BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
51067574	C(CN1CCN(Cc2ccccc2)CC1)Cc1ccccc1	InChI=1S/C20H26N2/c1-3-8-19(9-4-1)12-7-13-21-14-16-22(17-15-21)18-20-10-5-2-6-11-20/h1-6,8-11H,7,12-18H2	VQEIGNPANOHOSZ-UHFFFAOYSA-N	50372598	CHEMBL273041	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 20								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50372598	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50372598&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			2845719	160851699		CHEMBL273041					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067575	O=S(=O)(Cc1ccccc1)N1CCN(Cc2ccccc2)CC1	InChI=1S/C18H22N2O2S/c21-23(22,16-18-9-5-2-6-10-18)20-13-11-19(12-14-20)15-17-7-3-1-4-8-17/h1-10H,11-16H2	DYCHURWTNOAGFJ-UHFFFAOYSA-N	50435858	CHEMBL1327876	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 11								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50435858	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50435858&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			669283	175448175		CHEMBL1327876					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067576	Clc1cccc(CS(=O)(=O)N2CCN(Cc3ccccc3)CC2)c1	InChI=1S/C18H21ClN2O2S/c19-18-8-4-7-17(13-18)15-24(22,23)21-11-9-20(10-12-21)14-16-5-2-1-3-6-16/h1-8,13H,9-12,14-15H2	ANZIHRALXLVFIO-UHFFFAOYSA-N	50435859	CHEMBL2391059	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 68								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50435859	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50435859&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			17741018	175448176		CHEMBL2391059					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067577	Brc1cccc(CS(=O)(=O)N2CCN(Cc3ccccc3)CC2)c1	InChI=1S/C18H21BrN2O2S/c19-18-8-4-7-17(13-18)15-24(22,23)21-11-9-20(10-12-21)14-16-5-2-1-3-6-16/h1-8,13H,9-12,14-15H2	MSXUPMVROVCSRP-UHFFFAOYSA-N	50435860	CHEMBL2391060	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 30								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50435860	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50435860&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			71699057	175448177		CHEMBL2391060					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067578	Ic1cccc(CS(=O)(=O)N2CCN(Cc3ccccc3)CC2)c1	InChI=1S/C18H21IN2O2S/c19-18-8-4-7-17(13-18)15-24(22,23)21-11-9-20(10-12-21)14-16-5-2-1-3-6-16/h1-8,13H,9-12,14-15H2	UIUKBBKRDWHJHA-UHFFFAOYSA-N	50435861	CHEMBL2391061	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 2.7								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50435861	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50435861&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			71699058	175448178		CHEMBL2391061					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067579	Cc1cccc(CS(=O)(=O)N2CCN(Cc3ccccc3)CC2)c1	InChI=1S/C19H24N2O2S/c1-17-6-5-9-19(14-17)16-24(22,23)21-12-10-20(11-13-21)15-18-7-3-2-4-8-18/h2-9,14H,10-13,15-16H2,1H3	ORWHWRCEGOOPBW-UHFFFAOYSA-N	50435862	CHEMBL2391062	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 36								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50435862	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50435862&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			17741443	175448179		CHEMBL2391062					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067580	Fc1cccc(CN2CCN(CC2)S(=O)(=O)Cc2ccccc2)c1	InChI=1S/C18H21FN2O2S/c19-18-8-4-7-17(13-18)14-20-9-11-21(12-10-20)24(22,23)15-16-5-2-1-3-6-16/h1-8,13H,9-12,14-15H2	XBDXZPXLPLIEJJ-UHFFFAOYSA-N	50435863	CHEMBL2391063	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 69								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50435863	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50435863&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			9443040	175448180		CHEMBL2391063					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067581	Clc1cccc(CN2CCN(CC2)S(=O)(=O)Cc2ccccc2)c1	InChI=1S/C18H21ClN2O2S/c19-18-8-4-7-17(13-18)14-20-9-11-21(12-10-20)24(22,23)15-16-5-2-1-3-6-16/h1-8,13H,9-12,14-15H2	