-36(21-8-9-21)25-5-3-4-6-26(25)37/h3-6,11-12,15-17,19,21H,2,7-10,13-14,18H2,1H3,(H,35,38) TXNMICNSUCYSEA-UHFFFAOYSA-N 50019467 CHEMBL3290730 G-protein coupled bile acid receptor 1 Homo sapiens 119 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019467 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019467&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90327533 103930417 CHEMBL3290730 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105072 O=C(N1CCN(C2CC2)c2ccccc12)c1cnccc1Oc1cccc2[nH]ccc12 InChI=1S/C25H22N4O2/c30-25(29-15-14-28(17-8-9-17)21-5-1-2-6-22(21)29)19-16-26-12-11-24(19)31-23-7-3-4-20-18(23)10-13-27-20/h1-7,10-13,16-17,27H,8-9,14-15H2 HHDLXTVOLZUNEX-UHFFFAOYSA-N 50019468 CHEMBL3290709 G-protein coupled bile acid receptor 1 Homo sapiens 148 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019468 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019468&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71626558 103930418 CHEMBL3290709 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105073 O=C(N1CCN(C2CC2)c2ccccc12)c1cnccc1Oc1ccc2cc[nH]c2c1 InChI=1S/C25H22N4O2/c30-25(29-14-13-28(18-6-7-18)22-3-1-2-4-23(22)29)20-16-26-11-10-24(20)31-19-8-5-17-9-12-27-21(17)15-19/h1-5,8-12,15-16,18,27H,6-7,13-14H2 GRIJEJYICDLSBY-UHFFFAOYSA-N 50019469 CHEMBL3290710 G-protein coupled bile acid receptor 1 Homo sapiens 162 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019469 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019469&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71626491 103930419 CHEMBL3290710 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105074 O=C(N1CCN(C2CC2)c2ccccc12)c1cnccc1Oc1cccc2cccnc12 InChI=1S/C26H22N4O2/c31-26(30-16-15-29(19-10-11-19)21-7-1-2-8-22(21)30)20-17-27-14-12-23(20)32-24-9-3-5-18-6-4-13-28-25(18)24/h1-9,12-14,17,19H,10-11,15-16H2 LZCOGQJCRULDJL-UHFFFAOYSA-N 50019470 CHEMBL3290705 G-protein coupled bile acid receptor 1 Homo sapiens 178 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019470 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019470&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90644449 103930420 CHEMBL3290705 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105075 Cc1noc2cc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)ccc12 InChI=1S/C25H22N4O3/c1-16-19-9-8-18(14-24(19)32-27-16)31-23-10-11-26-15-20(23)25(30)29-13-12-28(17-6-7-17)21-4-2-3-5-22(21)29/h2-5,8-11,14-15,17H,6-7,12-13H2,1H3 KHTHVXWNAFSBLT-UHFFFAOYSA-N 50019471 CHEMBL3290714 G-protein coupled bile acid receptor 1 Homo sapiens 240 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019471 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019471&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71626422 103930421 CHEMBL3290714 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105076 CCOC(=O)CNC(=O)Cc1coc2cc(Cl)c(cc12)C(=O)Oc1ccncc1C(=O)N1CCN(C2CC2)c2ccccc12 InChI=1S/C32H29ClN4O7/c1-2-42-30(39)17-35-29(38)13-19-18-43-28-15-24(33)22(14-21(19)28)32(41)44-27-9-10-34-16-23(27)31(40)37-12-11-36(20-7-8-20)25-5-3-4-6-26(25)37/h3-6,9-10,14-16,18,20H,2,7-8,11-13,17H2,1H3,(H,35,38) ZTZXQRSNEBZXKU-UHFFFAOYSA-N 50019472 CHEMBL3290729 G-protein coupled bile acid receptor 1 Homo sapiens 520 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019472 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019472&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90644450 103930422 CHEMBL3290729 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105077 OC(=O)CCc1coc2cc(Cl)c(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12 InChI=1S/C28H24ClN3O5/c29-21-14-25-19(17(16-36-25)5-8-27(33)34)13-26(21)37-24-9-10-30-15-20(24)28(35)32-12-11-31(18-6-7-18)22-3-1-2-4-23(22)32/h1-4,9-10,13-16,18H,5-8,11-12H2,(H,33,34) FDNYQWLSNDFHBJ-UHFFFAOYSA-N 50019473 CHEMBL3290726 G-protein coupled bile acid receptor 1 Homo sapiens 675 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019473 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019473&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 77845284 103930423 CHEMBL3290726 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105078 Cc1coc2cc(Cl)c(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12 