BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 51088205 CC(C)N1C(=O)c2cc(C)nc(Oc3cc(NS(=O)(=O)c4ccc(Cl)cc4)ccc3F)c2C1=O InChI=1S/C23H19ClFN3O5S/c1-12(2)28-22(29)17-10-13(3)26-21(20(17)23(28)30)33-19-11-15(6-9-18(19)25)27-34(31,32)16-7-4-14(24)5-8-16/h4-12,27H,1-3H3 ZMXPRLZLGHHSKI-UHFFFAOYSA-N 50445481 CHEMBL3104879 G protein-coupled receptor 119 Macaca fascicularis 73 ChEMBL 10.1016/j.bmcl.2013.11.053 10.7270/Q2J104N3 24332491 Yu, M; Ken Zhang, J; Wang, Y; Zhu, J; Kayser, F; Medina, JC; Siegler, K; Conn, M; Shan, B; Grillo, MP; Coward, P; Jim Liu, J 12/27/2013 7/25/2014 Amgen http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50445481 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006468&target=G+protein-coupled+receptor+119&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50445481&enzyme=G+protein-coupled+receptor+119&column=ki&startPg=0&Increment=50&submit=Search 72946092 194943377 CHEMBL3104879 1 MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKSDGVNLCFTLNLAVADTLIGVAISGLLTEQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPLRYLKIMSGFVAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGSCSFFAVFHPYFVLTLSCVGFFPAMLLFVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRPPRTPSDFKAVRTVSVLIGSFTLSWTPFLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYRQKEVRLQLYHMALGVKKALTSFLLFLSARNGGPERPRESSCHIVTISNSEFDG Glucose-dependent insulinotropic receptor G7Q3P2_MACFA G7Q3P2 A0A2K5UGH4 51088206 CC(C)N1C(=O)c2cc(C)nc(Oc3cccc(NS(=O)(=O)c4ccc(Cl)cc4)c3F)c2C1=O InChI=1S/C23H19ClFN3O5S/c1-12(2)28-22(29)16-11-13(3)26-21(19(16)23(28)30)33-18-6-4-5-17(20(18)25)27-34(31,32)15-9-7-14(24)8-10-15/h4-12,27H,1-3H3 IWNGVKCDWVZWDC-UHFFFAOYSA-N 50445482 CHEMBL3104862 Glucose-dependent insulinotropic receptor Homo sapiens 493 ChEMBL 10.1016/j.bmcl.2013.11.053 10.7270/Q2J104N3 24332491 Yu, M; Ken Zhang, J; Wang, Y; Zhu, J; Kayser, F; Medina, JC; Siegler, K; Conn, M; Shan, B; Grillo, MP; Coward, P; Jim Liu, J 12/27/2013 7/25/2014 Amgen http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50445482 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7731&target=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50445482&enzyme=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search 72946094 194943378 CHEMBL3104862 1 MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISGLLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGFVAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLLFVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTPFLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKVLTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG 8VHF,7XZ6,7XZ5,9L80,9L79,8ZRK,8ZR5 Glucose-dependent insulinotropic receptor GP119_HUMAN Q8TDV5 Q495H7 Q4VBN3 51088207 CC(C)N1C(=O)c2cc(C)nc(Oc3cc(F)cc(NS(=O)(=O)c4ccc(Cl)cc4)c3)c2C1=O InChI=1S/C23H19ClFN3O5S/c1-12(2)28-22(29)19-8-13(3)26-21(20(19)23(28)30)33-17-10-15(25)9-16(11-17)27-34(31,32)18-6-4-14(24)5-7-18/h4-12,27H,1-3H3 RWXKSLAZBIBOMO-UHFFFAOYSA-N 50445483 CHEMBL3104861 Glucose-dependent insulinotropic receptor Homo sapiens 357 ChEMBL 10.1016/j.bmcl.2013.11.053 10.7270/Q2J104N3 24332491 Yu, M; Ken Zhang, J; Wang, Y; Zhu, J; Kayser, F; Medina, JC; Siegler, K; Conn, M; Shan, B; Grillo, MP; Coward, P; Jim Liu, J 12/27/2013 7/25/2014 Amgen http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50445483 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7731&target=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50445483&enzyme=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search 72946093 194943379 CHEMBL3104861 1 MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISGLLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGFVAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLLFVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTPFLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKVLTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG 8VHF,7XZ6,7XZ5,9L80,9L79,8ZRK,8ZR5 Glucose-dependent insulinotropic receptor GP119_HUMAN Q8TDV5 Q495H7 Q4VBN3 51088208 CC(C)N1C(=O)c2cc(C)nc(Oc3cc(NS(=O)(=O)c4ccc(Cl)cc4)ccc3F)c2C1=O InChI=1S/C23H19ClFN3O5S/c1-12(2)28-22(29)17-10-13(3)26-21(20(17)23(28)30)33-19-11-15(6-9-18(19)25)27-34(31,32)16-7-4-14(24)5-8-16/h4-12,27H,1-3H3 ZMXPRLZLGHHSKI-UHFFFAOYSA-N 50445481 CHEMBL3104879 Glucose-dependent insulinotropic receptor Homo sapiens 16 ChEMBL 10.1016/j.bmcl.2013.11.053 10.7270/Q2J104N3 24332491 Yu, M; Ken Zhang, J; Wang, Y; Zhu, J; Kayser, F; Medina, JC; Siegler, K; Conn, M; Shan, B; Grillo, MP; Coward, P; Jim Liu, J 12/27/2013 7/25/2014 Amgen http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50445481 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7731&target=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50445481&enzyme=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search 72946092 194943377 CHEMBL3104879 1 MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISGLLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGFVAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLLFVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTPFLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKVLTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG 8VHF,7XZ6,7XZ5,9L80,9L79,8ZRK,8ZR5 Glucose-dependent insulinotropic receptor GP119_HUMAN Q8TDV5 Q495H7 Q4VBN3 51088209 CC(C)N1C(=O)c2cc(C)nc(Oc3cc(NS(=O)(=O)c4ccc(Cl)cc4)ccc3Cl)c2C1=O InChI=1S/C23H19Cl2N3O5S/c1-12(2)28-22(29)17-10-13(3)26-21(20(17)23(28)30)33-19-11-15(6-9-18(19)25)27-34(31,32)16-7-4-14(24)5-8-16/h4-12,27H,1-3H3 PWBRLDPIRDUGRG-UHFFFAOYSA-N 50445484 CHEMBL3104880 Glucose-dependent insulinotropic receptor Homo sapiens 33 ChEMBL 10.1016/j.bmcl.2013.11.053 10.7270/Q2J104N3 24332491 Yu, M; Ken Zhang, J; Wang, Y; Zhu, J; Kayser, F; Medina, JC; Siegler, K; Conn, M; Shan, B; Grillo, MP; Coward, P; Jim Liu, J 12/27/2013 7/25/2014 Amgen http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50445484 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7731&target=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50445484&enzyme=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search 72946091 194943380 CHEMBL3104880 1 MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISGLLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGFVAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLLFVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTPFLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKVLTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG 8VHF,7XZ6,7XZ5,9L80,9L79,8ZRK,8ZR5 Glucose-dependent insulinotropic receptor GP119_HUMAN Q8TDV5 Q495H7 Q4VBN3 51088210 CC(C)N1C(=O)c2cc(C)nc(Oc3ccc(C)c(NS(=O)(=O)c4ccc(Cl)cc4)c3)c2C1=O InChI=1S/C24H22ClN3O5S/c1-13(2)28-23(29)19-11-15(4)26-22(21(19)24(28)30)33-17-8-5-14(3)20(12-17)27-34(31,32)18-9-6-16(25)7-10-18/h5-13,27H,1-4H3 MJDPBUPXVLIBAA-UHFFFAOYSA-N 50445485 CHEMBL3104881 Glucose-dependent insulinotropic receptor Homo sapiens 9.0 ChEMBL 10.1016/j.bmcl.2013.11.053 10.7270/Q2J104N3 24332491 Yu, M; Ken Zhang, J; Wang, Y; Zhu, J; Kayser, F; Medina, JC; Siegler, K; Conn, M; Shan, B; Grillo, MP; Coward, P; Jim Liu, J 12/27/2013 7/25/2014 Amgen http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50445485 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7731&target=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50445485&enzyme=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search 72945900 194943381 CHEMBL3104881 1 MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISGLLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGFVAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLLFVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTPFLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKVLTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG 8VHF,7XZ6,7XZ5,9L80,9L79,8ZRK,8ZR5 Glucose-dependent