BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 227561 ONC(=O)c1ccc2N(Cc3ccc(F)cc3F)CCc2c1 InChI=1S/C16H14F2N2O2/c17-13-3-1-12(14(18)8-13)9-20-6-5-10-7-11(16(21)19-22)2-4-15(10)20/h1-4,7-8,22H,5-6,9H2,(H,19,21) LAVGMJAFBZCYID-UHFFFAOYSA-N 107680 1-[(2,4-difluorophenyl)methyl]-N-hydroxy-2,3- dihydroindole-5-carboxamide (Compound 1) Gag-Pol polyprotein [1148-1435] Human immunodeficiency virus 1 8.4e+4 Curated from the literature by BindingDB 10.1111/cbdd.12207 10.7270/Q2QR4VSW 23957390 aid1800190 Bhatt, H; Patel, P; Pannecouque, C 2/28/2014 4/17/2014 Nirma University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=107680 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2393&target=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=107680&enzyme=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search 74763018 186524550 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED 8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 227562 OC(=O)C(=O)CC(=O)c1cc(OCc2ccccc2)cc(OCc2ccccc2)c1 InChI=1S/C24H20O6/c25-22(14-23(26)24(27)28)19-11-20(29-15-17-7-3-1-4-8-17)13-21(12-19)30-16-18-9-5-2-6-10-18/h1-13H,14-16H2,(H,27,28) SLRLQBRWUMWEOZ-UHFFFAOYSA-N 107681 CHEMBL320261::CHEMBL19977::(2Z)-4-[3,5-bis(benzyloxy)phenyl]-2-hydroxy-4- oxobut-2-enoic acid (Compound 2) Gag-Pol polyprotein [1148-1435] Human immunodeficiency virus 1 59 Curated from the literature by BindingDB 10.1111/cbdd.12207 10.7270/Q2QR4VSW 23957390 aid1800190 Bhatt, H; Patel, P; Pannecouque, C 2/28/2014 4/17/2014 Nirma University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=107681 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2393&target=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=107681&enzyme=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search 475514 186524551 CHEMBL19977CHEMBL320261 C00972 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED 8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 227563 ON1C(=O)C(C2CCCCC2)c2ccccc2C1=O InChI=1S/C15H17NO3/c17-14-12-9-5-4-8-11(12)13(15(18)16(14)19)10-6-2-1-3-7-10/h4-5,8-10,13,19H,1-3,6-7H2 XGMHPGVWKILKBF-UHFFFAOYSA-N 107682 4-cyclohexyl-2-hydroxy-4H-isoquinoline-1,3-dione (Compound 3) Gag-Pol polyprotein [1148-1435] Human immunodeficiency virus 1 1.35e+3 Curated from the literature by BindingDB 10.1111/cbdd.12207 10.7270/Q2QR4VSW 23957390 aid1800190 Bhatt, H; Patel, P; Pannecouque, C 2/28/2014 4/17/2014 Nirma University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=107682 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2393&target=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=107682&enzyme=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search 74982303 186524552 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED 8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 227564 Oc1ccccc1CNNC(=O)c1ccccc1O InChI=1S/C14H14N2O3/c17-12-7-3-1-5-10(12)9-15-16-14(19)11-6-2-4-8-13(11)18/h1-8,15,17-18H,9H2,(H,16,19) SJSJXRMQLWUZCN-UHFFFAOYSA-N 50056898 2-hydroxy-N'-[(2- hydroxyphenyl)methyl]benzohydrazide (Compound 4)::CHEMBL433983::2-Hydroxy-benzoic acid N'-(2-hydroxy-benzyl)-hydrazide Gag-Pol polyprotein [1148-1435] Human immunodeficiency virus 1 7e+2 Curated from the literature by BindingDB 10.1111/cbdd.12207 10.7270/Q2QR4VSW 23957390 aid1800190 Bhatt, H; Patel, P; Pannecouque, C 2/28/2014 4/17/2014 Nirma University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50056898 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2393&target=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50056898&enzyme=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search 392123 103953028 CHEMBL433983 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED 8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 227565 COC(=O)c1ccc(CC(=O)c2cc(C=O)c(O)cc2C)c(C)c1O