BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50975470 Cc1ccccc1NC(=O)c1cncnc1Oc1cc(Cl)ccc1Cl InChI=1S/C18H13Cl2N3O2/c1-11-4-2-3-5-15(11)23-17(24)13-9-21-10-22-18(13)25-16-8-12(19)6-7-14(16)20/h2-10H,1H3,(H,23,24) NQNORXPLESHTHB-UHFFFAOYSA-N 50399932 CHEMBL2181245 G-protein coupled bile acid receptor 1 Homo sapiens >10000 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399932 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399932&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71453903 163348956 CHEMBL2181245 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975471 Clc1ccc(Cl)c(Oc2cccnc2C(=O)N2CCCc3ccccc23)c1 InChI=1S/C21H16Cl2N2O2/c22-15-9-10-16(23)19(13-15)27-18-8-3-11-24-20(18)21(26)25-12-4-6-14-5-1-2-7-17(14)25/h1-3,5,7-11,13H,4,6,12H2 OEHSGBSQRKGCJQ-UHFFFAOYSA-N 50399933 CHEMBL2181249 G-protein coupled bile acid receptor 1 Homo sapiens >10000 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399933 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399933&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71457419 163348957 CHEMBL2181249 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975472 Clc1ccc(Cl)c(Oc2nccnc2C(=O)N2CCCc3ccccc23)c1 InChI=1S/C20H15Cl2N3O2/c21-14-7-8-15(22)17(12-14)27-19-18(23-9-10-24-19)20(26)25-11-3-5-13-4-1-2-6-16(13)25/h1-2,4,6-10,12H,3,5,11H2 BVJGNHRLBSXPEY-UHFFFAOYSA-N 50399934 CHEMBL2181248 G-protein coupled bile acid receptor 1 Homo sapiens 5422 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399934 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399934&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71453904 163348958 CHEMBL2181248 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975473 CCN(C(=O)c1cncnc1Oc1cc(Cl)ccc1Cl)c1ccccc1C InChI=1S/C20H17Cl2N3O2/c1-3-25(17-7-5-4-6-13(17)2)20(26)15-11-23-12-24-19(15)27-18-10-14(21)8-9-16(18)22/h4-12H,3H2,1-2H3 RIIYXKLMJIARET-UHFFFAOYSA-N 50399935 CHEMBL2181218 G-protein coupled bile acid receptor 1 Homo sapiens 4886 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399935 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399935&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71457417 163348959 CHEMBL2181218 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975474 Clc1ccc(Cl)c(Oc2cncnc2C(=O)N2CCCc3ccccc23)c1 InChI=1S/C20H15Cl2N3O2/c21-14-7-8-15(22)17(10-14)27-18-11-23-12-24-19(18)20(26)25-9-3-5-13-4-1-2-6-16(13)25/h1-2,4,6-8,10-12H,3,5,9H2 RABLXUVJKZEGPQ-UHFFFAOYSA-N 50399936 CHEMBL2181250 G-protein coupled bile acid receptor 1 Homo sapiens 3871 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399936 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399936&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71453905 163348960 CHEMBL2181250 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975475 CN(C)c1ccccc1N(C)C(=O)c1cncnc1Oc1cc(Cl)ccc1Cl InChI=1S/C20H18Cl2N4O2/c1-25(2)16-6-4-5-7-17(16)26(3)20(27)14-11-23-12-24-19(14)28-18-10-13(21)8-9-15(18)22/h4-12H,1-3H3 IULFHMMKRLZFHZ-UHFFFAOYSA-N 50399937 CHEMBL2181241 G-protein coupled bile acid receptor 1 Homo sapiens 3711 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399937 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399937&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71455635 163348961 CHEMBL2181241 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975476 CN(C(=O)c1cncnc1Oc1cc(Cl)ccc1Cl)c1ccccc1 InChI=1S/C18H13Cl2N3O2/c1-23(13-5-3-2-4-6-13)18(24)14-10-21-11-22-17(14)25-16-9-12(19)7-8-15(16)20/h2-11H,1H3 GUQKBJDWDABDLZ-UHFFFAOYSA-N 50399938 CHEMBL2181243 G-protein coupled bile acid receptor 1 Homo sapiens 3151 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399938 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399938&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71453902 163348962 CHEMBL2181243 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975477 CC(C)N1CCN(C(=O)c2cncnc2Oc2cc(Cl)ccc2Cl)c2ccccc12 InChI=1S/C22H20Cl2N4O2/c1-14(2)27-9-10-28(19-6-4-3-5-18(19)27)22(29)16-12-25-13-26-21(16)30-20-11-15(23)7-8-17(20)24/h3-8,11-14H,9-10H2,1-2H3 DRVQYSMKUKLERV-UHFFFAOYSA-N 50399939 CHEMBL2181254 G-protein coupled bile acid receptor 1 Homo sapiens 710 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399939 