InChI=1S/C26H22ClN3O3/c1-16-15-32-24-13-20(27)25(12-18(16)24)33-23-8-9-28-14-19(23)26(31)30-11-10-29(17-6-7-17)21-4-2-3-5-22(21)30/h2-5,8-9,12-15,17H,6-7,10-11H2,1H3 GKWPRSMFTMKLCV-UHFFFAOYSA-N 50019474 CHEMBL3290717 G-protein coupled bile acid receptor 1 Homo sapiens 0.280000 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019474 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019474&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90644451 103930424 CHEMBL3290717 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105079 Cc1coc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12 InChI=1S/C26H23N3O3/c1-17-16-31-24-9-8-19(14-20(17)24)32-25-10-11-27-15-21(25)26(30)29-13-12-28(18-6-7-18)22-4-2-3-5-23(22)29/h2-5,8-11,14-16,18H,6-7,12-13H2,1H3 XSQWZZWJHWYIQW-UHFFFAOYSA-N 50019475 CHEMBL3290716 G-protein coupled bile acid receptor 1 Homo sapiens 0.450000 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019475 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019475&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71626699 103930425 CHEMBL3290716 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105080 Cc1coc2cc(Cl)c(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12 InChI=1S/C26H22ClN3O3/c1-16-15-32-24-13-20(27)25(12-18(16)24)33-23-8-9-28-14-19(23)26(31)30-11-10-29(17-6-7-17)21-4-2-3-5-22(21)30/h2-5,8-9,12-15,17H,6-7,10-11H2,1H3 GKWPRSMFTMKLCV-UHFFFAOYSA-N 50019474 CHEMBL3290717 G-protein coupled bile acid receptor 1 Mus musculus 0.920000 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019474 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019474&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90644451 103930424 CHEMBL3290717 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50105081 Clc1cc2occc2cc1Oc1ccncc1C(=O)N1CCN(C2CC2)c2ccccc12 InChI=1S/C25H20ClN3O3/c26-19-14-23-16(8-12-31-23)13-24(19)32-22-7-9-27-15-18(22)25(30)29-11-10-28(17-5-6-17)20-3-1-2-4-21(20)29/h1-4,7-9,12-15,17H,5-6,10-11H2 UYMILKMRNOZXPJ-UHFFFAOYSA-N 50019478 CHEMBL3290715 G-protein coupled bile acid receptor 1 Homo sapiens 1.4 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019478 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019478&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71626700 103930428 CHEMBL3290715 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105082 Cc1noc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12 InChI=1S/C25H22N4O3/c1-16-19-14-18(8-9-24(19)32-27-16)31-23-10-11-26-15-20(23)25(30)29-13-12-28(17-6-7-17)21-4-2-3-5-22(21)29/h2-5,8-11,14-15,17H,6-7,12-13H2,1H3 QEXDHLVQFHJZIJ-UHFFFAOYSA-N 50019479 CHEMBL3290713 G-protein coupled bile acid receptor 1 Homo sapiens 1.5 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019479 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019479&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71626488 103930429 CHEMBL3290713 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105083 CCOC(=O)c1coc2cc(Cl)c(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12 InChI=1S/C28H24ClN3O5/c1-2-35-28(34)20-16-36-25-14-21(29)26(13-18(20)25)37-24-9-10-30-15-19(24)27(33)32-12-11-31(17-7-8-17)22-5-3-4-6-23(22)32/h3-6,9-10,13-17H,2,7-8,11-12H2,1H3 UBILEIIMFLCVCE-UHFFFAOYSA-N 50019485 CHEMBL3290720 G-protein coupled bile acid receptor 1 Homo sapiens 1.7 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019485 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019485&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 77845059 103930435 CHEMBL3290720 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105084 CC(=O)c1cc(ccc1O)C(=O)N1CCN(C2CC2)c2ccccc12 InChI=1S/C20H20N2O3/c1-13(23)16-12-14(6-9-19(16)24)20(25)22-11-10-21(15-7-8-15)17-4-2-3-5-18(17)22/h2-6,9,12,15,24H,7-8,10-11H2,1H3 GMOSTTPZYSNDNW-UHFFFAOYSA-N 50019486 CHEMBL3286440 G-protein coupled bile acid receptor 1 Homo sapiens 2.3 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019486 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019486&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90644452 103930436 CHEMBL3286440 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105085 