insulinotropic receptor GP119_HUMAN Q8TDV5 Q495H7 Q4VBN3 51088211 CC(C)N1C(=O)c2cc(C)nc(Oc3cccc(c3)N(C)S(=O)(=O)c3ccc(Cl)cc3)c2C1=O InChI=1S/C24H22ClN3O5S/c1-14(2)28-23(29)20-12-15(3)26-22(21(20)24(28)30)33-18-7-5-6-17(13-18)27(4)34(31,32)19-10-8-16(25)9-11-19/h5-14H,1-4H3 SUGAFSCTMRIQEW-UHFFFAOYSA-N 50445486 CHEMBL3104882 Glucose-dependent insulinotropic receptor Homo sapiens 11 ChEMBL 10.1016/j.bmcl.2013.11.053 10.7270/Q2J104N3 24332491 Yu, M; Ken Zhang, J; Wang, Y; Zhu, J; Kayser, F; Medina, JC; Siegler, K; Conn, M; Shan, B; Grillo, MP; Coward, P; Jim Liu, J 12/27/2013 7/25/2014 Amgen http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50445486 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7731&target=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50445486&enzyme=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search 72945899 194943382 CHEMBL3104882 1 MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISGLLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGFVAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLLFVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTPFLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKVLTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG 8VHF,7XZ6,7XZ5,9L80,9L79,8ZRK,8ZR5 Glucose-dependent insulinotropic receptor GP119_HUMAN Q8TDV5 Q495H7 Q4VBN3 51088212 CC(C)N1C(=O)c2cc(C)nc(Oc3cccc(NC(=O)c4ccc(Cl)cc4)c3)c2C1=O InChI=1S/C24H20ClN3O4/c1-13(2)28-23(30)19-11-14(3)26-22(20(19)24(28)31)32-18-6-4-5-17(12-18)27-21(29)15-7-9-16(25)10-8-15/h4-13H,1-3H3,(H,27,29) XBJNRQKBQJOQAC-UHFFFAOYSA-N 50445487 CHEMBL3104883 Glucose-dependent insulinotropic receptor Homo sapiens >30000 ChEMBL 10.1016/j.bmcl.2013.11.053 10.7270/Q2J104N3 24332491 Yu, M; Ken Zhang, J; Wang, Y; Zhu, J; Kayser, F; Medina, JC; Siegler, K; Conn, M; Shan, B; Grillo, MP; Coward, P; Jim Liu, J 12/27/2013 7/25/2014 Amgen http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50445487 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7731&target=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50445487&enzyme=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search 72945898 194943383 CHEMBL3104883 1 MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISGLLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGFVAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLLFVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTPFLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKVLTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG 8VHF,7XZ6,7XZ5,9L80,9L79,8ZRK,8ZR5 Glucose-dependent insulinotropic receptor GP119_HUMAN Q8TDV5 Q495H7 Q4VBN3 51088213 CC(C)N1C(=O)c2cc(C)nc(Oc3cccc(c3)S(=O)(=O)Nc3ccc(Cl)cc3)c2C1=O InChI=1S/C23H20ClN3O5S/c1-13(2)27-22(28)19-11-14(3)25-21(20(19)23(27)29)32-17-5-4-6-18(12-17)33(30,31)26-16-9-7-15(24)8-10-16/h4-13,26H,1-3H3 OZBFVTHSHFZADO-UHFFFAOYSA-N 50445488 CHEMBL3104884 Glucose-dependent insulinotropic receptor Homo sapiens 238 ChEMBL 10.1016/j.bmcl.2013.11.053 10.7270/Q2J104N3 24332491 Yu, M; Ken Zhang, J; Wang, Y; Zhu, J; Kayser, F; Medina, JC; Siegler, K; Conn, M; Shan, B; Grillo, MP; Coward, P; Jim Liu, J 12/27/2013 7/25/2014 Amgen http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50445488 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7731&target=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50445488&enzyme=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search 72945897 194943384 CHEMBL3104884 1 MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISGLLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGFVAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLLFVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTPFLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKVLTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG 8VHF,7XZ6,7XZ5,9L80,9L79,8ZRK,8ZR5 Glucose-dependent insulinotropic receptor GP119_HUMAN Q8TDV5 Q495H7 