BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50076452 Cc1ccccc1[C@@H](CC(N=O)c1ccc(=O)n(C)c1)c1ccc(cc1)S(C)(=O)=O |r| InChI=1S/C23H24N2O4S/c1-16-6-4-5-7-20(16)21(17-8-11-19(12-9-17)30(3,28)29)14-22(24-27)18-10-13-23(26)25(2)15-18/h4-13,15,21-22H,14H2,1-3H3 ZLQBDFFAZUFHQT-UHFFFAOYSA-N 50437872 CHEMBL2407935 G-protein coupled bile acid receptor 1 Homo sapiens 1400 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437872 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437872&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898719 175450189 CHEMBL2407935 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50076453 Cc1ccccc1[C@H](CC(N=O)c1ccc(=O)n(C)c1)c1ccc(cc1)S(C)(=O)=O |r| InChI=1S/C23H24N2O4S/c1-16-6-4-5-7-20(16)21(17-8-11-19(12-9-17)30(3,28)29)14-22(24-27)18-10-13-23(26)25(2)15-18/h4-13,15,21-22H,14H2,1-3H3 ZLQBDFFAZUFHQT-UHFFFAOYSA-N 50437873 CHEMBL2407934 G-protein coupled bile acid receptor 1 Homo sapiens 460 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437873 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437873&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898720 175450190 CHEMBL2407934 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50076454 Cc1cc(ccn1)C(C[C@@H](c1ccc(cc1)-c1ccc(cc1)C(O)=O)c1ccccc1C)N=O |r| InChI=1S/C29H26N2O3/c1-19-5-3-4-6-26(19)27(18-28(31-34)25-15-16-30-20(2)17-25)23-11-7-21(8-12-23)22-9-13-24(14-10-22)29(32)33/h3-17,27-28H,18H2,1-2H3,(H,32,33) GEMWXWUPINNETM-UHFFFAOYSA-N 50437878 CHEMBL2407929 G-protein coupled bile acid receptor 1 Homo sapiens 20 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437878 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437878&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898725 175450195 CHEMBL2407929 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50076455 Cc1cc(ccn1)C(C[C@@H](c1ccc(cc1)-c1ccc(cc1)C(O)=O)c1ccccc1C)N=O |r| InChI=1S/C29H26N2O3/c1-19-5-3-4-6-26(19)27(18-28(31-34)25-15-16-30-20(2)17-25)23-11-7-21(8-12-23)22-9-13-24(14-10-22)29(32)33/h3-17,27-28H,18H2,1-2H3,(H,32,33) GEMWXWUPINNETM-UHFFFAOYSA-N 50437878 CHEMBL2407929 G-protein coupled bile acid receptor 1 Homo sapiens 57 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437878 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437878&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898725 175450195 CHEMBL2407929 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50076456 CN(C)c1ccc(cc1)C(CC(N=O)c1ccncc1)c1ccccc1 InChI=1S/C22H23N3O/c1-25(2)20-10-8-18(9-11-20)21(17-6-4-3-5-7-17)16-22(24-26)19-12-14-23-15-13-19/h3-15,21-22H,16H2,1-2H3 GAOIASSLHDSFLE-UHFFFAOYSA-N 50437890 CHEMBL2407938::CHEMBL2407936 G-protein coupled bile acid receptor 1 Homo sapiens 2900 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437890 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437890&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898737 175450207 CHEMBL2407936CHEMBL2407938 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50076457 CN(C)c1ccc(cc1)C(CC(N=O)c1ccncc1)c1ccccc1 InChI=1S/C22H23N3O/c1-25(2)20-10-8-18(9-11-20)21(17-6-4-3-5-7-17)16-22(24-26)19-12-14-23-15-13-19/h3-15,21-22H,16H2,1-2H3 GAOIASSLHDSFLE-UHFFFAOYSA-N 50437890 CHEMBL2407938::CHEMBL2407936 Cytochrome P450 3A4 Homo sapiens <200 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437890 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2127&target=Cytochrome+P450+3A4&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437890&enzyme=Cytochrome+P450+3A4&column=ki&startPg=0&Increment=50&submit=Search 91898737 175450207 CHEMBL2407936CHEMBL2407938 1 MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGTVSGA 7LXL,3NXU,2V0M,2J0D,1W0G,1W0F,1W0E,9GK1,4NY4 Cytochrome P450 3A4 CP3A4_HUMAN P08684 P05184 Q16757 Q9UK50 Cytochrome P450 3A Q6GRK0_HUMAN Q6GRK0 50076458 Cc1cc(ccn1)C(CC(c1ccc(cc1)C(O)=O)c1ccccc1C)N=O InChI=1S/C23H22N2O3/c1-15-5-3-4-6-20(15)21(17-7-9-18(10-8-17)23(26)27)14-22(25-28)19-11-12-24-16(2)13-19/h3-13,21-22H,14H2,1-2H3,(H,26,27) GMZJHGZSQIVJEK-UHFFFAOYSA-N 50437882 CHEMBL2407952 Cytochrome P450 3A4 Homo sapiens >50000 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437882 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2127&target=Cytochrome+P450+3A4&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437882&enzyme=Cytochrome+P450+3A4&column=ki&startPg=0&Increment=50&submit=Search 91898729 175450199 CHEMBL2407952 1 MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGTVSGA 7LXL,3NXU,2V0M,2J0D,1W0G,1W0F,1W0E,9GK1,4NY4 Cytochrome P450 3A4 CP3A4_HUMAN P08684 P05184 Q16757 Q9UK50 Cytochrome P450 3A Q6GRK0_HUMAN Q6GRK0 50076459 Cc1cc(ccn1)C(CC(c1ccc(CC(O)=O)cc1)c1ccccc1C)N=O InChI=1S/C24H24N2O3/c1-16-5-3-4-6-21(16)22(19-9-7-18(8-10-19)14-24(27)28)15-23(26-29)20-11-12-25-17(2)13-20/h3-13,22-23H,14-15H2,1-2H3,(H,27,28) GGSCWSOJUPJACO-UHFFFAOYSA-N 50437881 CHEMBL2407953 Cytochrome P450 3A4 Homo sapiens >50000 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437881 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2127&target=Cytochrome+P450+3A4&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437881&enzyme=Cytochrome+P450+3A4&column=ki&startPg=0&Increment=50&submit=Search 91898728 175450198 CHEMBL2407953 C03768 1 MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGTVSGA 7LXL,3NXU,2V0M,2J0D,1W0G,1W0F,1W0E,9GK1,4NY4 Cytochrome P450 3A4 CP3A4_HUMAN P08684 P05184 Q16757 Q9UK50 Cytochrome P450 3A Q6GRK0_HUMAN Q6GRK0 50076460 