InChI=1S/C19H18O6/c1-10-6-16(21)13(9-20)7-15(10)17(22)8-12-4-5-14(19(24)25-3)18(23)11(12)2/h4-7,9,21,23H,8H2,1-3H3 HTHBZKQZPAHXGQ-UHFFFAOYSA-N 107683 methyl 4-[2-(5-formyl-4-hydroxy-2-methylphenyl)-2- oxoethyl]-2-hydroxy-3-methylbenzoate (Compound 5) Gag-Pol polyprotein [1148-1435] Human immunodeficiency virus 1 1.23e+5 Curated from the literature by BindingDB 10.1111/cbdd.12207 10.7270/Q2QR4VSW 23957390 aid1800190 Bhatt, H; Patel, P; Pannecouque, C 2/28/2014 4/17/2014 Nirma University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=107683 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2393&target=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=107683&enzyme=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search 74982304 186524553 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED 8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 227566 Cn1c2ccc(cc2c(O)c(C(O)=O)c1=O)-c1ccc(F)cc1 InChI=1S/C17H12FNO4/c1-19-13-7-4-10(9-2-5-11(18)6-3-9)8-12(13)15(20)14(16(19)21)17(22)23/h2-8,20H,1H3,(H,22,23) JIBUEOQOCLHBTJ-UHFFFAOYSA-N 107684 6-(4-fluorophenyl)-4-hydroxy-1-methyl-2- oxoquinoline-3-carboxylic acid (Compound 6) Gag-Pol polyprotein [1148-1435] Human immunodeficiency virus 1 2.3e+4 Curated from the literature by BindingDB 10.1111/cbdd.12207 10.7270/Q2QR4VSW 23957390 aid1800190 Bhatt, H; Patel, P; Pannecouque, C 2/28/2014 4/17/2014 Nirma University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=107684 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2393&target=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=107684&enzyme=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search 74982305 186524554 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED 8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 227567 Oc1c(ccc2cccnc12)C(=O)c1cccc(Cc2ccccc2)c1 InChI=1S/C23H17NO2/c25-22(20-12-11-18-10-5-13-24-21(18)23(20)26)19-9-4-8-17(15-19)14-16-6-2-1-3-7-16/h1-13,15,26H,14H2 HISIYDZZYZHWFN-UHFFFAOYSA-N 50123470 CHEMBL35842::7-(3-benzylbenzoyl)quinolin-8-ol (Compound 7)::(3-benzylphenyl)(8-hydroxyquinolin-7-yl)methanone::(3-Benzyl-phenyl)-(8-hydroxy-quinolin-7-yl)-methanone Gag-Pol polyprotein [1148-1435] Human immunodeficiency virus 1 3.7e+2 Curated from the literature by BindingDB 10.1111/cbdd.12207 10.7270/Q2QR4VSW 23957390 aid1800190 Bhatt, H; Patel, P; Pannecouque, C 2/28/2014 4/17/2014 Nirma University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50123470 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2393&target=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50123470&enzyme=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search 463001 104015963 CHEMBL35842 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED 8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 227568 COc1cc2SC(=O)C3CSCN3C(=O)c2cc1OC InChI=1S/C13H13NO4S2/c1-17-9-3-7-11(4-10(9)18-2)20-13(16)8-5-19-6-14(8)12(7)15/h3-4,8H,5-6H2,1-2H3 WEVKCUPTYBGFTJ-UHFFFAOYSA-N 50079923 12,13-dimethoxy-5,9-dithia-3- azatricyclo[8.4.0.0 ,⁷]tetradeca-1(14),10,12- triene-2,8-dione (Compound 8)::CHEMBL284144::6,7-Dimethoxy-1,10a-dihydro-2,9-dithia-3a-aza-benzo[f]azulene-4,10-dione Gag-Pol polyprotein [1148-1435] Human immunodeficiency virus 1 3.31e+5 Curated from the literature by BindingDB 10.1111/cbdd.12207 10.7270/Q2QR4VSW 23957390 aid1800190 Bhatt, H; Patel, P; Pannecouque, C 2/28/2014 4/17/2014 Nirma University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50079923 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2393&target=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50079923&enzyme=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search 395787 103972037 CHEMBL284144 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED 8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 