Cc1coc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12 InChI=1S/C26H23N3O3/c1-17-16-31-24-9-8-19(14-20(17)24)32-25-10-11-27-15-21(25)26(30)29-13-12-28(18-6-7-18)22-4-2-3-5-23(22)29/h2-5,8-11,14-16,18H,6-7,12-13H2,1H3 XSQWZZWJHWYIQW-UHFFFAOYSA-N 50019475 CHEMBL3290716 G-protein coupled bile acid receptor 1 Mus musculus 2.4 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019475 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019475&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71626699 103930425 CHEMBL3290716 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50105086 CCOC(=O)Cc1coc2cc(Cl)c(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12 InChI=1S/C29H26ClN3O5/c1-2-36-28(34)13-18-17-37-26-15-22(30)27(14-20(18)26)38-25-9-10-31-16-21(25)29(35)33-12-11-32(19-7-8-19)23-5-3-4-6-24(23)33/h3-6,9-10,14-17,19H,2,7-8,11-13H2,1H3 ZHJLEBSYCYGBOQ-UHFFFAOYSA-N 50019488 CHEMBL3290721 G-protein coupled bile acid receptor 1 Homo sapiens 5.2 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019488 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019488&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90644453 103930438 CHEMBL3290721 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105087 CC(=O)c1cccc(Oc2ccncc2C(=O)N2CCN(C3CC3)c3ccccc23)c1 InChI=1S/C25H23N3O3/c1-17(29)18-5-4-6-20(15-18)31-24-11-12-26-16-21(24)25(30)28-14-13-27(19-9-10-19)22-7-2-3-8-23(22)28/h2-8,11-12,15-16,19H,9-10,13-14H2,1H3 XRCCAWIVHSMHBA-UHFFFAOYSA-N 50019489 CHEMBL3290739 G-protein coupled bile acid receptor 1 Homo sapiens 5.5 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019489 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019489&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90644454 242042096 CHEMBL3290739 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105088 Cc1noc2ccc(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12 InChI=1S/C25H22N4O3/c1-16-19-14-18(8-9-24(19)32-27-16)31-23-10-11-26-15-20(23)25(30)29-13-12-28(17-6-7-17)21-4-2-3-5-22(21)29/h2-5,8-11,14-15,17H,6-7,12-13H2,1H3 QEXDHLVQFHJZIJ-UHFFFAOYSA-N 50019479 CHEMBL3290713 G-protein coupled bile acid receptor 1 Mus musculus 5.5 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019479 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019479&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71626488 103930429 CHEMBL3290713 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50105089 CCOC(=O)CNC(=O)\C=C\c1oc2ccc(Cl)c(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)c2c1C InChI=1S/C33H31ClN4O6/c1-3-42-30(40)19-36-29(39)13-12-26-20(2)31-28(43-26)11-10-23(34)32(31)44-27-14-15-35-18-22(27)33(41)38-17-16-37(21-8-9-21)24-6-4-5-7-25(24)38/h4-7,10-15,18,21H,3,8-9,16-17,19H2,1-2H3,(H,36,39) DVOYPVCTWZIMAA-UHFFFAOYSA-N 50019490 CHEMBL3290733 G-protein coupled bile acid receptor 1 Mus musculus 6.1 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019490 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019490&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90644455 242042097 CHEMBL3290733 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50105090 Cc1c(Br)oc2cc(Cl)c(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12 InChI=1S/C26H21BrClN3O3/c1-15-17-12-24(19(28)13-23(17)34-25(15)27)33-22-8-9-29-14-18(22)26(32)31-11-10-30(16-6-7-16)20-4-2-3-5-21(20)31/h2-5,8-9,12-14,16H,6-7,10-11H2,1H3 MXKPEBZFAPYPGB-UHFFFAOYSA-N 50019491 CHEMBL3290718 G-protein coupled bile acid receptor 1 Homo sapiens 7.7 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019491 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019491&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 77846087 103930439 CHEMBL3290718 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105091 CCOC(=O)CNC(=O)\C=C\c1oc2ccc(Cl)c(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)c2c1C InChI=1S/C33H31ClN4O6/c1-3-42-30(40)19-36-29(39)13-12-26-20(2)31-28(43-26)11-10-23(34)32(31)44-27-14-15-35-18-22(27)33(41)38-17-16-37(21-8-9-21)24-6-4-5-7-25(24)38/h4-7,10-15,18,21H,3,8-9,16-17,19H2,1-2H3,(H,36,39) DVOYPVCTWZIMAA-UHFFFAOYSA-N 50019490 CHEMBL3290733 G-protein coupled bile acid receptor 1 Homo sapiens 8.5 