Cc1ccccc1[C@@H](CC(N=O)c1ccc(=O)n(C)c1)c1ccc(cc1)-c1ccc(cc1)C(O)=O |r| InChI=1S/C29H26N2O4/c1-19-5-3-4-6-25(19)26(17-27(30-35)24-15-16-28(32)31(2)18-24)22-11-7-20(8-12-22)21-9-13-23(14-10-21)29(33)34/h3-16,18,26-27H,17H2,1-2H3,(H,33,34) ANOSMWHBNFJLHV-UHFFFAOYSA-N 50437874 CHEMBL2407933 G-protein coupled bile acid receptor 1 Homo sapiens 6400 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437874 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437874&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898721 175450191 CHEMBL2407933 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50076461 Cc1ccccc1[C@H](CC(N=O)c1ccc(=O)n(C)c1)c1ccc(cc1)-c1ccc(cc1)C(O)=O |r| InChI=1S/C29H26N2O4/c1-19-5-3-4-6-25(19)26(17-27(30-35)24-15-16-28(32)31(2)18-24)22-11-7-20(8-12-22)21-9-13-23(14-10-21)29(33)34/h3-16,18,26-27H,17H2,1-2H3,(H,33,34) ANOSMWHBNFJLHV-UHFFFAOYSA-N 50437875 CHEMBL2407932 G-protein coupled bile acid receptor 1 Homo sapiens 2000 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437875 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437875&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898722 175450192 CHEMBL2407932 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50076462 CN(C)c1ccc(cc1)C(CC(N=O)c1ccncc1)c1ccccc1C InChI=1S/C23H25N3O/c1-17-6-4-5-7-21(17)22(18-8-10-20(11-9-18)26(2)3)16-23(25-27)19-12-14-24-15-13-19/h4-15,22-23H,16H2,1-3H3 PJPNDEXWHMPNBM-UHFFFAOYSA-N 50437889 CHEMBL2407944 G-protein coupled bile acid receptor 1 Homo sapiens 1040 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437889 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437889&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898736 175450206 CHEMBL2407944 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50076463 Cc1cc(ccn1)C(C[C@@H](c1ccc(cc1)-c1ccc(cc1)C(O)=O)c1ccccc1C)N=O |r| InChI=1S/C29H26N2O3/c1-19-5-3-4-6-26(19)27(18-28(31-34)25-15-16-30-20(2)17-25)23-11-7-21(8-12-23)22-9-13-24(14-10-22)29(32)33/h3-17,27-28H,18H2,1-2H3,(H,32,33) GEMWXWUPINNETM-UHFFFAOYSA-N 50437878 CHEMBL2407929 Cytochrome P450 3A4 Homo sapiens >50000 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437878 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2127&target=Cytochrome+P450+3A4&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437878&enzyme=Cytochrome+P450+3A4&column=ki&startPg=0&Increment=50&submit=Search 91898725 175450195 CHEMBL2407929 1 MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGTVSGA 7LXL,3NXU,2V0M,2J0D,1W0G,1W0F,1W0E,9GK1,4NY4 Cytochrome P450 3A4 CP3A4_HUMAN P08684 P05184 Q16757 Q9UK50 Cytochrome P450 3A Q6GRK0_HUMAN Q6GRK0 50076464 Cc1cc(ccn1)C(CC(c1ccc(cc1)-c1cccc(c1)C(O)=O)c1ccccc1C)N=O InChI=1S/C29H26N2O3/c1-19-6-3-4-9-26(19)27(18-28(31-34)24-14-15-30-20(2)16-24)22-12-10-21(11-13-22)23-7-5-8-25(17-23)29(32)33/h3-17,27-28H,18H2,1-2H3,(H,32,33) HNQWHFSVEGXOKB-UHFFFAOYSA-N 50437880 CHEMBL2407955 Cytochrome P450 3A4 Homo sapiens >50000 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437880 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2127&target=Cytochrome+P450+3A4&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437880&enzyme=Cytochrome+P450+3A4&column=ki&startPg=0&Increment=50&submit=Search 91898727 175450197 CHEMBL2407955 1 MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGTVSGA 7LXL,3NXU,2V0M,2J0D,1W0G,1W0F,1W0E,9GK1,4NY4 Cytochrome P450 3A4 CP3A4_HUMAN P08684 P05184 Q16757 Q9UK50 Cytochrome P450 3A Q6GRK0_HUMAN Q6GRK0 50076465 Cc1cc(ccn1)C(C[C@@H](c1ccc(cc1)-c1ccc(cc1)C(O)=O)c1ccccc1C)N=O |r| InChI=1S/C29H26N2O3/c1-19-5-3-4-6-26(19)27(18-28(31-34)25-15-16-30-20(2)17-25)23-11-7-21(8-12-23)22-9-13-24(14-10-22)29(32)33/h3-17,27-28H,18H2,1-2H3,(H,32,33) GEMWXWUPINNETM-UHFFFAOYSA-N 50437878 CHEMBL2407929 G-protein coupled bile acid receptor 1 Mus musculus 93 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437878 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437878&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898725 175450195 CHEMBL2407929 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50076466 Cc1cc(ccn1)C(C[C@H](c1ccc(cc1)-c1ccc(cc1)C(O)=O)c1ccccc1C)N=O |r| InChI=1S/C29H26N2O3/c1-19-5-3-4-6-26(19)27(18-28(31-34)25-15-16-30-20(2)17-25)23-11-7-21(8-12-23)22-9-13-24(14-10-22)29(32)33/h3-17,27-28H,18H2,1-2H3,(H,32,33) GEMWXWUPINNETM-UHFFFAOYSA-N 50437879 CHEMBL2408107 G-protein coupled bile acid receptor 1 Homo sapiens 11 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437879 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437879&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898726 175450196 CHEMBL2408107 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50076467 CN(C)c1ccc(cc1)C(CC(N=O)c1ccncc1)c1cccc(C)c1 InChI=1S/C23H25N3O/c1-17-5-4-6-20(15-17)22(18-7-9-21(10-8-18)26(2)3)16-23(25-27)19-11-13-24-14-12-19/h4-15,22-23H,16H2,1-3H3 JLEQHPJQHNOEBF-UHFFFAOYSA-N 50437888 CHEMBL2407945 G-protein coupled bile acid receptor 1 Homo sapiens 2750 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437888 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437888&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898735 175450205 CHEMBL2407945 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50076468 Cc1ccccc1C(CC(N=O)c1ccncc1)c1ccc(Br)cc1 InChI=1S/C21H19BrN2O/c1-15-4-2-3-5-19(15)20(16-6-8-18(22)9-7-16)14-21(24-25)17-10-12-23-13-11-17/h2-13,20-21H,14H2,1H3 XEFOLPJVSOYLJE-UHFFFAOYSA-N 50437885 CHEMBL2407949 Cytochrome P450 3A4 