227569 OC(=O)C(=O)CC(=O)c1cn(Cc2ccc(F)cc2)c2ccc(F)cc2c1=O InChI=1S/C20H13F2NO5/c21-12-3-1-11(2-4-12)9-23-10-15(17(24)8-18(25)20(27)28)19(26)14-7-13(22)5-6-16(14)23/h1-7,10H,8-9H2,(H,27,28) NOYQYUMZPMUAQK-UHFFFAOYSA-N 107685 (2Z)-4-{6-fluoro-1-[(4-fluorophenyl)methyl]-4- oxoquinolin-3-yl}-2-hydroxy-4-oxobut-2-enoic acid (Compound 9) Gag-Pol polyprotein [1148-1435] Human immunodeficiency virus 1 2.3e+3 Curated from the literature by BindingDB 10.1111/cbdd.12207 10.7270/Q2QR4VSW 23957390 aid1800190 Bhatt, H; Patel, P; Pannecouque, C 2/28/2014 4/17/2014 Nirma University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=107685 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2393&target=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=107685&enzyme=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search 68446170 186524555 C00972 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED 8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 227570 Oc1c(O)c2ccccc2c(O)c1C=C1C(=O)C(=O)c2ccccc2C1=O |w:13.14| InChI=1S/C21H12O6/c22-16-10-5-1-3-7-12(10)18(24)20(26)14(16)9-15-17(23)11-6-2-4-8-13(11)19(25)21(15)27/h1-9,22,24,26H KBWGHNBKIWONDS-UHFFFAOYSA-N 107686 2-hydroxy-3-[(3-hydroxy-1,4-dioxonaphthalen-2- yl)methyl]naphthalene-1,4-dione (Compound 10) Gag-Pol polyprotein [1148-1435] Human immunodeficiency virus 1 2.0e+4 Curated from the literature by BindingDB 10.1111/cbdd.12207 10.7270/Q2QR4VSW 23957390 aid1800190 Bhatt, H; Patel, P; Pannecouque, C 2/28/2014 4/17/2014 Nirma University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=107686 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2393&target=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=107686&enzyme=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search 91899672 186524556 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED 8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 227571 Oc1cccc(\C=C2\C=NN(C(=O)c3ccccc3O)C2=O)c1 |c:8| InChI=1S/C17H12N2O4/c20-13-5-3-4-11(9-13)8-12-10-18-19(16(12)22)17(23)14-6-1-2-7-15(14)21/h1-10,20-21H BIUMRDHYCWGNLD-UHFFFAOYSA-N 107687 (4Z)-2-(2-hydroxybenzoyl)-4-[(3- hydroxyphenyl)methylidene]pyrazol-3-one (Compound 11) Gag-Pol polyprotein [1148-1435] Human immunodeficiency virus 1 7.4e+3 Curated from the literature by BindingDB 10.1111/cbdd.12207 10.7270/Q2QR4VSW 23957390 aid1800190 Bhatt, H; Patel, P; Pannecouque, C 2/28/2014 4/17/2014 Nirma University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=107687 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2393&target=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=107687&enzyme=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search 74982306 186524557 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED 8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 227572 Oc1c(nc([nH]c1=O)-c1cccs1)C(=O)NCc1cc2ccccc2s1 InChI=1S/C18H13N3O3S2/c22-15-14(20-16(21-18(15)24)13-6-3-7-25-13)17(23)19-9-11-8-10-4-1-2-5-12(10)26-11/h1-8,22H,9H2,(H,19,23)(H,20,21,24) FYXXIVCLXLOWRN-UHFFFAOYSA-N 107688 N-(1-benzothiophen-2-ylmethyl)-5,6-dihydroxy-2- (thiophen-2-yl)pyrimidine-4-carboxamide (Compound 12) Gag-Pol polyprotein [1148-1435] Human immunodeficiency virus 1 1e+1 Curated from the literature by BindingDB 10.1111/cbdd.12207 10.7270/Q2QR4VSW 23957390 aid1800190 Bhatt, H; Patel, P; Pannecouque, C 2/28/2014 4/17/2014 Nirma University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=107688 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2393&target=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=107688&enzyme=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search 54714796 186524558 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED 8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 227573 Oc1c(C2c3ccccc3Oc3c2c(=O)oc2ccccc32)c(=O)oc2ccccc12 