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019490 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019490&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90644455 242042097 CHEMBL3290733 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105092 CCOC(=O)\C=C\c1oc2ccc(Cl)c(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)c2c1C InChI=1S/C31H28ClN3O5/c1-3-38-28(36)13-12-25-19(2)29-27(39-25)11-10-22(32)30(29)40-26-14-15-33-18-21(26)31(37)35-17-16-34(20-8-9-20)23-6-4-5-7-24(23)35/h4-7,10-15,18,20H,3,8-9,16-17H2,1-2H3 PTIUNFXQKYZPGH-UHFFFAOYSA-N 50019493 CHEMBL3290731 G-protein coupled bile acid receptor 1 Homo sapiens 8.9 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019493 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019493&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90644456 103930441 CHEMBL3290731 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105093 Clc1cc2occc2cc1Oc1ccncc1C(=O)N1CCN(C2CC2)c2ccccc12 InChI=1S/C25H20ClN3O3/c26-19-14-23-16(8-12-31-23)13-24(19)32-22-7-9-27-15-18(22)25(30)29-11-10-28(17-5-6-17)20-3-1-2-4-21(20)29/h1-4,7-9,12-15,17H,5-6,10-11H2 UYMILKMRNOZXPJ-UHFFFAOYSA-N 50019478 CHEMBL3290715 G-protein coupled bile acid receptor 1 Mus musculus 10.0 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019478 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019478&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71626700 103930428 CHEMBL3290715 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50105094 O=C(N1CCN(C2CC2)c2ccccc12)c1cnccc1Oc1ccc2occc2c1 InChI=1S/C25H21N3O3/c29-25(28-13-12-27(18-5-6-18)21-3-1-2-4-22(21)28)20-16-26-11-9-24(20)31-19-7-8-23-17(15-19)10-14-30-23/h1-4,7-11,14-16,18H,5-6,12-13H2 KYBOAWZHMHJXLA-UHFFFAOYSA-N 50019494 CHEMBL3290706 G-protein coupled bile acid receptor 1 Homo sapiens 11 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019494 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019494&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71626492 103930442 CHEMBL3290706 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105095 Cc1c(\C=C\C(=O)NCC(O)=O)oc2ccc(Cl)c(C(=O)Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)c12 InChI=1S/C32H27ClN4O7/c1-18-24(10-11-27(38)35-17-28(39)40)43-26-9-8-21(33)30(29(18)26)32(42)44-25-12-13-34-16-20(25)31(41)37-15-14-36(19-6-7-19)22-4-2-3-5-23(22)37/h2-5,8-13,16,19H,6-7,14-15,17H2,1H3,(H,35,38)(H,39,40) BYPOYJAQQHIBLX-UHFFFAOYSA-N 50019495 CHEMBL3290734 G-protein coupled bile acid receptor 1 Mus musculus 13 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019495 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019495&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90644457 103930443 CHEMBL3290734 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50105096 O=C(N1CCN(C2CC2)c2ccccc12)c1cnccc1Oc1ccc2ncsc2c1 InChI=1S/C24H20N4O2S/c29-24(28-12-11-27(16-5-6-16)20-3-1-2-4-21(20)28)18-14-25-10-9-22(18)30-17-7-8-19-23(13-17)31-15-26-19/h1-4,7-10,13-16H,5-6,11-12H2 VHUOGBXOCIUGBI-UHFFFAOYSA-N 50019496 CHEMBL3290712 G-protein coupled bile acid receptor 1 Homo sapiens 15 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019496 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019496&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71626560 103930444 CHEMBL3290712 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105097 O=C(N1CCN(C2CC2)c2ccccc12)c1cnccc1Oc1ccc2sccc2c1 InChI=1S/C25H21N3O2S/c29-25(28-13-12-27(18-5-6-18)21-3-1-2-4-22(21)28)20-16-26-11-9-23(20)30-19-7-8-24-17(15-19)10-14-31-24/h1-4,7-11,14-16,18H,5-6,12-13H2 ISPYSTMOLGIFAH-UHFFFAOYSA-N 50019497 CHEMBL3290711 G-protein coupled bile acid receptor 1 Homo sapiens 16 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019497 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019497&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71626697 103930445 CHEMBL3290711 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105098 CCOC(=O)\C=C\c1oc2ccc(Cl)c(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)c2c1C InChI=1S/C31H28ClN3O5/c1-3-38-28(36)13-12-25-19(2)29-27(39-25)11-10-22(32)30(29)40-26-14-15-33-18-21(26)31(37)35-17-16-34(20-8-9-20)23-6-4-5-7-24(23)35/h4-7,10-15,18,20H,3,8-9,16-17H2,1-2H3 