Q4VBN3 51088214 CC(C)N1C(=O)c2cc(C)nc(Nc3ccc(C)c(NS(=O)(=O)c4ccc(Cl)cc4)c3)c2C1=O InChI=1S/C24H23ClN4O4S/c1-13(2)29-23(30)19-11-15(4)26-22(21(19)24(29)31)27-17-8-5-14(3)20(12-17)28-34(32,33)18-9-6-16(25)7-10-18/h5-13,28H,1-4H3,(H,26,27) WYIYDGLQROPKKZ-UHFFFAOYSA-N 50445489 CHEMBL3104885 Glucose-dependent insulinotropic receptor Homo sapiens 382 ChEMBL 10.1016/j.bmcl.2013.11.053 10.7270/Q2J104N3 24332491 Yu, M; Ken Zhang, J; Wang, Y; Zhu, J; Kayser, F; Medina, JC; Siegler, K; Conn, M; Shan, B; Grillo, MP; Coward, P; Jim Liu, J 12/27/2013 7/25/2014 Amgen http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50445489 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7731&target=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50445489&enzyme=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search 72945896 194943385 CHEMBL3104885 1 MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISGLLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGFVAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLLFVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTPFLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKVLTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG 8VHF,7XZ6,7XZ5,9L80,9L79,8ZRK,8ZR5 Glucose-dependent insulinotropic receptor GP119_HUMAN Q8TDV5 Q495H7 Q4VBN3 51088215 CC(C)N1C(=O)c2cc(C)nc(Sc3ccc(C)c(NS(=O)(=O)c4ccc(Cl)cc4)c3)c2C1=O InChI=1S/C24H22ClN3O4S2/c1-13(2)28-23(29)19-11-15(4)26-22(21(19)24(28)30)33-17-8-5-14(3)20(12-17)27-34(31,32)18-9-6-16(25)7-10-18/h5-13,27H,1-4H3 LJBOULIACRCCKK-UHFFFAOYSA-N 50445490 CHEMBL3104886 Glucose-dependent insulinotropic receptor Homo sapiens 224 ChEMBL 10.1016/j.bmcl.2013.11.053 10.7270/Q2J104N3 24332491 Yu, M; Ken Zhang, J; Wang, Y; Zhu, J; Kayser, F; Medina, JC; Siegler, K; Conn, M; Shan, B; Grillo, MP; Coward, P; Jim Liu, J 12/27/2013 7/25/2014 Amgen http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50445490 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7731&target=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50445490&enzyme=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search 72945895 194943386 CHEMBL3104886 1 MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISGLLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGFVAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLLFVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTPFLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKVLTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG 8VHF,7XZ6,7XZ5,9L80,9L79,8ZRK,8ZR5 Glucose-dependent insulinotropic receptor GP119_HUMAN Q8TDV5 Q495H7 Q4VBN3 51088216 CC(C)N1C(=O)c2cc(C)nc(Sc3cccc(NS(=O)(=O)c4ccc(Cl)cc4)c3)c2C1=O InChI=1S/C23H20ClN3O4S2/c1-13(2)27-22(28)19-11-14(3)25-21(20(19)23(27)29)32-17-6-4-5-16(12-17)26-33(30,31)18-9-7-15(24)8-10-18/h4-13,26H,1-3H3 RIZKCWAKTJGVKW-UHFFFAOYSA-N 50445491 CHEMBL3104896 Glucose-dependent insulinotropic receptor Homo sapiens 19 ChEMBL 10.1016/j.bmcl.2013.11.053 10.7270/Q2J104N3 24332491 Yu, M; Ken Zhang, J; Wang, Y; Zhu, J; Kayser, F; Medina, JC; Siegler, K; Conn, M; Shan, B; Grillo, MP; Coward, P; Jim Liu, J 12/27/2013 7/25/2014 Amgen http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50445491 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7731&target=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50445491&enzyme=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search 72945711 194943387 CHEMBL3104896 1 MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISGLLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGFVAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLLFVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTPFLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKVLTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG 8VHF,7XZ6,7XZ5,9L80,9L79,8ZRK,8ZR5 Glucose-dependent insulinotropic receptor GP119_HUMAN Q8TDV5 Q495H7 Q4VBN3 51088217 