InChI=1S/C25H14O6/c26-22-14-8-2-5-11-17(14)30-24(27)20(22)19-13-7-1-4-10-16(13)29-23-15-9-3-6-12-18(15)31-25(28)21(19)23/h1-12,19,26H OALUGYLIPAUKCN-UHFFFAOYSA-N 50055689 CHEMBL32926::12-(4-hydroxy-2-oxochromen-3-yl)-12H-5,10- dioxatetraphen-11-one (Compound 13)::7-(4-Hydroxy-2-oxo-2H-chromen-3-yl)-7H-chromeno[4,3-b]chromen-6-one Gag-Pol polyprotein [1148-1435] Human immunodeficiency virus 1 1.22e+5 Curated from the literature by BindingDB 10.1111/cbdd.12207 10.7270/Q2QR4VSW 23957390 aid1800190 Bhatt, H; Patel, P; Pannecouque, C 2/28/2014 4/17/2014 Nirma University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50055689 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2393&target=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50055689&enzyme=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search 54692153 103952171 CHEMBL32926 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED 8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 227574 Oc1c(nc([nH]c1=O)-c1cccs1)C(=O)NCc1ccc(Cl)c(Cl)c1 InChI=1S/C16H11Cl2N3O3S/c17-9-4-3-8(6-10(9)18)7-19-15(23)12-13(22)16(24)21-14(20-12)11-2-1-5-25-11/h1-6,22H,7H2,(H,19,23)(H,20,21,24) YLSDEWQNSIAMQO-UHFFFAOYSA-N 107689 N-[(3,4-dichlorophenyl)methyl]-5,6-dihydroxy-2- (thiophen-2-yl)pyrimidine-4-carboxamide (Compound 14) Gag-Pol polyprotein [1148-1435] Human immunodeficiency virus 1 1e+1 Curated from the literature by BindingDB 10.1111/cbdd.12207 10.7270/Q2QR4VSW 23957390 aid1800190 Bhatt, H; Patel, P; Pannecouque, C 2/28/2014 4/17/2014 Nirma University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=107689 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2393&target=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=107689&enzyme=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search 54714887 186524559 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED 8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 227575 OC(CNNCc1ccccc1O)COc1ccccc1 InChI=1S/C16H20N2O3/c19-14(12-21-15-7-2-1-3-8-15)11-18-17-10-13-6-4-5-9-16(13)20/h1-9,14,17-20H,10-12H2 VQXVNZVMRGBRBO-UHFFFAOYSA-N 107690 2-{[2-(2-hydroxy-3-phenoxypropyl)hydrazin-1- yl]methyl}phenol (Compound 15) Gag-Pol polyprotein [1148-1435] Human immunodeficiency virus 1 2.00e+5 Curated from the literature by BindingDB 10.1111/cbdd.12207 10.7270/Q2QR4VSW 23957390 aid1800190 Bhatt, H; Patel, P; Pannecouque, C 2/28/2014 4/17/2014 Nirma University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=107690 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2393&target=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=107690&enzyme=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search 74982308 186524560 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED 8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 227576 Oc1ccc(C=c2c(=C)[nH]n(C(=O)c3ccc(Cl)cc3)c2=O)cc1 |w:5.4| InChI=1S/C18H13ClN2O3/c1-11-16(10-12-2-8-15(22)9-3-12)18(24)21(20-11)17(23)13-4-6-14(19)7-5-13/h2-10,20,22H,1H2 GLKKMTAPUFNFGI-UHFFFAOYSA-N 50066300 CHEMBL441600::(4Z)-2-(4-chlorobenzoyl)-4-[(4- hydroxyphenyl)methylidene]-5-methylpyrazol-3-one (Compound 16)::CHEMBL107777::2-(4-Chloro-benzoyl)-4-[1-(4-hydroxy-phenyl)-meth-(E)-ylidene]-5-methyl-2,4-dihydro-pyrazol-3-one Gag-Pol polyprotein [1148-1435] Human immunodeficiency virus 1 2.93e+5 Curated from the literature by BindingDB 10.1111/cbdd.12207 10.7270/Q2QR4VSW 23957390 aid1800190 Bhatt, H; Patel, P; Pannecouque, C 2/28/2014 4/17/2014 Nirma University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50066300 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2393&target=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50066300&enzyme=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search 91930846 103960954 CHEMBL107777CHEMBL441600 