PTIUNFXQKYZPGH-UHFFFAOYSA-N 50019493 CHEMBL3290731 G-protein coupled bile acid receptor 1 Mus musculus 16 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019493 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019493&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90644456 103930441 CHEMBL3290731 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50105099 O=C(N1CCN(C2CC2)c2ccccc12)c1cnccc1Oc1cccc2ccccc12 InChI=1S/C27H23N3O2/c31-27(30-17-16-29(20-12-13-20)23-9-3-4-10-24(23)30)22-18-28-15-14-26(22)32-25-11-5-7-19-6-1-2-8-21(19)25/h1-11,14-15,18,20H,12-13,16-17H2 GIKLKUKUHWEEDL-UHFFFAOYSA-N 50019498 CHEMBL3290700 G-protein coupled bile acid receptor 1 Homo sapiens 17 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019498 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019498&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71626489 103930446 CHEMBL3290700 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105100 CCOC(=O)CCc1oc2ccc(Cl)c(C(=O)Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)c2c1C InChI=1S/C32H30ClN3O6/c1-3-40-28(37)13-12-25-19(2)29-27(41-25)11-10-22(33)30(29)32(39)42-26-14-15-34-18-21(26)31(38)36-17-16-35(20-8-9-20)23-6-4-5-7-24(23)36/h4-7,10-11,14-15,18,20H,3,8-9,12-13,16-17H2,1-2H3 XMQDPHTYQDWLIH-UHFFFAOYSA-N 50019462 CHEMBL3290735 G-protein coupled bile acid receptor 1 Homo sapiens 18 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019462 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019462&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90644444 103930412 CHEMBL3290735 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105101 Cc1c(\C=C\C(O)=O)oc2ccc(Cl)c(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)c12 InChI=1S/C29H24ClN3O5/c1-17-23(10-11-26(34)35)37-25-9-8-20(30)28(27(17)25)38-24-12-13-31-16-19(24)29(36)33-15-14-32(18-6-7-18)21-4-2-3-5-22(21)33/h2-5,8-13,16,18H,6-7,14-15H2,1H3,(H,34,35) HJNONGVGWPNBLK-UHFFFAOYSA-N 50019499 CHEMBL3290732 G-protein coupled bile acid receptor 1 Mus musculus 18 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019499 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019499&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90644458 103930447 CHEMBL3290732 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50105102 COC(=O)CCc1coc2cc(Cl)c(cc12)C(=O)Oc1ccncc1C(=O)N1CCN(C2CC2)c2ccccc12 InChI=1S/C30H26ClN3O6/c1-38-28(35)9-6-18-17-39-27-15-23(31)21(14-20(18)27)30(37)40-26-10-11-32-16-22(26)29(36)34-13-12-33(19-7-8-19)24-4-2-3-5-25(24)34/h2-5,10-11,14-17,19H,6-9,12-13H2,1H3 QYYBCTHIUVFMLW-UHFFFAOYSA-N 50019464 CHEMBL3290722 G-protein coupled bile acid receptor 1 Homo sapiens 24 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019464 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019464&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90644446 103930414 CHEMBL3290722 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105103 O=C(N1CCN(C2CC2)c2ccccc12)c1cnccc1Oc1ccc2ccoc2c1 InChI=1S/C25H21N3O3/c29-25(28-13-12-27(18-6-7-18)21-3-1-2-4-22(21)28)20-16-26-11-9-23(20)31-19-8-5-17-10-14-30-24(17)15-19/h1-5,8-11,14-16,18H,6-7,12-13H2 FKSIHABGGOIYDY-UHFFFAOYSA-N 50019500 CHEMBL3290707 G-protein coupled bile acid receptor 1 Homo sapiens 25 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019500 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019500&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71626556 103930448 CHEMBL3290707 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105104 Cc1c(\C=C\C(O)=O)oc2ccc(Cl)c(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)c12 InChI=1S/C29H24ClN3O5/c1-17-23(10-11-26(34)35)37-25-9-8-20(30)28(27(17)25)38-24-12-13-31-16-19(24)29(36)33-15-14-32(18-6-7-18)21-4-2-3-5-22(21)33/h2-5,8-13,16,18H,6-7,14-15H2,1H3,(H,34,35) HJNONGVGWPNBLK-UHFFFAOYSA-N 50019499 CHEMBL3290732 G-protein coupled bile acid receptor 1 Homo sapiens 25 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019499 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019499&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90644458 103930447 CHEMBL3290732 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105105 