Homo sapiens <200 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437885 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2127&target=Cytochrome+P450+3A4&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437885&enzyme=Cytochrome+P450+3A4&column=ki&startPg=0&Increment=50&submit=Search 91898732 175450202 CHEMBL2407949 1 MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGTVSGA 7LXL,3NXU,2V0M,2J0D,1W0G,1W0F,1W0E,9GK1,4NY4 Cytochrome P450 3A4 CP3A4_HUMAN P08684 P05184 Q16757 Q9UK50 Cytochrome P450 3A Q6GRK0_HUMAN Q6GRK0 50076469 Cc1cc(ccn1)C(CC(c1ccc(Br)cc1)c1ccccc1C)N=O InChI=1S/C22H21BrN2O/c1-15-5-3-4-6-20(15)21(17-7-9-19(23)10-8-17)14-22(25-26)18-11-12-24-16(2)13-18/h3-13,21-22H,14H2,1-2H3 INISOYAKHGTHDU-UHFFFAOYSA-N 50437884 CHEMBL2407950 Cytochrome P450 3A4 Homo sapiens 5000 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437884 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2127&target=Cytochrome+P450+3A4&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437884&enzyme=Cytochrome+P450+3A4&column=ki&startPg=0&Increment=50&submit=Search 91898731 175450201 CHEMBL2407950 1 MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGTVSGA 7LXL,3NXU,2V0M,2J0D,1W0G,1W0F,1W0E,9GK1,4NY4 Cytochrome P450 3A4 CP3A4_HUMAN P08684 P05184 Q16757 Q9UK50 Cytochrome P450 3A Q6GRK0_HUMAN Q6GRK0 50076470 CN(C)c1ccc(cc1)C(CC(N=O)c1ccncc1)c1ccccc1 InChI=1S/C22H23N3O/c1-25(2)20-10-8-18(9-11-20)21(17-6-4-3-5-7-17)16-22(24-26)19-12-14-23-15-13-19/h3-15,21-22H,16H2,1-2H3 GAOIASSLHDSFLE-UHFFFAOYSA-N 50437890 CHEMBL2407938::CHEMBL2407936 G-protein coupled bile acid receptor 1 Homo sapiens 270 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437890 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437890&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898737 175450207 CHEMBL2407936CHEMBL2407938 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50076471 Cc1cc(ccn1)C(CC(c1ccc(Br)cc1)c1ccccc1C)N=O InChI=1S/C22H21BrN2O/c1-15-5-3-4-6-20(15)21(17-7-9-19(23)10-8-17)14-22(25-26)18-11-12-24-16(2)13-18/h3-13,21-22H,14H2,1-2H3 INISOYAKHGTHDU-UHFFFAOYSA-N 50437884 CHEMBL2407950 G-protein coupled bile acid receptor 1 Homo sapiens 500 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437884 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437884&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898731 175450201 CHEMBL2407950 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50076472 Cc1ccccc1C(CC(N=O)c1ccncc1)c1ccc(Br)cc1 InChI=1S/C21H19BrN2O/c1-15-4-2-3-5-19(15)20(16-6-8-18(22)9-7-16)14-21(24-25)17-10-12-23-13-11-17/h2-13,20-21H,14H2,1H3 XEFOLPJVSOYLJE-UHFFFAOYSA-N 50437885 CHEMBL2407949 G-protein coupled bile acid receptor 1 Homo sapiens 880 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437885 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437885&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898732 175450202 CHEMBL2407949 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50076473 Cc1ccccc1C(CC(N=O)c1ccc(=O)n(C)c1)c1ccc(Br)cc1 InChI=1S/C22H21BrN2O2/c1-15-5-3-4-6-19(15)20(16-7-10-18(23)11-8-16)13-21(24-27)17-9-12-22(26)25(2)14-17/h3-12,14,20-21H,13H2,1-2H3 JCNNMOCPEWZLCZ-UHFFFAOYSA-N 50437883 CHEMBL2407951 Cytochrome P450 3A4 Homo sapiens >50000 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437883 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2127&target=Cytochrome+P450+3A4&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437883&enzyme=Cytochrome+P450+3A4&column=ki&startPg=0&Increment=50&submit=Search 91898730 175450200 CHEMBL2407951 1 MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGTVSGA 7LXL,3NXU,2V0M,2J0D,1W0G,1W0F,1W0E,9GK1,4NY4 Cytochrome P450 3A4 CP3A4_HUMAN P08684 P05184 Q16757 Q9UK50 Cytochrome P450 3A Q6GRK0_HUMAN Q6GRK0 50076474 Cc1ccccc1C(CC(N=O)c1ccc(=O)n(C)c1)c1ccc(Br)cc1 InChI=1S/C22H21BrN2O2/c1-15-5-3-4-6-19(15)20(16-7-10-18(23)11-8-16)13-21(24-27)17-9-12-22(26)25(2)14-17/h3-12,14,20-21H,13H2,1-2H3 JCNNMOCPEWZLCZ-UHFFFAOYSA-N 50437883 CHEMBL2407951 G-protein coupled bile acid receptor 1 Homo sapiens 170 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437883 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437883&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898730 175450200 CHEMBL2407951 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50076475 Cc1cc(ccn1)C(C[C@@H](c1ccc(cc1)N1CCC(CC1)C(O)=O)c1ccccc1C)N=O |r| InChI=1S/C28H31N3O3/c1-19-5-3-4-6-25(19)26(18-27(30-34)23-11-14-29-20(2)17-23)21-7-9-24(10-8-21)31-15-12-22(13-16-31)28(32)33/h3-11,14,17,22,26-27H,12-13,15-16,18H2,1-2H3,(H,32,33) NJCCHNXUSBDCQP-UHFFFAOYSA-N 50437876 CHEMBL2407931 G-protein coupled bile acid receptor 1 Homo sapiens 750 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437876 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437876&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898723 175450193 CHEMBL2407931 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50076476 Cc1cc(ccn1)C(C[C@@H](c1ccc(cc1)-c1ccc(cc1)C(O)=O)c1ccccc1C)N=O |r| InChI=1S/C29H26N2O3/c1-19-5-3-4-6-26(19)27(18-28(31-34)25-15-16-30-20(2)17-25)23-11-7-21(8-12-23)22-9-13-24(14-10-22)29(32)33/h3-17,27-28H,18H2,1-2H3,(H,32,33) GEMWXWUPINNETM-UHFFFAOYSA-N 50437878 CHEMBL2407929 G-protein coupled bile acid receptor 1 Homo sapiens 1600 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437878 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437878&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898725 