Cc1cc2C(=O)N(C(=O)c2c(Oc2cccc(NS(=O)(=O)c3ccc(Cl)cc3)c2)n1)c1ccccc1 InChI=1S/C26H18ClN3O5S/c1-16-14-22-23(26(32)30(25(22)31)19-7-3-2-4-8-19)24(28-16)35-20-9-5-6-18(15-20)29-36(33,34)21-12-10-17(27)11-13-21/h2-15,29H,1H3 PAZIYVLFJMEHAP-UHFFFAOYSA-N 50445492 CHEMBL3104895 Glucose-dependent insulinotropic receptor Homo sapiens 299 ChEMBL 10.1016/j.bmcl.2013.11.053 10.7270/Q2J104N3 24332491 Yu, M; Ken Zhang, J; Wang, Y; Zhu, J; Kayser, F; Medina, JC; Siegler, K; Conn, M; Shan, B; Grillo, MP; Coward, P; Jim Liu, J 12/27/2013 7/25/2014 Amgen http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50445492 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7731&target=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50445492&enzyme=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search 72945710 194943388 CHEMBL3104895 1 MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISGLLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGFVAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLLFVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTPFLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKVLTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG 8VHF,7XZ6,7XZ5,9L80,9L79,8ZRK,8ZR5 Glucose-dependent insulinotropic receptor GP119_HUMAN Q8TDV5 Q495H7 Q4VBN3 51088218 Cc1cc2C(=O)N(C3CCCC3)C(=O)c2c(Oc2cccc(NS(=O)(=O)c3ccc(Cl)cc3)c2)n1 InChI=1S/C25H22ClN3O5S/c1-15-13-21-22(25(31)29(24(21)30)18-6-2-3-7-18)23(27-15)34-19-8-4-5-17(14-19)28-35(32,33)20-11-9-16(26)10-12-20/h4-5,8-14,18,28H,2-3,6-7H2,1H3 VAUXCDKWINZQLS-UHFFFAOYSA-N 50445493 CHEMBL3104894 Glucose-dependent insulinotropic receptor Homo sapiens 69 ChEMBL 10.1016/j.bmcl.2013.11.053 10.7270/Q2J104N3 24332491 Yu, M; Ken Zhang, J; Wang, Y; Zhu, J; Kayser, F; Medina, JC; Siegler, K; Conn, M; Shan, B; Grillo, MP; Coward, P; Jim Liu, J 12/27/2013 7/25/2014 Amgen http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50445493 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7731&target=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50445493&enzyme=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search 72945709 194943389 CHEMBL3104894 1 MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISGLLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGFVAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLLFVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTPFLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKVLTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG 8VHF,7XZ6,7XZ5,9L80,9L79,8ZRK,8ZR5 Glucose-dependent insulinotropic receptor GP119_HUMAN Q8TDV5 Q495H7 Q4VBN3 51088219 CC(C)N1C(=O)c2cc(C)nc(Oc3cccc(NS(=O)(=O)c4ccc(Cl)cc4)c3)c2C1=O InChI=1S/C23H20ClN3O5S/c1-13(2)27-22(28)19-11-14(3)25-21(20(19)23(27)29)32-17-6-4-5-16(12-17)26-33(30,31)18-9-7-15(24)8-10-18/h4-13,26H,1-3H3 HQYISXOLZSBYHR-UHFFFAOYSA-N 50445494 CHEMBL3104893 Glucose-dependent insulinotropic receptor Homo sapiens 13 ChEMBL 10.1016/j.bmcl.2013.11.053 10.7270/Q2J104N3 24332491 Yu, M; Ken Zhang, J; Wang, Y; Zhu, J; Kayser, F; Medina, JC; Siegler, K; Conn, M; Shan, B; Grillo, MP; Coward, P; Jim Liu, J 12/27/2013 7/25/2014 Amgen http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50445494 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7731&target=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50445494&enzyme=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search 72945708 194943390 CHEMBL3104893 1 MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISGLLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGFVAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLLFVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTPFLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKVLTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG 8VHF,7XZ6,7XZ5,9L80,9L79,8ZRK,8ZR5 Glucose-dependent insulinotropic receptor GP119_HUMAN Q8TDV5 Q495H7 Q4VBN3 51088220 CCN1C(=O)c2cc(C)nc(Oc3cccc(NS(=O)(=O)c4ccc(Cl)cc4)c3)c2C1=O