O=C(N1CCN(C2CC2)c2ccccc12)c1cnccc1Oc1ccc2occc2c1 InChI=1S/C25H21N3O3/c29-25(28-13-12-27(18-5-6-18)21-3-1-2-4-22(21)28)20-16-26-11-9-24(20)31-19-7-8-23-17(15-19)10-14-30-23/h1-4,7-11,14-16,18H,5-6,12-13H2 KYBOAWZHMHJXLA-UHFFFAOYSA-N 50019494 CHEMBL3290706 G-protein coupled bile acid receptor 1 Mus musculus 28 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019494 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019494&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71626492 103930442 CHEMBL3290706 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50105106 CCOC(=O)CNC(=O)CCc1oc2ccc(Cl)c(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)c2c1C InChI=1S/C33H33ClN4O6/c1-3-42-30(40)19-36-29(39)13-12-26-20(2)31-28(43-26)11-10-23(34)32(31)44-27-14-15-35-18-22(27)33(41)38-17-16-37(21-8-9-21)24-6-4-5-7-25(24)38/h4-7,10-11,14-15,18,21H,3,8-9,12-13,16-17,19H2,1-2H3,(H,36,39) LCPHXJRRBBZJNX-UHFFFAOYSA-N 50019465 CHEMBL3290737 G-protein coupled bile acid receptor 1 Homo sapiens 30 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019465 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019465&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90644447 103930415 CHEMBL3290737 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105107 Cc1c(\C=C\C(=O)NCC(O)=O)oc2ccc(Cl)c(C(=O)Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)c12 InChI=1S/C32H27ClN4O7/c1-18-24(10-11-27(38)35-17-28(39)40)43-26-9-8-21(33)30(29(18)26)32(42)44-25-12-13-34-16-20(25)31(41)37-15-14-36(19-6-7-19)22-4-2-3-5-23(22)37/h2-5,8-13,16,19H,6-7,14-15,17H2,1H3,(H,35,38)(H,39,40) BYPOYJAQQHIBLX-UHFFFAOYSA-N 50019495 CHEMBL3290734 G-protein coupled bile acid receptor 1 Homo sapiens 34 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019495 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019495&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90644457 103930443 CHEMBL3290734 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105108 Cc1c(CCC(O)=O)oc2ccc(Cl)c(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)c12 InChI=1S/C29H26ClN3O5/c1-17-23(10-11-26(34)35)37-25-9-8-20(30)28(27(17)25)38-24-12-13-31-16-19(24)29(36)33-15-14-32(18-6-7-18)21-4-2-3-5-22(21)33/h2-5,8-9,12-13,16,18H,6-7,10-11,14-15H2,1H3,(H,34,35) KBEYTIZTXJACDD-UHFFFAOYSA-N 50019466 CHEMBL3290736 G-protein coupled bile acid receptor 1 Homo sapiens 35 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019466 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019466&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90644448 103930416 CHEMBL3290736 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105109 CCOC(=O)c1oc2cc(Cl)c(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc2c1C InChI=1S/C29H26ClN3O5/c1-3-36-29(35)27-17(2)19-14-26(21(30)15-25(19)38-27)37-24-10-11-31-16-20(24)28(34)33-13-12-32(18-8-9-18)22-6-4-5-7-23(22)33/h4-7,10-11,14-16,18H,3,8-9,12-13H2,1-2H3 QMYRFJVIMVNOLH-UHFFFAOYSA-N 50019501 CHEMBL3290719 G-protein coupled bile acid receptor 1 Homo sapiens 38 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019501 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019501&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90644459 103930449 CHEMBL3290719 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105110 CCOC(=O)Cc1coc2cc(Cl)c(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12 InChI=1S/C29H26ClN3O5/c1-2-36-28(34)13-18-17-37-26-15-22(30)27(14-20(18)26)38-25-9-10-31-16-21(25)29(35)33-12-11-32(19-7-8-19)23-5-3-4-6-24(23)33/h3-6,9-10,14-17,19H,2,7-8,11-13H2,1H3 ZHJLEBSYCYGBOQ-UHFFFAOYSA-N 50019488 CHEMBL3290721 G-protein coupled bile acid receptor 1 Mus musculus 38 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019488 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019488&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90644453 103930438 CHEMBL3290721 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50105111 CCOC(=O)c1coc2cc(Cl)c(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12 InChI=1S/C28H24ClN3O5/c1-2-35-28(34)20-16-36-25-14-21(29)26(13-18(20)25)37-24-9-10-30-15-19(24)27(33)32-12-11-31(17-7-8-17)22-5-3-4-6-23(22)32/h3-6,9-10,13-17H,2,7-8,11-12H2,1H3 