RVIZVLBSQZZWHL-UHFFFAOYSA-N	50435864	CHEMBL2391064	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 52								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50435864	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50435864&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			9443406	175448181		CHEMBL2391064					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067582	Ic1cccc(CN2CCN(CC2)S(=O)(=O)Cc2ccccc2)c1	InChI=1S/C18H21IN2O2S/c19-18-8-4-7-17(13-18)14-20-9-11-21(12-10-20)24(22,23)15-16-5-2-1-3-6-16/h1-8,13H,9-12,14-15H2	YEIOBTDYKXUSHW-UHFFFAOYSA-N	50435865	CHEMBL2391065	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 1.8								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50435865	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50435865&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			71699138	175448182		CHEMBL2391065					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067583	Cc1cccc(CN2CCN(CC2)S(=O)(=O)Cc2ccccc2)c1	InChI=1S/C19H24N2O2S/c1-17-6-5-9-19(14-17)15-20-10-12-21(13-11-20)24(22,23)16-18-7-3-2-4-8-18/h2-9,14H,10-13,15-16H2,1H3	CHUQLVWUSFHOFG-UHFFFAOYSA-N	50435866	CHEMBL2391066	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 15								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50435866	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50435866&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			8163021	175448183		CHEMBL2391066					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067584	Brc1ccc(CN2CCN(CC2)S(=O)(=O)Cc2ccccc2)cc1	InChI=1S/C18H21BrN2O2S/c19-18-8-6-16(7-9-18)14-20-10-12-21(13-11-20)24(22,23)15-17-4-2-1-3-5-17/h1-9H,10-15H2	DRFUGWKSRKNZEK-UHFFFAOYSA-N	50435867	CHEMBL1479800	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 13								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50435867	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50435867&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			1340978	175448184		CHEMBL1479800					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067585	COc1ccc(CN2CCN(CC2)S(=O)(=O)Cc2ccccc2)cc1	InChI=1S/C19H24N2O3S/c1-24-19-9-7-17(8-10-19)15-20-11-13-21(14-12-20)25(22,23)16-18-5-3-2-4-6-18/h2-10H,11-16H2,1H3	MIKBEVABIWPCSN-UHFFFAOYSA-N	50435868	CHEMBL2391067	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 192								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50435868	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50435868&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			17368168	175448185		CHEMBL2391067					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067586	O=S(=O)(Cc1ccccc1)N1CCC(Cc2ccccc2)CC1	InChI=1S/C19H23NO2S/c21-23(22,16-19-9-5-2-6-10-19)20-13-11-18(12-14-20)15-17-7-3-1-4-8-17/h1-10,18H,11-16H2	PDMZUNUOSXPLPU-UHFFFAOYSA-N	50435869	CHEMBL2391068	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 9.9								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50435869	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50435869&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			669284	175448186		CHEMBL2391068					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067587	Clc1cccc(CS(=O)(=O)N2CCC(Cc3ccccc3)CC2)c1	InChI=1S/C19H22ClNO2S/c20-19-8-4-7-18(14-19)15-24(22,23)21-11-9-17(10-12-21)13-16-5-2-1-3-6-16/h1-8,14,17H,9-13,15H2	DRLWUAWEAANLSB-UHFFFAOYSA-N	50435870	CHEMBL2391069	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 40								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50435870	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50435870&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			71699216	175448187		CHEMBL2391069					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067588	Brc1cccc(CS(=O)(=O)N2CCC(Cc3ccccc3)CC2)c1	InChI=1S/C19H22BrNO2S/c20-19-8-4-7-18(14-19)15-24(22,23)21-11-9-17(10-12-21)13-16-5-2-1-3-6-16/h1-8,14,17H,9-13,15H2	XYQLFDUDXJSJKE-UHFFFAOYSA-N	50435871	CHEMBL2391070	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 1.6								