InChI=1S/C22H18ClN3O5S/c1-3-26-21(27)18-11-13(2)24-20(19(18)22(26)28)31-16-6-4-5-15(12-16)25-32(29,30)17-9-7-14(23)8-10-17/h4-12,25H,3H2,1-2H3 DTOXZAUVNHRCQB-UHFFFAOYSA-N 50445495 CHEMBL3104892 Glucose-dependent insulinotropic receptor Homo sapiens 11 ChEMBL 10.1016/j.bmcl.2013.11.053 10.7270/Q2J104N3 24332491 Yu, M; Ken Zhang, J; Wang, Y; Zhu, J; Kayser, F; Medina, JC; Siegler, K; Conn, M; Shan, B; Grillo, MP; Coward, P; Jim Liu, J 12/27/2013 7/25/2014 Amgen http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50445495 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7731&target=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50445495&enzyme=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search 72945707 194943391 CHEMBL3104892 1 MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISGLLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGFVAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLLFVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTPFLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKVLTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG 8VHF,7XZ6,7XZ5,9L80,9L79,8ZRK,8ZR5 Glucose-dependent insulinotropic receptor GP119_HUMAN Q8TDV5 Q495H7 Q4VBN3 51088221 CN1C(=O)c2cc(C)nc(Oc3cccc(NS(=O)(=O)c4ccc(Cl)cc4)c3)c2C1=O InChI=1S/C21H16ClN3O5S/c1-12-10-17-18(21(27)25(2)20(17)26)19(23-12)30-15-5-3-4-14(11-15)24-31(28,29)16-8-6-13(22)7-9-16/h3-11,24H,1-2H3 BUOGRCHUCDFTJK-UHFFFAOYSA-N 50445496 CHEMBL3104891 Glucose-dependent insulinotropic receptor Homo sapiens 23 ChEMBL 10.1016/j.bmcl.2013.11.053 10.7270/Q2J104N3 24332491 Yu, M; Ken Zhang, J; Wang, Y; Zhu, J; Kayser, F; Medina, JC; Siegler, K; Conn, M; Shan, B; Grillo, MP; Coward, P; Jim Liu, J 12/27/2013 7/25/2014 Amgen http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50445496 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7731&target=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50445496&enzyme=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search 72945706 194943392 CHEMBL3104891 1 MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISGLLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGFVAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLLFVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTPFLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKVLTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG 8VHF,7XZ6,7XZ5,9L80,9L79,8ZRK,8ZR5 Glucose-dependent insulinotropic receptor GP119_HUMAN Q8TDV5 Q495H7 Q4VBN3 51088222 Cc1cc2C(=O)NC(=O)c2c(Oc2cccc(NS(=O)(=O)c3ccc(Cl)cc3)c2)n1 InChI=1S/C20H14ClN3O5S/c1-11-9-16-17(19(26)23-18(16)25)20(22-11)29-14-4-2-3-13(10-14)24-30(27,28)15-7-5-12(21)6-8-15/h2-10,24H,1H3,(H,23,25,26) FCMVBJKEDNUDAH-UHFFFAOYSA-N 50445497 CHEMBL3104890 Glucose-dependent insulinotropic receptor Homo sapiens 121 ChEMBL 10.1016/j.bmcl.2013.11.053 10.7270/Q2J104N3 24332491 Yu, M; Ken Zhang, J; Wang, Y; Zhu, J; Kayser, F; Medina, JC; Siegler, K; Conn, M; Shan, B; Grillo, MP; Coward, P; Jim Liu, J 12/27/2013 7/25/2014 Amgen http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50445497 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7731&target=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50445497&enzyme=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search 72945519 194943393 CHEMBL3104890 1 MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISGLLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGFVAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLLFVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTPFLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKVLTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG 8VHF,7XZ6,7XZ5,9L80,9L79,8ZRK,8ZR5 Glucose-dependent insulinotropic receptor GP119_HUMAN Q8TDV5 Q495H7 Q4VBN3 51088223 Cc1cc2C(=O)N(C3CC3)C(=O)c2c(Oc2cccc(NS(=O)(=O)c3ccc(Cl)cc3)c2)n1 