UBILEIIMFLCVCE-UHFFFAOYSA-N 50019485 CHEMBL3290720 G-protein coupled bile acid receptor 1 Mus musculus 39 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019485 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019485&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 77845059 103930435 CHEMBL3290720 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50105112 O=C(N1CCN(C2CC2)c2ccccc12)c1cnccc1Oc1cccc2ncccc12 InChI=1S/C26H22N4O2/c31-26(30-16-15-29(18-10-11-18)22-7-1-2-8-23(22)30)20-17-27-14-12-25(20)32-24-9-3-6-21-19(24)5-4-13-28-21/h1-9,12-14,17-18H,10-11,15-16H2 PROWSSANIATLQT-UHFFFAOYSA-N 50019502 CHEMBL3290702 G-protein coupled bile acid receptor 1 Homo sapiens 40 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019502 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019502&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71626557 103930450 CHEMBL3290702 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105113 O=C(N1CCN(C2CC2)c2ccccc12)c1cnccc1Oc1ccc2ccccc2c1 InChI=1S/C27H23N3O2/c31-27(30-16-15-29(21-10-11-21)24-7-3-4-8-25(24)30)23-18-28-14-13-26(23)32-22-12-9-19-5-1-2-6-20(19)17-22/h1-9,12-14,17-18,21H,10-11,15-16H2 QFEORMHUMOYISV-UHFFFAOYSA-N 50019503 CHEMBL3290701 G-protein coupled bile acid receptor 1 Homo sapiens 41 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019503 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019503&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71626490 103930451 CHEMBL3290701 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105114 O=C(N1CCN(C2CC2)c2ccccc12)c1cnccc1Oc1ccc2ccoc2c1 InChI=1S/C25H21N3O3/c29-25(28-13-12-27(18-6-7-18)21-3-1-2-4-22(21)28)20-16-26-11-9-23(20)31-19-8-5-17-10-14-30-24(17)15-19/h1-5,8-11,14-16,18H,6-7,12-13H2 FKSIHABGGOIYDY-UHFFFAOYSA-N 50019500 CHEMBL3290707 G-protein coupled bile acid receptor 1 Mus musculus 43 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019500 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019500&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71626556 103930448 CHEMBL3290707 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50105115 O=C(N1CCN(C2CC2)c2ccccc12)c1cnccc1Oc1ccc2sccc2c1 InChI=1S/C25H21N3O2S/c29-25(28-13-12-27(18-5-6-18)21-3-1-2-4-22(21)28)20-16-26-11-9-23(20)30-19-7-8-24-17(15-19)10-14-31-24/h1-4,7-11,14-16,18H,5-6,12-13H2 ISPYSTMOLGIFAH-UHFFFAOYSA-N 50019497 CHEMBL3290711 G-protein coupled bile acid receptor 1 Mus musculus 52 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019497 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019497&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71626697 103930445 CHEMBL3290711 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50105116 O=C(N1CCN(C2CC2)c2ccccc12)c1cnccc1Oc1ccc2cccnc2c1 InChI=1S/C26H22N4O2/c31-26(30-15-14-29(19-8-9-19)23-5-1-2-6-24(23)30)21-17-27-13-11-25(21)32-20-10-7-18-4-3-12-28-22(18)16-20/h1-7,10-13,16-17,19H,8-9,14-15H2 GEMAUICASOBLMZ-UHFFFAOYSA-N 50019504 CHEMBL3290704 G-protein coupled bile acid receptor 1 Homo sapiens 59 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019504 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019504&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71626493 103930452 CHEMBL3290704 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105117 O=C(N1CCN(C2CC2)c2ccccc12)c1cnccc1Oc1ccc2ncsc2c1 InChI=1S/C24H20N4O2S/c29-24(28-12-11-27(16-5-6-16)20-3-1-2-4-21(20)28)18-14-25-10-9-22(18)30-17-7-8-19-23(13-17)31-15-26-19/h1-4,7-10,13-16H,5-6,11-12H2 VHUOGBXOCIUGBI-UHFFFAOYSA-N 50019496 CHEMBL3290712 G-protein coupled bile acid receptor 1 Mus musculus 60 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019496 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019496&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71626560 103930444 CHEMBL3290712 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50105118 Cc1c(oc2cc(Cl)c(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12)C(O)=O InChI=1S/C27H22ClN3O5/c1-15-17-12-24(19(28)13-23(17)36-25(15)27(33)34)35-22-8-9-29-14-18(22)26(32)31-11-10-30(16-6-7-16)20-4-2-3-5-21(20)31/h2-5,8-9,12-14,16H,6-7,10-11H2,1H3,(H,33,34) MEVXQVCFUKETIW-UHFFFAOYSA-N 