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50435871	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50435871&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			71699217	175448188		CHEMBL2391070					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067589	Ic1cccc(CS(=O)(=O)N2CCC(Cc3ccccc3)CC2)c1	InChI=1S/C19H22INO2S/c20-19-8-4-7-18(14-19)15-24(22,23)21-11-9-17(10-12-21)13-16-5-2-1-3-6-16/h1-8,14,17H,9-13,15H2	ZHAFILXCNOYRFH-UHFFFAOYSA-N	50435872	CHEMBL2391071	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 0.960000								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50435872	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50435872&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			71699218	175448189		CHEMBL2391071					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067590	Cc1cccc(CS(=O)(=O)N2CCC(Cc3ccccc3)CC2)c1	InChI=1S/C20H25NO2S/c1-17-6-5-9-20(14-17)16-24(22,23)21-12-10-19(11-13-21)15-18-7-3-2-4-8-18/h2-9,14,19H,10-13,15-16H2,1H3	WMRISRKFHMHGCU-UHFFFAOYSA-N	50435873	CHEMBL2391072	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 4.7								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50435873	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50435873&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			71699219	175448190		CHEMBL2391072					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067591	O=S(=O)(N1CCC(Cc2ccccc2)CC1)c1ccccc1	InChI=1S/C18H21NO2S/c20-22(21,18-9-5-2-6-10-18)19-13-11-17(12-14-19)15-16-7-3-1-4-8-16/h1-10,17H,11-15H2	HYSYUQJJRUVDQY-UHFFFAOYSA-N	50435874	CHEMBL2391073::US12139461, Compound C18	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 24								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50435874	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50435874&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			727417	175448191		CHEMBL2391073					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067592	O=S(=O)(N1CCN(Cc2ccccc2)CC1)c1ccccc1	InChI=1S/C17H20N2O2S/c20-22(21,17-9-5-2-6-10-17)19-13-11-18(12-14-19)15-16-7-3-1-4-8-16/h1-10H,11-15H2	BLBMBKATZISMKR-UHFFFAOYSA-N	50435875	CHEMBL272551	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 28								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50435875	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50435875&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			711024	175448192		CHEMBL272551					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067593	Clc1ccc(cc1)S(=O)(=O)N1CCC(Cc2ccccc2)CC1	InChI=1S/C18H20ClNO2S/c19-17-6-8-18(9-7-17)23(21,22)20-12-10-16(11-13-20)14-15-4-2-1-3-5-15/h1-9,16H,10-14H2	FDOUWHOQTJKHEX-UHFFFAOYSA-N	50435876	CHEMBL2391074::US12139461, Compound C29	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 551								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50435876	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50435876&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			710407	175448193		CHEMBL2391074					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067594	Clc1ccc(cc1)S(=O)(=O)N1CCN(Cc2ccccc2)CC1	InChI=1S/C17H19ClN2O2S/c18-16-6-8-17(9-7-16)23(21,22)20-12-10-19(11-13-20)14-15-4-2-1-3-5-15/h1-9H,10-14H2	CJZZSVCCBZWMCS-UHFFFAOYSA-N	50435877	CHEMBL2391075	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 969								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50435877	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50435877&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			985373	175448194		CHEMBL2391075					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067595	O=S(=O)(CCc1ccccc1)N1CCC(Cc2ccccc2)CC1	InChI=1S/C20H25NO2S/c22-24(23,16-13-18-7-3-1-4-8-18)21-14-11-20(12-15-21)17-19-9-5-2-6-10-19/h1-10,20H,11-17H2	ZQOJSPYYQBFNLQ-UHFFFAOYSA-N	50435878	CHEMBL2391076	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 60								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50435878	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50435878&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			