InChI=1S/C23H18ClN3O5S/c1-13-11-19-20(23(29)27(22(19)28)16-7-8-16)21(25-13)32-17-4-2-3-15(12-17)26-33(30,31)18-9-5-14(24)6-10-18/h2-6,9-12,16,26H,7-8H2,1H3 BCLHNZKRVLWHLN-UHFFFAOYSA-N 50445498 CHEMBL3104889 Glucose-dependent insulinotropic receptor Homo sapiens 15 ChEMBL 10.1016/j.bmcl.2013.11.053 10.7270/Q2J104N3 24332491 Yu, M; Ken Zhang, J; Wang, Y; Zhu, J; Kayser, F; Medina, JC; Siegler, K; Conn, M; Shan, B; Grillo, MP; Coward, P; Jim Liu, J 12/27/2013 7/25/2014 Amgen http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50445498 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7731&target=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50445498&enzyme=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search 72945518 194943394 CHEMBL3104889 1 MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISGLLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGFVAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLLFVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTPFLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKVLTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG 8VHF,7XZ6,7XZ5,9L80,9L79,8ZRK,8ZR5 Glucose-dependent insulinotropic receptor GP119_HUMAN Q8TDV5 Q495H7 Q4VBN3 51088224 COc1cc2C(=O)N(C3CC3)C(=O)c2c(Oc2cccc(NS(=O)(=O)c3ccc(Cl)cc3)c2)n1 InChI=1S/C23H18ClN3O6S/c1-32-19-12-18-20(23(29)27(22(18)28)15-7-8-15)21(25-19)33-16-4-2-3-14(11-16)26-34(30,31)17-9-5-13(24)6-10-17/h2-6,9-12,15,26H,7-8H2,1H3 IWXMVQQXVUSRLF-UHFFFAOYSA-N 50445499 CHEMBL3104888 Glucose-dependent insulinotropic receptor Homo sapiens 19 ChEMBL 10.1016/j.bmcl.2013.11.053 10.7270/Q2J104N3 24332491 Yu, M; Ken Zhang, J; Wang, Y; Zhu, J; Kayser, F; Medina, JC; Siegler, K; Conn, M; Shan, B; Grillo, MP; Coward, P; Jim Liu, J 12/27/2013 7/25/2014 Amgen http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50445499 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7731&target=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50445499&enzyme=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search 72945517 194943395 CHEMBL3104888 1 MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISGLLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGFVAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLLFVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTPFLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKVLTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG 8VHF,7XZ6,7XZ5,9L80,9L79,8ZRK,8ZR5 Glucose-dependent insulinotropic receptor GP119_HUMAN Q8TDV5 Q495H7 Q4VBN3 51088225 Clc1ccc(cc1)S(=O)(=O)Nc1cccc(Oc2nc(cc3C(=O)N(C4CC4)C(=O)c23)C2CC2)c1 InChI=1S/C25H20ClN3O5S/c26-15-6-10-19(11-7-15)35(32,33)28-16-2-1-3-18(12-16)34-23-22-20(13-21(27-23)14-4-5-14)24(30)29(25(22)31)17-8-9-17/h1-3,6-7,10-14,17,28H,4-5,8-9H2 CNSGCFMMOZXTLD-UHFFFAOYSA-N 50445500 CHEMBL3104887 Glucose-dependent insulinotropic receptor Homo sapiens 45 ChEMBL 10.1016/j.bmcl.2013.11.053 10.7270/Q2J104N3 24332491 Yu, M; Ken Zhang, J; Wang, Y; Zhu, J; Kayser, F; Medina, JC; Siegler, K; Conn, M; Shan, B; Grillo, MP; Coward, P; Jim Liu, J 12/27/2013 7/25/2014 Amgen http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50445500 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7731&target=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50445500&enzyme=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search 71713968 194943396 CHEMBL3104887 1 MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISGLLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGFVAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLLFVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTPFLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKVLTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG 8VHF,7XZ6,7XZ5,9L80,9L79,8ZRK,8ZR5 Glucose-dependent insulinotropic receptor GP119_HUMAN Q8TDV5 Q495H7 Q4VBN3 51088226 CC(C)OC(=O)N1CCC(CC1)Oc1ncnc2n(ncc12)-c1ccc(cc1)S(C)(=O)=O