50019505 CHEMBL3290723 G-protein coupled bile acid receptor 1 Homo sapiens 63 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019505 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019505&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90327488 103930453 CHEMBL3290723 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105119 O=C(N1CCN(C2CC2)c2ccccc12)c1cnccc1Oc1ccc2ncccc2c1 InChI=1S/C26H22N4O2/c31-26(30-15-14-29(19-7-8-19)23-5-1-2-6-24(23)30)21-17-27-13-11-25(21)32-20-9-10-22-18(16-20)4-3-12-28-22/h1-6,9-13,16-17,19H,7-8,14-15H2 AXZYYCXRZMBVEK-UHFFFAOYSA-N 50019506 CHEMBL3290703 G-protein coupled bile acid receptor 1 Homo sapiens 64 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019506 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019506&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71626555 103930454 CHEMBL3290703 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105120 O=C(N1CCN(C2CC2)c2ccccc12)c1cnccc1Oc1cccc2ccccc12 InChI=1S/C27H23N3O2/c31-27(30-17-16-29(20-12-13-20)23-9-3-4-10-24(23)30)22-18-28-15-14-26(22)32-25-11-5-7-19-6-1-2-8-21(19)25/h1-11,14-15,18,20H,12-13,16-17H2 GIKLKUKUHWEEDL-UHFFFAOYSA-N 50019498 CHEMBL3290700 G-protein coupled bile acid receptor 1 Mus musculus 66 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019498 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019498&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71626489 103930446 CHEMBL3290700 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50105121 Cc1c(Br)oc2cc(Cl)c(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12 InChI=1S/C26H21BrClN3O3/c1-15-17-12-24(19(28)13-23(17)34-25(15)27)33-22-8-9-29-14-18(22)26(32)31-11-10-30(16-6-7-16)20-4-2-3-5-21(20)31/h2-5,8-9,12-14,16H,6-7,10-11H2,1H3 MXKPEBZFAPYPGB-UHFFFAOYSA-N 50019491 CHEMBL3290718 G-protein coupled bile acid receptor 1 Mus musculus 66 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019491 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019491&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 77846087 103930439 CHEMBL3290718 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50105122 O=C(N1CCN(C2CC2)c2ccccc12)c1cnccc1Oc1ccc2[nH]ccc2c1 InChI=1S/C25H22N4O2/c30-25(29-14-13-28(18-5-6-18)22-3-1-2-4-23(22)29)20-16-26-11-10-24(20)31-19-7-8-21-17(15-19)9-12-27-21/h1-4,7-12,15-16,18,27H,5-6,13-14H2 KFXAELCMIDEFKA-UHFFFAOYSA-N 50019507 CHEMBL3290708 G-protein coupled bile acid receptor 1 Homo sapiens 1216 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019507 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019507&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71626559 103930455 CHEMBL3290708 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105123 OC(=O)Cc1coc2cc(Cl)c(Oc3ccncc3C(=O)N3CCN(C4CC4)c4ccccc34)cc12 InChI=1S/C27H22ClN3O5/c28-20-13-24-18(16(15-35-24)11-26(32)33)12-25(20)36-23-7-8-29-14-19(23)27(34)31-10-9-30(17-5-6-17)21-3-1-2-4-22(21)31/h1-4,7-8,12-15,17H,5-6,9-11H2,(H,32,33) SGNWXKVSGHHLMZ-UHFFFAOYSA-N 50019508 CHEMBL3290725 G-protein coupled bile acid receptor 1 Homo sapiens 1358 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019508 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019508&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 77845211 103930456 CHEMBL3290725 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50105124 CCOC(=O)CNC(=O)c1coc2cc(Cl)c(cc12)C(=O)Oc1ccncc1C(=O)N1CCN(C2CC2)c2ccccc12 InChI=1S/C31H27ClN4O7/c1-2-41-28(37)16-34-29(38)22-17-42-27-14-23(32)20(13-19(22)27)31(40)43-26-9-10-33-15-21(26)30(39)36-12-11-35(18-7-8-18)24-5-3-4-6-25(24)36/h3-6,9-10,13-15,17-18H,2,7-8,11-12,16H2,1H3,(H,34,38) VVMFKQLKBLLYLF-UHFFFAOYSA-N 50019509 CHEMBL3290728 G-protein coupled bile acid receptor 1 Homo sapiens 1405 ChEMBL 10.1016/j.ejmech.2014.05.031 10.7270/Q2F76F4H 24863981 Zou, Q; Duan, H; Ning, M; Liu, J; Feng, Y; Zhang, L; Zhu, J; Leng, Y; Shen, J 6/28/2014 2/11/2015 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50019509 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50019509&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90644460 103930457 CHEMBL3290728 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35