71699220	175448195		CHEMBL2391076					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067596	O=S(=O)(CCc1ccccc1)N1CCN(Cc2ccccc2)CC1	InChI=1S/C19H24N2O2S/c22-24(23,16-11-18-7-3-1-4-8-18)21-14-12-20(13-15-21)17-19-9-5-2-6-10-19/h1-10H,11-17H2	DAQJNZIQEKHBGE-UHFFFAOYSA-N	50435879	CHEMBL2391077	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 78								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50435879	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50435879&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			71699221	175448196		CHEMBL2391077					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067597	O=S(=O)(\C=C\c1ccccc1)N1CCC(Cc2ccccc2)CC1	InChI=1S/C20H23NO2S/c22-24(23,16-13-18-7-3-1-4-8-18)21-14-11-20(12-15-21)17-19-9-5-2-6-10-19/h1-10,13,16,20H,11-12,14-15,17H2	OLQOHLFQPURHNB-UHFFFAOYSA-N	50435880	CHEMBL2391078	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 138								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50435880	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50435880&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			2475510	175448197		CHEMBL2391078					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067598	O=S(=O)(\C=C\c1ccccc1)N1CCN(Cc2ccccc2)CC1	InChI=1S/C19H22N2O2S/c22-24(23,16-11-18-7-3-1-4-8-18)21-14-12-20(13-15-21)17-19-9-5-2-6-10-19/h1-11,16H,12-15,17H2	MKCLLEUTXFVXRL-UHFFFAOYSA-N	50435881	CHEMBL1422857	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 201								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50435881	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50435881&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			882298	175448198		CHEMBL1422857					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067599	Brc1ccc(\C=C\S(=O)(=O)N2CCC(Cc3ccccc3)CC2)cc1	InChI=1S/C20H22BrNO2S/c21-20-8-6-17(7-9-20)12-15-25(23,24)22-13-10-19(11-14-22)16-18-4-2-1-3-5-18/h1-9,12,15,19H,10-11,13-14,16H2	HGNRDEWQLLLQCB-UHFFFAOYSA-N	50435882	CHEMBL2391079	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 843								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50435882	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50435882&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			71699305	175448199		CHEMBL2391079					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067600	Brc1ccc(\C=C\S(=O)(=O)N2CCN(Cc3ccccc3)CC2)cc1	InChI=1S/C19H21BrN2O2S/c20-19-8-6-17(7-9-19)10-15-25(23,24)22-13-11-21(12-14-22)16-18-4-2-1-3-5-18/h1-10,15H,11-14,16H2	ZRIOWGAHLQBMIG-UHFFFAOYSA-N	50435883	CHEMBL2391080	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 1075								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50435883	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50435883&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			71699306	175448200		CHEMBL2391080					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067601	c1cc(ccc1C(=O)CCCN2CCC(CC2)(c3ccc(cc3)Cl)O)F	InChI=1S/C21H23ClFNO2/c22-18-7-5-17(6-8-18)21(26)11-14-24(15-12-21)13-1-2-20(25)16-3-9-19(23)10-4-16/h3-10,26H,1-2,11-15H2	LNEPOXFFQSENCJ-UHFFFAOYSA-N	21398	4-[4-(4-Chloro-phenyl)-4-hydroxy-piperidin-1-yl]-1-(4-fluoro-phenyl)-butan-1-one;propionate(HCl)::Haloperidol, 1::CHEMBL545608::CHEMBL54::4-[4-(4-chlorophenyl)-4-hydroxypiperidin-1-yl]-1-(4-fluorophenyl)butan-1-one::Haloperidol::US20240317745, Compound haloperidol	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 2.8								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=21398	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=21398&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	GMJ	6DJZ,6LUQ,6X10	3559	49689470		CHEMBL54CHEMBL545608	DB00502		C01814		1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067602	[#6]-[#6@@H]1-[#6@@H]-2-[#6]-c3ccc(-[#8])cc3[C@@]1([#6])[#6]-[#6]-[#7]-2-[#6]\[#6]=[#6](/[#6])-[#6] |r,TLB:16:15:10.4.3:1|	InChI=1S/C19H5NO/c1-13(2)7-9-20-10-8-19(4)14(3)18(20)11-15-5-6-16(21)12-17(15)19/h5-6,12,14,18H	NTESFUMRHWXLJE-UHFFFAOYSA-N	50035131	