175450195 CHEMBL2407929 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50076477 Cc1cc(ccn1)C(C[C@H](c1ccc(cc1)N1CCC(CC1)C(O)=O)c1ccccc1C)N=O |r| InChI=1S/C28H31N3O3/c1-19-5-3-4-6-25(19)26(18-27(30-34)23-11-14-29-20(2)17-23)21-7-9-24(10-8-21)31-15-12-22(13-16-31)28(32)33/h3-11,14,17,22,26-27H,12-13,15-16,18H2,1-2H3,(H,32,33) NJCCHNXUSBDCQP-UHFFFAOYSA-N 50437877 CHEMBL2407930 G-protein coupled bile acid receptor 1 Homo sapiens 80 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437877 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437877&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898724 175450194 CHEMBL2407930 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 51071568 Cc1ccccc1[C@@H](CC(N=O)c1ccc(=O)n(C)c1)c1ccc(cc1)S(C)(=O)=O |r| InChI=1S/C23H24N2O4S/c1-16-6-4-5-7-20(16)21(17-8-11-19(12-9-17)30(3,28)29)14-22(24-27)18-10-13-23(26)25(2)15-18/h4-13,15,21-22H,14H2,1-3H3 ZLQBDFFAZUFHQT-UHFFFAOYSA-N 50437872 CHEMBL2407935 G-protein coupled bile acid receptor 1 Mus musculus 3000 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437872 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437872&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898719 175450189 CHEMBL2407935 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 51071569 Cc1ccccc1[C@H](CC(N=O)c1ccc(=O)n(C)c1)c1ccc(cc1)S(C)(=O)=O |r| InChI=1S/C23H24N2O4S/c1-16-6-4-5-7-20(16)21(17-8-11-19(12-9-17)30(3,28)29)14-22(24-27)18-10-13-23(26)25(2)15-18/h4-13,15,21-22H,14H2,1-3H3 ZLQBDFFAZUFHQT-UHFFFAOYSA-N 50437873 CHEMBL2407934 G-protein coupled bile acid receptor 1 Mus musculus 1300 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437873 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437873&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898720 175450190 CHEMBL2407934 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 51071570 Cc1ccccc1[C@@H](CC(N=O)c1ccc(=O)n(C)c1)c1ccc(cc1)-c1ccc(cc1)C(O)=O |r| InChI=1S/C29H26N2O4/c1-19-5-3-4-6-25(19)26(17-27(30-35)24-15-16-28(32)31(2)18-24)22-11-7-20(8-12-22)21-9-13-23(14-10-21)29(33)34/h3-16,18,26-27H,17H2,1-2H3,(H,33,34) ANOSMWHBNFJLHV-UHFFFAOYSA-N 50437874 CHEMBL2407933 G-protein coupled bile acid receptor 1 Mus musculus 620 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437874 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437874&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898721 175450191 CHEMBL2407933 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 51071571 Cc1ccccc1[C@H](CC(N=O)c1ccc(=O)n(C)c1)c1ccc(cc1)-c1ccc(cc1)C(O)=O |r| InChI=1S/C29H26N2O4/c1-19-5-3-4-6-25(19)26(17-27(30-35)24-15-16-28(32)31(2)18-24)22-11-7-20(8-12-22)21-9-13-23(14-10-21)29(33)34/h3-16,18,26-27H,17H2,1-2H3,(H,33,34) ANOSMWHBNFJLHV-UHFFFAOYSA-N 50437875 CHEMBL2407932 G-protein coupled bile acid receptor 1 Mus musculus 450 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437875 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437875&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898722 175450192 CHEMBL2407932 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 51071572 Cc1cc(ccn1)C(C[C@@H](c1ccc(cc1)N1CCC(CC1)C(O)=O)c1ccccc1C)N=O |r| InChI=1S/C28H31N3O3/c1-19-5-3-4-6-25(19)26(18-27(30-34)23-11-14-29-20(2)17-23)21-7-9-24(10-8-21)31-15-12-22(13-16-31)28(32)33/h3-11,14,17,22,26-27H,12-13,15-16,18H2,1-2H3,(H,32,33) NJCCHNXUSBDCQP-UHFFFAOYSA-N 50437876 CHEMBL2407931 G-protein coupled bile acid receptor 1 Mus musculus 130 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437876 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437876&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898723 175450193 CHEMBL2407931 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 51071573 Cc1cc(ccn1)C(C[C@H](c1ccc(cc1)N1CCC(CC1)C(O)=O)c1ccccc1C)N=O |r| InChI=1S/C28H31N3O3/c1-19-5-3-4-6-25(19)26(18-27(30-34)23-11-14-29-20(2)17-23)21-7-9-24(10-8-21)31-15-12-22(13-16-31)28(32)33/h3-11,14,17,22,26-27H,12-13,15-16,18H2,1-2H3,(H,32,33) NJCCHNXUSBDCQP-UHFFFAOYSA-N 50437877 CHEMBL2407930 G-protein coupled bile acid receptor 1 Mus musculus 28 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437877 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437877&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898724 175450194 CHEMBL2407930 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 51071574 Cc1cc(ccn1)C(C[C@@H](c1ccc(cc1)-c1ccc(cc1)C(O)=O)c1ccccc1C)N=O |r| InChI=1S/C29H26N2O3/c1-19-5-3-4-6-26(19)27(18-28(31-34)25-15-16-30-20(2)17-25)23-11-7-21(8-12-23)22-9-13-24(14-10-22)29(32)33/h3-17,27-28H,18H2,1-2H3,(H,32,33) GEMWXWUPINNETM-UHFFFAOYSA-N 50437878 CHEMBL2407929 G-protein coupled bile acid receptor 1 Mus musculus 190 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437878 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437878&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898725 175450195 CHEMBL2407929 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 51071575 Cc1cc(ccn1)C(C[C@H](c1ccc(cc1)-c1ccc(cc1)C(O)=O)c1ccccc1C)N=O |r| InChI=1S/C29H26N2O3/c1-19-5-3-4-6-26(19)27(18-28(31-34)25-15-16-30-20(2)17-25)23-11-7-21(8-12-23)22-9-13-24(14-10-22)29(32)33/h3-17,27-28H,18H2,1-2H3,(H,32,33) GEMWXWUPINNETM-UHFFFAOYSA-N 50437879 CHEMBL2408107 G-protein coupled bile acid receptor 1 Mus musculus 140 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437879 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437879&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898726 