InChI=1S/C21H25N5O5S/c1-14(2)30-21(27)25-10-8-16(9-11-25)31-20-18-12-24-26(19(18)22-13-23-20)15-4-6-17(7-5-15)32(3,28)29/h4-7,12-14,16H,8-11H2,1-3H3 WMCWRFZUFUHFRB-UHFFFAOYSA-N 50343449 isopropyl 4-(1-(4-(methylsulfonyl)phenyl)-1H-pyrazolo[3,4-d]pyrimidin-4-yloxy)piperidine-1-carboxylate::CHEMBL1775171 Glucose-dependent insulinotropic receptor Homo sapiens 41 ChEMBL 10.1016/j.bmcl.2013.11.053 10.7270/Q2J104N3 24332491 Yu, M; Ken Zhang, J; Wang, Y; Zhu, J; Kayser, F; Medina, JC; Siegler, K; Conn, M; Shan, B; Grillo, MP; Coward, P; Jim Liu, J 12/27/2013 7/25/2014 Amgen http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50343449 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7731&target=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50343449&enzyme=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search 11224944 131346385 CHEMBL1775171 1 MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISGLLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGFVAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLLFVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTPFLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKVLTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG 8VHF,7XZ6,7XZ5,9L80,9L79,8ZRK,8ZR5 Glucose-dependent insulinotropic receptor GP119_HUMAN Q8TDV5 Q495H7 Q4VBN3 51088227 CC(C)N1C(=O)c2cc(C)nc(Oc3cc(NS(=O)(=O)c4ccc(Cl)cc4)ccc3F)c2C1=O InChI=1S/C23H19ClFN3O5S/c1-12(2)28-22(29)17-10-13(3)26-21(20(17)23(28)30)33-19-11-15(6-9-18(19)25)27-34(31,32)16-7-4-14(24)5-8-16/h4-12,27H,1-3H3 ZMXPRLZLGHHSKI-UHFFFAOYSA-N 50445481 CHEMBL3104879 Glucose-dependent insulinotropic receptor Rattus norvegicus 2050 ChEMBL 10.1016/j.bmcl.2013.11.053 10.7270/Q2J104N3 24332491 Yu, M; Ken Zhang, J; Wang, Y; Zhu, J; Kayser, F; Medina, JC; Siegler, K; Conn, M; Shan, B; Grillo, MP; Coward, P; Jim Liu, J 12/27/2013 7/25/2014 Amgen http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50445481 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003872&target=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50445481&enzyme=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search 72946092 194943377 CHEMBL3104879 1 MESSFSFGVILAVLTILIIAVNALVVVAMLLSIYKNDGVGLCFTLNLAVADTLIGVAISGLVTDQLSSSAQHTQKTLCSLRMAFVTSSAAASVLTVMLIAFDRYLAIKQPLRYFQIMNGLVAGGCIAGLWLISYLIGFLPLGVSIFQQTTYHGPCTFFAVFHPRFVLTLSCAGFFPAVLLFVFFYCDMLKIASVHSQHIRKMEHAGAMVGACRPPRPVNDFKAVRTVSVLIGSFTLSWSPFLITSIVQVACHKCCLYQVLEKYLWLLGVGNSLLNPLIYAYWQREVRQQLCHMALGLLADGSTQPQIETLKGKEERKKVGRKTLYTCDAQTLYTCDAQTLYTCDAQTLYTCDACDTQTLYTCDAQTLYTCDAQTLYTCDAQTLYTCDAQTLYTCDAQTLYTCDTQTLYTCDAQTLYTCDAQTLYTCDAQTLYTCDAQTLYTSSLVTGQTEQTPLKRANMSDPLRTCRG Glucose-dependent insulinotropic receptor GP119_RAT Q7TQN8 51088228 CC(C)N1C(=O)c2cc(C)nc(Oc3cc(NS(=O)(=O)c4ccc(Cl)cc4)ccc3F)c2C1=O InChI=1S/C23H19ClFN3O5S/c1-12(2)28-22(29)17-10-13(3)26-21(20(17)23(28)30)33-19-11-15(6-9-18(19)25)27-34(31,32)16-7-4-14(24)5-8-16/h4-12,27H,1-3H3 ZMXPRLZLGHHSKI-UHFFFAOYSA-N 50445481 CHEMBL3104879 Glucose-dependent insulinotropic receptor Mus musculus 1900 ChEMBL 10.1016/j.bmcl.2013.11.053 10.7270/Q2J104N3 24332491 Yu, M; Ken Zhang, J; Wang, Y; Zhu, J; Kayser, F; Medina, JC; Siegler, K; Conn, M; Shan, B; Grillo, MP; Coward, P; Jim Liu, J 12/27/2013 7/25/2014 Amgen http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50445481 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003873&target=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50445481&enzyme=Glucose-dependent+insulinotropic+receptor&column=ki&startPg=0&Increment=50&submit=Search 72946092 194943377 CHEMBL3104879 1 MESSFSFGVILAVLTILIIAVNALVVVAMLLSIYKNDGVGLCFTLNLAVADTLIGVAISGLVTDQLSSSAQHTQKTLCSLRMAFVTSSAAASVLTVMLIAFDRYLAIKQPLRYFQIMNGLVAGACIAGLWLVSYLIGFLPLGVSIFQQTTYHGPCSFFAVFHPRFVLTLSCAGFFPAVLLFVFFYCDMLKIASVHSQQIRKMEHAGAMAGAYRPPRSVNDFKAVRTIAVLIGSFTLSWSPFLITSIVQVACHKCCLYQVLEKYLWLLGVGNSLLNPLIYAYWQREVRQQLYHMALGVKKFFTSILLLLPARNRGPERTRESAYHIVTISHPELDG Glucose-dependent insulinotropic receptor GP119_MOUSE Q7TQP3 Q2ABS2