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399939&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71453906 163348963 CHEMBL2181254 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975478 CCCCN1CCN(C(=O)c2cncnc2Oc2cc(Cl)ccc2Cl)c2ccccc12 InChI=1S/C23H22Cl2N4O2/c1-2-3-10-28-11-12-29(20-7-5-4-6-19(20)28)23(30)17-14-26-15-27-22(17)31-21-13-16(24)8-9-18(21)25/h4-9,13-15H,2-3,10-12H2,1H3 UQBGTZFHMRHWLQ-UHFFFAOYSA-N 50399940 CHEMBL2181257 G-protein coupled bile acid receptor 1 Homo sapiens 590 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399940 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399940&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71461058 163348964 CHEMBL2181257 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975479 CN(C(=O)c1cncnc1Oc1cc(Cl)ccc1Cl)c1ccccc1C InChI=1S/C19H15Cl2N3O2/c1-12-5-3-4-6-16(12)24(2)19(25)14-10-22-11-23-18(14)26-17-9-13(20)7-8-15(17)21/h3-11H,1-2H3 PUIKEQABOOXLQY-UHFFFAOYSA-N 50399941 CHEMBL2181242 G-protein coupled bile acid receptor 1 Homo sapiens 535 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399941 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399941&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71461056 163348965 CHEMBL2181242 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975480 CN(C(=O)c1cnccc1Oc1cc(Cl)ccc1Cl)c1ccccc1Cl InChI=1S/C19H13Cl3N2O2/c1-24(16-5-3-2-4-14(16)21)19(25)13-11-23-9-8-17(13)26-18-10-12(20)6-7-15(18)22/h2-11H,1H3 PACRXZGHOQJNLH-UHFFFAOYSA-N 50399942 CHEMBL2181219 G-protein coupled bile acid receptor 1 Homo sapiens 451 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399942 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399942&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71461053 163348966 CHEMBL2181219 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975481 Clc1ccc(Cl)c(Oc2ncncc2C(=O)N2CCSc3ccccc23)c1 InChI=1S/C19H13Cl2N3O2S/c20-12-5-6-14(21)16(9-12)26-18-13(10-22-11-23-18)19(25)24-7-8-27-17-4-2-1-3-15(17)24/h1-6,9-11H,7-8H2 BTGSXBIRMLXHTN-UHFFFAOYSA-N 50399943 CHEMBL2181232 G-protein coupled bile acid receptor 1 Homo sapiens 164 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399943 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399943&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71462788 163348967 CHEMBL2181232 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975482 COc1ccccc1N(C)C(=O)c1cncnc1Oc1cc(Cl)ccc1Cl InChI=1S/C19H15Cl2N3O3/c1-24(15-5-3-4-6-16(15)26-2)19(25)13-10-22-11-23-18(13)27-17-9-12(20)7-8-14(17)21/h3-11H,1-2H3 DWBDWTLBGPVCTD-UHFFFAOYSA-N 50399944 CHEMBL2181244 G-protein coupled bile acid receptor 1 Homo sapiens 160 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399944 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399944&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71461057 163348968 CHEMBL2181244 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975483 Clc1ccc(Cl)c(Oc2ncncc2C(=O)N2CCCc3ccccc23)c1 InChI=1S/C20H15Cl2N3O2/c21-14-7-8-16(22)18(10-14)27-19-15(11-23-12-24-19)20(26)25-9-3-5-13-4-1-2-6-17(13)25/h1-2,4,6-8,10-12H,3,5,9H2 FGKIZYHSOOCLGM-UHFFFAOYSA-N 50399945 CHEMBL2181251 G-protein coupled bile acid receptor 1 Homo sapiens 155 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399945 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399945&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 53311618 163348969 CHEMBL2181251 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975484 Clc1ccc(Cl)c(Oc2ccncc2C(=O)N2CCOc3ccccc23)c1 InChI=1S/C20H14Cl2N2O3/c21-13-5-6-15(22)19(11-13)27-17-7-8-23-12-14(17)20(25)24-9-10-26-18-4-2-1-3-16(18)24/h1-8,11-12H,9-10H2 UBWMCRNMTIYMMA-UHFFFAOYSA-N 50399946 CHEMBL2181234 G-protein coupled bile acid receptor 1 Homo sapiens 127 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399946 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399946&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71452077 163348970 CHEMBL2181234 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975485 CCCN1CCN(C(=O)c2cnccc2Oc2cc(Cl)ccc2Cl)c2ccccc12 InChI=1S/C23H21Cl2N3O2/c1-2-11-27-12-13-28(20-6-4-3-5-19(20)27)23(29)17-15-26-10-9-21(17)30-22-14-16(24)7-8-18(22)25/h3-10,14-15H,2,11-13H2,1H3 