175450196 CHEMBL2408107 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 51071576 Cc1cc(ccn1)C(CC(c1ccc(cc1)-c1cccc(c1)C(O)=O)c1ccccc1C)N=O InChI=1S/C29H26N2O3/c1-19-6-3-4-9-26(19)27(18-28(31-34)24-14-15-30-20(2)16-24)22-12-10-21(11-13-22)23-7-5-8-25(17-23)29(32)33/h3-17,27-28H,18H2,1-2H3,(H,32,33) HNQWHFSVEGXOKB-UHFFFAOYSA-N 50437880 CHEMBL2407955 G-protein coupled bile acid receptor 1 Mus musculus 860 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437880 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437880&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898727 175450197 CHEMBL2407955 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 51071578 Cc1cc(ccn1)C(CC(c1ccc(CC(O)=O)cc1)c1ccccc1C)N=O InChI=1S/C24H24N2O3/c1-16-5-3-4-6-21(16)22(19-9-7-18(8-10-19)14-24(27)28)15-23(26-29)20-11-12-25-17(2)13-20/h3-13,22-23H,14-15H2,1-2H3,(H,27,28) GGSCWSOJUPJACO-UHFFFAOYSA-N 50437881 CHEMBL2407953 G-protein coupled bile acid receptor 1 Mus musculus 6100 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437881 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437881&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898728 175450198 CHEMBL2407953 C03768 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 51071579 Cc1cc(ccn1)C(CC(c1ccc(cc1)C(O)=O)c1ccccc1C)N=O InChI=1S/C23H22N2O3/c1-15-5-3-4-6-20(15)21(17-7-9-18(10-8-17)23(26)27)14-22(25-28)19-11-12-24-16(2)13-19/h3-13,21-22H,14H2,1-2H3,(H,26,27) GMZJHGZSQIVJEK-UHFFFAOYSA-N 50437882 CHEMBL2407952 G-protein coupled bile acid receptor 1 Mus musculus 3700 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437882 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437882&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898729 175450199 CHEMBL2407952 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 51071580 Cc1ccccc1C(CC(N=O)c1ccc(=O)n(C)c1)c1ccc(Br)cc1 InChI=1S/C22H21BrN2O2/c1-15-5-3-4-6-19(15)20(16-7-10-18(23)11-8-16)13-21(24-27)17-9-12-22(26)25(2)14-17/h3-12,14,20-21H,13H2,1-2H3 JCNNMOCPEWZLCZ-UHFFFAOYSA-N 50437883 CHEMBL2407951 G-protein coupled bile acid receptor 1 Mus musculus 1420 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437883 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437883&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898730 175450200 CHEMBL2407951 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 51071581 Cc1cc(ccn1)C(CC(c1ccc(Br)cc1)c1ccccc1C)N=O InChI=1S/C22H21BrN2O/c1-15-5-3-4-6-20(15)21(17-7-9-19(23)10-8-17)14-22(25-26)18-11-12-24-16(2)13-18/h3-13,21-22H,14H2,1-2H3 INISOYAKHGTHDU-UHFFFAOYSA-N 50437884 CHEMBL2407950 G-protein coupled bile acid receptor 1 Mus musculus 740 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437884 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437884&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898731 175450201 CHEMBL2407950 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 51071582 Cc1ccccc1C(CC(N=O)c1ccncc1)c1ccc(Br)cc1 InChI=1S/C21H19BrN2O/c1-15-4-2-3-5-19(15)20(16-6-8-18(22)9-7-16)14-21(24-25)17-10-12-23-13-11-17/h2-13,20-21H,14H2,1H3 XEFOLPJVSOYLJE-UHFFFAOYSA-N 50437885 CHEMBL2407949 G-protein coupled bile acid receptor 1 Mus musculus 310 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437885 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437885&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898732 175450202 CHEMBL2407949 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 51071583 CN(C)c1ccc(cc1)C(CC(N=O)c1ccncc1)c1ccccn1 InChI=1S/C21H22N4O/c1-25(2)18-8-6-16(7-9-18)19(20-5-3-4-12-23-20)15-21(24-26)17-10-13-22-14-11-17/h3-14,19,21H,15H2,1-2H3 WROCYBWIVUGGHR-UHFFFAOYSA-N 50437886 CHEMBL2407947 G-protein coupled bile acid receptor 1 Mus musculus 1600 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437886 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437886&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898733 175450203 CHEMBL2407947 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 51071584 CN(C)c1ccc(cc1)C(CC(N=O)c1ccncc1)c1ccc(C)cc1 InChI=1S/C23H25N3O/c1-17-4-6-18(7-5-17)22(19-8-10-21(11-9-19)26(2)3)16-23(25-27)20-12-14-24-15-13-20/h4-15,22-23H,16H2,1-3H3 MITMTGJJFPFSEA-UHFFFAOYSA-N 50437887 CHEMBL2407946 G-protein coupled bile acid receptor 1 Mus musculus 1100 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437887 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437887&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898734 175450204 CHEMBL2407946 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 51071585 CN(C)c1ccc(cc1)C(CC(N=O)c1ccncc1)c1cccc(C)c1 InChI=1S/C23H25N3O/c1-17-5-4-6-20(15-17)22(18-7-9-21(10-8-18)26(2)3)16-23(25-27)19-11-13-24-14-12-19/h4-15,22-23H,16H2,1-3H3 JLEQHPJQHNOEBF-UHFFFAOYSA-N 50437888 CHEMBL2407945 G-protein coupled bile acid receptor 1 Mus musculus 1500 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437888 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437888&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898735 175450205 CHEMBL2407945 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 51071586 CN(C)c1ccc(cc1)C(CC(N=O)c1ccncc1)c1ccccc1C InChI=1S/C23H25N3O/c1-17-6-4-5-7-21(17)22(18-8-10-20(11-9-18)26(2)3)16-23(25-27)19-12-14-24-15-13-19/h4-15,22-23H,16H2,1-3H3 PJPNDEXWHMPNBM-UHFFFAOYSA-N 50437889 CHEMBL2407944 G-protein coupled bile acid receptor 1 Mus musculus 700 