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED 8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 227577 Oc1cccc(C(=O)NNC(=O)c2ccccc2O)c1O InChI=1S/C14H12N2O5/c17-10-6-2-1-4-8(10)13(20)15-16-14(21)9-5-3-7-11(18)12(9)19/h1-7,17-19H,(H,15,20)(H,16,21) DNCBPZLOUZEIIO-UHFFFAOYSA-N 107691 2,3-dihydroxy-N'-(2-hydroxybenzoyl)benzohydrazide (Compound 17) Gag-Pol polyprotein [1148-1435] Human immunodeficiency virus 1 5e+2 Curated from the literature by BindingDB 10.1111/cbdd.12207 10.7270/Q2QR4VSW 23957390 aid1800190 Bhatt, H; Patel, P; Pannecouque, C 2/28/2014 4/17/2014 Nirma University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=107691 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2393&target=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=107691&enzyme=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search 24773968 186524561 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED 8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 227578 COC(=O)c1ccc2cc(CCc3ccc(O)c(O)c3)oc2c1 InChI=1S/C18H16O5/c1-22-18(21)13-5-4-12-9-14(23-17(12)10-13)6-2-11-3-7-15(19)16(20)8-11/h3-5,7-10,19-20H,2,6H2,1H3 HKVLYXQYQNHRAM-UHFFFAOYSA-N 107692 methyl 2-[2-(3,4-dihydroxyphenyl)ethyl]-1- benzofuran-6-carboxylate (Compound 18) Gag-Pol polyprotein [1148-1435] Human immunodeficiency virus 1 4.380e+4 Curated from the literature by BindingDB 10.1111/cbdd.12207 10.7270/Q2QR4VSW 23957390 aid1800190 Bhatt, H; Patel, P; Pannecouque, C 2/28/2014 4/17/2014 Nirma University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=107692 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2393&target=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=107692&enzyme=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search 74982309 186524562 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED 8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 227579 OC(=O)C(=O)CC(=O)c1c[nH]c2ccc(Cl)cc12 InChI=1S/C12H8ClNO4/c13-6-1-2-9-7(3-6)8(5-14-9)10(15)4-11(16)12(17)18/h1-3,5,14H,4H2,(H,17,18) NVTRJKGWECZIQW-UHFFFAOYSA-N 107693 CHEMBL108760::(2Z)-4-(5-chloro-1H-indol-3-yl)-2-hydroxy-4-oxobut-2- enoic acid (Compound 19) Gag-Pol polyprotein [1148-1435] Human immunodeficiency virus 1 5.2e+2 Curated from the literature by BindingDB 10.1111/cbdd.12207 10.7270/Q2QR4VSW 23957390 aid1800190 Bhatt, H; Patel, P; Pannecouque, C 2/28/2014 4/17/2014 Nirma University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=107693 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2393&target=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=107693&enzyme=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search 484784 186524563 CHEMBL108760 C00972 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED 8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5 227580 Oc1c(ccc2cccnc12)C(=O)Nc1ncnc2n(Cc3ccc(F)cc3)cnc12 InChI=1S/C22H15FN6O2/c23-15-6-3-13(4-7-15)10-29-12-27-18-20(25-11-26-21(18)29)28-22(31)16-8-5-14-2-1-9-24-17(14)19(16)30/h1-9,11-12,30H,10H2,(H,25,26,28,31) GJWVTWYMZBPKIQ-UHFFFAOYSA-N 107694 N-{9-[(4-fluorophenyl)methyl]purin-6-yl}-8- hydroxyquinoline-7-carboxamide (Compound 20) Gag-Pol polyprotein [1148-1435] Human immunodeficiency virus 1 1.12e+4 Curated from the literature by BindingDB 10.1111/cbdd.12207 10.7270/Q2QR4VSW 23957390 aid1800190 Bhatt, H; Patel, P; Pannecouque, C 2/28/2014 4/17/2014 Nirma University http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=107694 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2393&target=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=107694&enzyme=Gag-Pol+polyprotein+%5B1148-1435%5D&column=ki&startPg=0&Increment=50&submit=Search 15959232 186524564 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED 8CBV,8CBU,8CBT,8CBS,8CBR,8BUV,8A1Q,8A1P Gag-Pol polyprotein POL_HV1H2 P04585 O09777 Q9WJC5