(1S,9S,13S)-1,13-dimethyl-10-(3-methylbut-2-enyl)-10-azatricyclo[7.3.1.0~2,7~]trideca-2,4,6-trien-4-ol::6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol anion::(2R,6R,11R)-6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol::CHEMBL60542::(2R,6R,11S)-6,11-dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol::6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol((+)pentazocine)::(2S,3R,6S,11S)-6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol::6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol ((+)-pentazocine)::(+)-(6R,11S)-6,11-dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol::(2S,6S,11S)-6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol::6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-ethano-benzo[d]azocin-8-ol(+)-pentazocine::6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol::(6R,11S)-6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol::(-)-PENTAZOCINE	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 4.6								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50035131	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50035131&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			12259685	103943179		CHEMBL60542					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067603	Cc1ccccc1NC(N)=Nc1ccccc1C |w:10.11|	InChI=1S/C15H17N3/c1-11-7-3-5-9-13(11)17-15(16)18-14-10-6-4-8-12(14)2/h3-10H,1-2H3,(H3,16,17,18)	OPNUROKCUBTKLF-UHFFFAOYSA-N	81982	CAS_97-39-2::cid_7333::Di-o-tolylguanidine::DITOLYLGUANIDINE::DTG::Tol2Gdn	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 38								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=81982	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=81982&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			7333	131342556							1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067604	C(N1CCN(Cc2ccccc2)CC1)c1ccccc1	InChI=1S/C18H22N2/c1-3-7-17(8-4-1)15-19-11-13-20(14-12-19)16-18-9-5-2-6-10-18/h1-10H,11-16H2	YPUGLZQRXQQCSX-UHFFFAOYSA-N	50125096	CHEMBL162522::1,4-Dibenzyl-piperazine, 9::1,4-Dibenzyl-piperazine::1,4-Dibenzylpiperazine::US10166229, Example 00032	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 5.8								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50125096	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50125096&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			200601	104017330		CHEMBL162522					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067605	C(CN1CCC(Cc2ccccc2)CC1)Cc1ccccc1	InChI=1S/C21H27N/c1-3-8-19(9-4-1)12-7-15-22-16-13-21(14-17-22)18-20-10-5-2-6-11-20/h1-6,8-11,21H,7,12-18H2	OEOKSYGSLJBPFM-UHFFFAOYSA-N	50159011	4-Benzyl-1-(4-phenyl-butyl)-piperidine::CHEMBL178153	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 0.400000								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50159011	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50159011&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			23294399	104045611		CHEMBL178153					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
51067606	OC[C@@H]1CN(CCc2ccccc2)CCN1Cc1ccccc1 |r|	InChI=1S/C20H26N2O/c23-17-20-16-21(12-11-18-7-3-1-4-8-18)13-14-22(20)15-19-9-5-2-6-10-19/h1-10,20,23H,11-17H2	FBMYKPUAQAWIQE-UHFFFAOYSA-N	50435884	CHEMBL2391057	Sigma non-opioid intracellular receptor 1	Cavia porcellus	 38								ChEMBL	10.1016/j.ejmech.2013.04.013	10.7270/Q2WM1FTD	23680866			Sadeghzadeh, M; Sheibani, S; Ghandi, M; Daha, FJ; Amanlou, M; Arjmand, M; Hasani Bozcheloie, A	6/14/2013	4/13/2014	Nstri	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50435884	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4936&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50435884&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			73352014	175448201		CHEMBL2391057					1	MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSKLIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP		Sigma non-opioid intracellular receptor 1	SGMR1_CAVPO	Q60492																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