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437889 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437889&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898736 175450206 CHEMBL2407944 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 51071587 CN(C)c1ccc(cc1)C(CC(N=O)c1ccncc1)c1ccccc1 InChI=1S/C22H23N3O/c1-25(2)20-10-8-18(9-11-20)21(17-6-4-3-5-7-17)16-22(24-26)19-12-14-23-15-13-19/h3-15,21-22H,16H2,1-2H3 GAOIASSLHDSFLE-UHFFFAOYSA-N 50437890 CHEMBL2407938::CHEMBL2407936 G-protein coupled bile acid receptor 1 Mus musculus 2000 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437890 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437890&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898737 175450207 CHEMBL2407936CHEMBL2407938 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 51071588 Cc1ccccc1[C@@H](CC(N=O)c1ccc(=O)n(C)c1)c1ccc(cc1)S(C)(=O)=O |r| InChI=1S/C23H24N2O4S/c1-16-6-4-5-7-20(16)21(17-8-11-19(12-9-17)30(3,28)29)14-22(24-27)18-10-13-23(26)25(2)15-18/h4-13,15,21-22H,14H2,1-3H3 ZLQBDFFAZUFHQT-UHFFFAOYSA-N 50437872 CHEMBL2407935 G-protein coupled bile acid receptor 1 Homo sapiens 80 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437872 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437872&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898719 175450189 CHEMBL2407935 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 51071589 Cc1ccccc1[C@H](CC(N=O)c1ccc(=O)n(C)c1)c1ccc(cc1)S(C)(=O)=O |r| InChI=1S/C23H24N2O4S/c1-16-6-4-5-7-20(16)21(17-8-11-19(12-9-17)30(3,28)29)14-22(24-27)18-10-13-23(26)25(2)15-18/h4-13,15,21-22H,14H2,1-3H3 ZLQBDFFAZUFHQT-UHFFFAOYSA-N 50437873 CHEMBL2407934 G-protein coupled bile acid receptor 1 Homo sapiens 26 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437873 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437873&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898720 175450190 CHEMBL2407934 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 51071590 Cc1ccccc1[C@@H](CC(N=O)c1ccc(=O)n(C)c1)c1ccc(cc1)-c1ccc(cc1)C(O)=O |r| InChI=1S/C29H26N2O4/c1-19-5-3-4-6-25(19)26(17-27(30-35)24-15-16-28(32)31(2)18-24)22-11-7-20(8-12-22)21-9-13-23(14-10-21)29(33)34/h3-16,18,26-27H,17H2,1-2H3,(H,33,34) ANOSMWHBNFJLHV-UHFFFAOYSA-N 50437874 CHEMBL2407933 G-protein coupled bile acid receptor 1 Homo sapiens 320 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437874 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437874&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898721 175450191 CHEMBL2407933 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 51071591 Cc1ccccc1[C@H](CC(N=O)c1ccc(=O)n(C)c1)c1ccc(cc1)-c1ccc(cc1)C(O)=O |r| InChI=1S/C29H26N2O4/c1-19-5-3-4-6-25(19)26(17-27(30-35)24-15-16-28(32)31(2)18-24)22-11-7-20(8-12-22)21-9-13-23(14-10-21)29(33)34/h3-16,18,26-27H,17H2,1-2H3,(H,33,34) ANOSMWHBNFJLHV-UHFFFAOYSA-N 50437875 CHEMBL2407932 G-protein coupled bile acid receptor 1 Homo sapiens 60 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437875 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437875&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898722 175450192 CHEMBL2407932 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 51071592 Cc1cc(ccn1)C(C[C@@H](c1ccc(cc1)N1CCC(CC1)C(O)=O)c1ccccc1C)N=O |r| InChI=1S/C28H31N3O3/c1-19-5-3-4-6-25(19)26(18-27(30-34)23-11-14-29-20(2)17-23)21-7-9-24(10-8-21)31-15-12-22(13-16-31)28(32)33/h3-11,14,17,22,26-27H,12-13,15-16,18H2,1-2H3,(H,32,33) NJCCHNXUSBDCQP-UHFFFAOYSA-N 50437876 CHEMBL2407931 G-protein coupled bile acid receptor 1 Homo sapiens 23 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437876 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437876&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898723 175450193 CHEMBL2407931 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 51071593 Cc1cc(ccn1)C(C[C@H](c1ccc(cc1)N1CCC(CC1)C(O)=O)c1ccccc1C)N=O |r| InChI=1S/C28H31N3O3/c1-19-5-3-4-6-25(19)26(18-27(30-34)23-11-14-29-20(2)17-23)21-7-9-24(10-8-21)31-15-12-22(13-16-31)28(32)33/h3-11,14,17,22,26-27H,12-13,15-16,18H2,1-2H3,(H,32,33) NJCCHNXUSBDCQP-UHFFFAOYSA-N 50437877 CHEMBL2407930 G-protein coupled bile acid receptor 1 Homo sapiens 4.0 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437877 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437877&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898724 175450194 CHEMBL2407930 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 51071596 Cc1cc(ccn1)C(CC(c1ccc(cc1)-c1cccc(c1)C(O)=O)c1ccccc1C)N=O InChI=1S/C29H26N2O3/c1-19-6-3-4-9-26(19)27(18-28(31-34)24-14-15-30-20(2)16-24)22-12-10-21(11-13-22)23-7-5-8-25(17-23)29(32)33/h3-17,27-28H,18H2,1-2H3,(H,32,33) HNQWHFSVEGXOKB-UHFFFAOYSA-N 50437880 CHEMBL2407955 G-protein coupled bile acid receptor 1 Homo sapiens 290 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437880 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437880&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898727 175450197 CHEMBL2407955 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 51071598 Cc1cc(ccn1)C(CC(c1ccc(CC(O)=O)cc1)c1ccccc1C)N=O InChI=1S/C24H24N2O3/c1-16-5-3-4-6-21(16)22(19-9-7-18(8-10-19)14-24(27)28)15-23(26-29)20-11-12-25-17(2)13-20/h3-13,22-23H,14-15H2,1-2H3,(H,27,28) GGSCWSOJUPJACO-UHFFFAOYSA-N 50437881 CHEMBL2407953 G-protein coupled bile acid receptor 1 Homo sapiens 700 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437881 