KPYYZMLWXHSKDH-UHFFFAOYSA-N 50399947 CHEMBL2181236 G-protein coupled bile acid receptor 1 Mus musculus 76 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399947 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399947&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71459276 163348971 CHEMBL2181236 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50975486 CC(C)N1CCN(C(=O)c2cnccc2Oc2cc(Cl)ccc2Cl)c2ccccc12 InChI=1S/C23H21Cl2N3O2/c1-15(2)27-11-12-28(20-6-4-3-5-19(20)27)23(29)17-14-26-10-9-21(17)30-22-13-16(24)7-8-18(22)25/h3-10,13-15H,11-12H2,1-2H3 QEXKLMHUBWUPMZ-UHFFFAOYSA-N 50399948 CHEMBL2181237 G-protein coupled bile acid receptor 1 Homo sapiens 69 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399948 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399948&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71461055 163348972 CHEMBL2181237 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975487 Clc1ccc(Cl)c(Oc2ccncc2C(=O)N2CCN(CC=C)c3ccccc23)c1 InChI=1S/C23H19Cl2N3O2/c1-2-11-27-12-13-28(20-6-4-3-5-19(20)27)23(29)17-15-26-10-9-21(17)30-22-14-16(24)7-8-18(22)25/h2-10,14-15H,1,11-13H2 KQHRXHIZWNAAIR-UHFFFAOYSA-N 50399949 CHEMBL2181238 G-protein coupled bile acid receptor 1 Mus musculus 66 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399949 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399949&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71453901 163348973 CHEMBL2181238 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50975488 Clc1ccc(Cl)c(Oc2ccncc2C(=O)N2CCCc3ccccc23)c1 InChI=1S/C21H16Cl2N2O2/c22-15-7-8-17(23)20(12-15)27-19-9-10-24-13-16(19)21(26)25-11-3-5-14-4-1-2-6-18(14)25/h1-2,4,6-10,12-13H,3,5,11H2 HHJXDGCDWSETDB-UHFFFAOYSA-N 50399950 CHEMBL2181233 G-protein coupled bile acid receptor 1 Homo sapiens 49 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399950 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399950&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 53311781 163348974 CHEMBL2181233 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975489 O=C(N1CCN(C2CC2)c2ccccc12)c1cnccc1Oc1ccccc1 InChI=1S/C23H21N3O2/c27-23(19-16-24-13-12-22(19)28-18-6-2-1-3-7-18)26-15-14-25(17-10-11-17)20-8-4-5-9-21(20)26/h1-9,12-13,16-17H,10-11,14-15H2 XMOWMTQPHWWPJS-UHFFFAOYSA-N 50399951 CHEMBL2181220 G-protein coupled bile acid receptor 1 Homo sapiens 47 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399951 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399951&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71452075 163348975 CHEMBL2181220 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975490 Clc1cccc(Oc2ccncc2C(=O)N2CCN(C3CC3)c3ccccc23)c1 InChI=1S/C23H20ClN3O2/c24-16-4-3-5-18(14-16)29-22-10-11-25-15-19(22)23(28)27-13-12-26(17-8-9-17)20-6-1-2-7-21(20)27/h1-7,10-11,14-15,17H,8-9,12-13H2 UMJJEAJBZJJYQD-UHFFFAOYSA-N 50399952 CHEMBL2181222 G-protein coupled bile acid receptor 1 Mus musculus 31 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399952 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399952&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71459274 163348976 CHEMBL2181222 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50975491 Clc1ccc(Cl)c(Oc2ccncc2C(=O)N2CCN(C3CCC3)c3ccccc23)c1 InChI=1S/C24H21Cl2N3O2/c25-16-8-9-19(26)23(14-16)31-22-10-11-27-15-18(22)24(30)29-13-12-28(17-4-3-5-17)20-6-1-2-7-21(20)29/h1-2,6-11,14-15,17H,3-5,12-13H2 MTODFZWWDNJEKP-UHFFFAOYSA-N 50399953 CHEMBL2181240 G-protein coupled bile acid receptor 1 Mus musculus 31 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399953 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399953&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71450252 163348977 CHEMBL2181240 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50975492 Clc1ccccc1Oc1ccncc1C(=O)N1CCN(C2CC2)c2ccccc12 InChI=1S/C23H20ClN3O2/c24-18-5-1-4-8-22(18)29-21-11-12-25-15-17(21)23(28)27-14-13-26(16-9-10-16)19-6-2-3-7-20(19)27/h1-8,11-12,15-16H,9-10,13-14H2 PGFKZJYQQKOPSQ-UHFFFAOYSA-N 50399954 CHEMBL2181221 G-protein coupled bile acid receptor 1 Mus musculus 30 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399954 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399954&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71459273 