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437881&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898728 175450198 CHEMBL2407953 C03768 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 51071599 Cc1cc(ccn1)C(CC(c1ccc(cc1)C(O)=O)c1ccccc1C)N=O InChI=1S/C23H22N2O3/c1-15-5-3-4-6-20(15)21(17-7-9-18(10-8-17)23(26)27)14-22(25-28)19-11-12-24-16(2)13-19/h3-13,21-22H,14H2,1-2H3,(H,26,27) GMZJHGZSQIVJEK-UHFFFAOYSA-N 50437882 CHEMBL2407952 G-protein coupled bile acid receptor 1 Homo sapiens 260 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437882 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437882&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898729 175450199 CHEMBL2407952 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 51071600 Cc1ccccc1C(CC(N=O)c1ccc(=O)n(C)c1)c1ccc(Br)cc1 InChI=1S/C22H21BrN2O2/c1-15-5-3-4-6-19(15)20(16-7-10-18(23)11-8-16)13-21(24-27)17-9-12-22(26)25(2)14-17/h3-12,14,20-21H,13H2,1-2H3 JCNNMOCPEWZLCZ-UHFFFAOYSA-N 50437883 CHEMBL2407951 G-protein coupled bile acid receptor 1 Homo sapiens 8.0 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437883 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437883&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898730 175450200 CHEMBL2407951 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 51071601 Cc1cc(ccn1)C(CC(c1ccc(Br)cc1)c1ccccc1C)N=O InChI=1S/C22H21BrN2O/c1-15-5-3-4-6-20(15)21(17-7-9-19(23)10-8-17)14-22(25-26)18-11-12-24-16(2)13-18/h3-13,21-22H,14H2,1-2H3 INISOYAKHGTHDU-UHFFFAOYSA-N 50437884 CHEMBL2407950 G-protein coupled bile acid receptor 1 Homo sapiens 28 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437884 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437884&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898731 175450201 CHEMBL2407950 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 51071602 Cc1ccccc1C(CC(N=O)c1ccncc1)c1ccc(Br)cc1 InChI=1S/C21H19BrN2O/c1-15-4-2-3-5-19(15)20(16-6-8-18(22)9-7-16)14-21(24-25)17-10-12-23-13-11-17/h2-13,20-21H,14H2,1H3 XEFOLPJVSOYLJE-UHFFFAOYSA-N 50437885 CHEMBL2407949 G-protein coupled bile acid receptor 1 Homo sapiens 12 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437885 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437885&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898732 175450202 CHEMBL2407949 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 51071603 CCC(CC(N=O)c1ccncc1)c1ccc(cc1)N(C)C InChI=1S/C18H23N3O/c1-4-14(15-5-7-17(8-6-15)21(2)3)13-18(20-22)16-9-11-19-12-10-16/h5-12,14,18H,4,13H2,1-3H3 LLMOULVTDNJQGM-UHFFFAOYSA-N 50437891 CHEMBL2407948 G-protein coupled bile acid receptor 1 Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437891 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437891&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898738 175450208 CHEMBL2407948 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 51071604 CN(C)c1ccc(cc1)C(CC(N=O)c1ccncc1)c1ccccn1 InChI=1S/C21H22N4O/c1-25(2)18-8-6-16(7-9-18)19(20-5-3-4-12-23-20)15-21(24-26)17-10-13-22-14-11-17/h3-14,19,21H,15H2,1-2H3 WROCYBWIVUGGHR-UHFFFAOYSA-N 50437886 CHEMBL2407947 G-protein coupled bile acid receptor 1 Homo sapiens 380 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437886 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437886&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898733 175450203 CHEMBL2407947 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 51071605 CN(C)c1ccc(cc1)C(CC(N=O)c1ccncc1)c1ccc(C)cc1 InChI=1S/C23H25N3O/c1-17-4-6-18(7-5-17)22(19-8-10-21(11-9-19)26(2)3)16-23(25-27)20-12-14-24-15-13-20/h4-15,22-23H,16H2,1-3H3 MITMTGJJFPFSEA-UHFFFAOYSA-N 50437887 CHEMBL2407946 G-protein coupled bile acid receptor 1 Homo sapiens 100 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437887 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437887&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898734 175450204 CHEMBL2407946 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 51071606 CN(C)c1ccc(cc1)C(CC(N=O)c1ccncc1)c1cccc(C)c1 InChI=1S/C23H25N3O/c1-17-5-4-6-20(15-17)22(18-7-9-21(10-8-18)26(2)3)16-23(25-27)19-11-13-24-14-12-19/h4-15,22-23H,16H2,1-3H3 JLEQHPJQHNOEBF-UHFFFAOYSA-N 50437888 CHEMBL2407945 G-protein coupled bile acid receptor 1 Homo sapiens 79 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437888 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437888&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898735 175450205 CHEMBL2407945 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 51071607 CN(C)c1ccc(cc1)C(CC(N=O)c1ccncc1)c1ccccc1C InChI=1S/C23H25N3O/c1-17-6-4-5-7-21(17)22(18-8-10-20(11-9-18)26(2)3)16-23(25-27)19-12-14-24-15-13-19/h4-15,22-23H,16H2,1-3H3 PJPNDEXWHMPNBM-UHFFFAOYSA-N 50437889 CHEMBL2407944 G-protein coupled bile acid receptor 1 Homo sapiens 25 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437889 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437889&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898736 175450206 CHEMBL2407944 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 51071608 CN(C)c1ccc(cc1)C(CC(N=O)c1ccccn1)c1ccccc1 InChI=1S/C22H23N3O/c1-25(2)19-13-11-18(12-14-19)20(17-8-4-3-5-9-17)16-22(24-26)21-10-6-7-15-23-21/h3-15,20,22H,16H2,1-2H3 FZNROVUGDZJOBI-UHFFFAOYSA-N 50437892 CHEMBL2407943 G-protein coupled bile acid receptor 1 Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437892 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437892&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898739 175450209 CHEMBL2407943 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 51071609 CN(C)c1ccc(cc1)C(CC(N=O)c1cccnc1)c1ccccc1 InChI=1S/C22H23N3O/c1-25(2)20-12-10-18(11-13-20)21(17-7-4-3-5-8-17)15-22(24-26)19-9-6-14-23-16-19/h3-14,16,21-22H,15H2,1-2H3 ZUKBYVFWUNDXKQ-UHFFFAOYSA-N 50437893 CHEMBL2407942 G-protein coupled bile acid receptor 1 Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437893 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437893&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898740 175450210 CHEMBL2407942 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 51071610 CN(C)c1ccc(cc1)C(CC(N=O)c1ccc(F)cc1)c1ccccc1 InChI=1S/C23H23FN2O/c1-26(2)21-14-10-18(11-15-21)22(17-6-4-3-5-7-17)16-23(25-27)19-8-12-20(24)13-9-19/h3-15,22-23H,16H2,1-2H3 VKAHDPXFBMNEJM-UHFFFAOYSA-N 50437894 CHEMBL2407941 G-protein coupled bile acid receptor 1 Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437894 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437894&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898741 175450211 CHEMBL2407941 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 51071611 CN(C)c1ccc(cc1)C(CC(N=O)c1ccccc1)c1ccccc1 InChI=1S/C23H24N2O/c1-25(2)21-15-13-19(14-16-21)22(18-9-5-3-6-10-18)17-23(24-26)20-11-7-4-8-12-20/h3-16,22-23H,17H2,1-2H3 YEKDMJNHXWXNCA-UHFFFAOYSA-N 50437895 CHEMBL2407940 G-protein coupled bile acid receptor 1 Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437895 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437895&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898742 175450212 CHEMBL2407940 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 51071612 CO\N=C(/CC(c1ccccc1)c1ccc(cc1)N(C)C)c1ccncc1 InChI=1S/C23H25N3O/c1-26(2)21-11-9-19(10-12-21)22(18-7-5-4-6-8-18)17-23(25-27-3)20-13-15-24-16-14-20/h4-16,22H,17H2,1-3H3 IBXDHALIIXNLKO-UHFFFAOYSA-N 50437896 CHEMBL2407939 G-protein coupled bile acid receptor 1 Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437896 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437896&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71812800 175450213 CHEMBL2407939 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 51071614 CN(C)c1ccc(cc1)C(CC(=O)c1ccncc1)c1ccccc1 InChI=1S/C22H22N2O/c1-24(2)20-10-8-18(9-11-20)21(17-6-4-3-5-7-17)16-22(25)19-12-14-23-15-13-19/h3-15,21H,16H2,1-2H3 BOUMIFMLXHKHKV-UHFFFAOYSA-N 50437898 CHEMBL2407937 G-protein coupled bile acid receptor 1 Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437898 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437898&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 66668687 175450215 CHEMBL2407937 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 51071615 CN(C)c1ccc(cc1)C(CC(N=O)c1ccncc1)c1ccccc1 InChI=1S/C22H23N3O/c1-25(2)20-10-8-18(9-11-20)21(17-6-4-3-5-7-17)16-22(24-26)19-12-14-23-15-13-19/h3-15,21-22H,16H2,1-2H3 GAOIASSLHDSFLE-UHFFFAOYSA-N 50437890 CHEMBL2407938::CHEMBL2407936 G-protein coupled bile acid receptor 1 Homo sapiens 45 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437890 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437890&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898737 175450207 CHEMBL2407936CHEMBL2407938 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 51071623 Cc1cc(ccn1)C(C[C@H](c1ccc(cc1)-c1ccc(cc1)C(O)=O)c1ccccc1C)N=O |r| InChI=1S/C29H26N2O3/c1-19-5-3-4-6-26(19)27(18-28(31-34)25-15-16-30-20(2)17-25)23-11-7-21(8-12-23)22-9-13-24(14-10-22)29(32)33/h3-17,27-28H,18H2,1-2H3,(H,32,33) GEMWXWUPINNETM-UHFFFAOYSA-N 50437879 CHEMBL2408107 G-protein coupled bile acid receptor 1 Homo sapiens 360 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437879 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437879&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898726 175450196 CHEMBL2408107 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 51071624 Cc1cc(ccn1)C(C[C@@H](c1ccc(cc1)-c1ccc(cc1)C(O)=O)c1ccccc1C)N=O |r| InChI=1S/C29H26N2O3/c1-19-5-3-4-6-26(19)27(18-28(31-34)25-15-16-30-20(2)17-25)23-11-7-21(8-12-23)22-9-13-24(14-10-22)29(32)33/h3-17,27-28H,18H2,1-2H3,(H,32,33) GEMWXWUPINNETM-UHFFFAOYSA-N 50437878 CHEMBL2407929 G-protein coupled bile acid receptor 1 Homo sapiens 580 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437878 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437878&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 91898725 175450195 CHEMBL2407929 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 51071631 CC[C@@H]1[C@@H]2C[C@@H](CC[C@@]2([C@H]3C[C@@H]([C@]4([C@H]([C@@H]3[C@@H]1O)CC[C@@H]4[C@H](C)C[C@H](C)C(=O)O)C)O)C)O InChI=1S/C27H46O5/c1-6-17-20-12-16(28)9-10-26(20,4)21-13-22(29)27(5)18(14(2)11-15(3)25(31)32)7-8-19(27)23(21)24(17)30/h14-24,28-30H,6-13H2,1-5H3,(H,31,32) NPBCMXATLRCCLF-UHFFFAOYSA-N 50300199 6alpha-ethyl-23(S)-methyl-cholic acid::CHEMBL567640 G-protein coupled bile acid receptor 1 Homo sapiens 13000 ChEMBL 10.1016/j.bmcl.2013.06.017 10.7270/Q2833TF1 23831134 Dehmlow, H; Alvarez Sanchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P 7/24/2013 4/13/2014 F. Hoffmann-La Roche http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50300199 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50300199&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search FX0 7CFN 45483949 104154560 CHEMBL567640 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35