163348978 CHEMBL2181221 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50975493 Clc1ccc(Cl)c(Oc2ncncc2C(=O)N2CCN(C3CC3)c3ccccc23)c1 InChI=1S/C22H18Cl2N4O2/c23-14-5-8-17(24)20(11-14)30-21-16(12-25-13-26-21)22(29)28-10-9-27(15-6-7-15)18-3-1-2-4-19(18)28/h1-5,8,11-13,15H,6-7,9-10H2 BSHORRBKTIOXHU-UHFFFAOYSA-N 50399955 CHEMBL2181256 G-protein coupled bile acid receptor 1 Mus musculus 30 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399955 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399955&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71452080 163348979 CHEMBL2181256 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50975494 Clc1ccc(Cl)c(Oc2ncncc2C(=O)N2CCN(CC=C)c3ccccc23)c1 InChI=1S/C22H18Cl2N4O2/c1-2-9-27-10-11-28(19-6-4-3-5-18(19)27)22(29)16-13-25-14-26-21(16)30-20-12-15(23)7-8-17(20)24/h2-8,12-14H,1,9-11H2 DIUSLTNYHUZZEU-UHFFFAOYSA-N 50399956 CHEMBL2181255 G-protein coupled bile acid receptor 1 Homo sapiens 30 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399956 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399956&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71452079 163348980 CHEMBL2181255 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975495 CCCN1CCN(C(=O)c2cncnc2Oc2cc(Cl)ccc2Cl)c2ccccc12 InChI=1S/C22H20Cl2N4O2/c1-2-9-27-10-11-28(19-6-4-3-5-18(19)27)22(29)16-13-25-14-26-21(16)30-20-12-15(23)7-8-17(20)24/h3-8,12-14H,2,9-11H2,1H3 IZYGXPVQPRUSGM-UHFFFAOYSA-N 50399957 CHEMBL2181253 G-protein coupled bile acid receptor 1 Homo sapiens 30 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399957 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399957&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71455636 163348981 CHEMBL2181253 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975496 Clc1ccccc1Oc1ccncc1C(=O)N1CCN(C2CC2)c2ccccc12 InChI=1S/C23H20ClN3O2/c24-18-5-1-4-8-22(18)29-21-11-12-25-15-17(21)23(28)27-14-13-26(16-9-10-16)19-6-2-3-7-20(19)27/h1-8,11-12,15-16H,9-10,13-14H2 PGFKZJYQQKOPSQ-UHFFFAOYSA-N 50399954 CHEMBL2181221 G-protein coupled bile acid receptor 1 Homo sapiens 27 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399954 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399954&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71459273 163348978 CHEMBL2181221 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975497 COc1cccc(Oc2ccncc2C(=O)N2CCN(C3CC3)c3ccccc23)c1 InChI=1S/C24H23N3O3/c1-29-18-5-4-6-19(15-18)30-23-11-12-25-16-20(23)24(28)27-14-13-26(17-9-10-17)21-7-2-3-8-22(21)27/h2-8,11-12,15-17H,9-10,13-14H2,1H3 GMYIRAMSQWVPGP-UHFFFAOYSA-N 50399958 CHEMBL2181223 G-protein coupled bile acid receptor 1 Mus musculus 26 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399958 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399958&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71455632 163348982 CHEMBL2181223 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50975498 CCN1CCN(C(=O)c2cnccc2Oc2cc(Cl)ccc2Cl)c2ccccc12 InChI=1S/C22H19Cl2N3O2/c1-2-26-11-12-27(19-6-4-3-5-18(19)26)22(28)16-14-25-10-9-20(16)29-21-13-15(23)7-8-17(21)24/h3-10,13-14H,2,11-12H2,1H3 BBXCEBZWMOSRMC-UHFFFAOYSA-N 50399959 CHEMBL2181235 G-protein coupled bile acid receptor 1 Mus musculus 24 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399959 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399959&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71459275 163348983 CHEMBL2181235 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50975499 Clc1ccc(Cl)c(Oc2ncncc2C(=O)N2CCN(C3CCC3)c3ccccc23)c1 InChI=1S/C23H20Cl2N4O2/c24-15-8-9-18(25)21(12-15)31-22-17(13-26-14-27-22)23(30)29-11-10-28(16-4-3-5-16)19-6-1-2-7-20(19)29/h1-2,6-9,12-14,16H,3-5,10-11H2 LKFNUBBKEOVLFZ-UHFFFAOYSA-N 50399960 CHEMBL2181231 G-protein coupled bile acid receptor 1 Homo sapiens 23 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399960 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399960&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71452076 163348984 CHEMBL2181231 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975500 CCN1CCN(C(=O)c2cncnc2Oc2cc(Cl)ccc2Cl)c2ccccc12 InChI=1S/C21H18Cl2N4O2/c1-2-26-9-10-27(18-6-4-3-5-17(18)26)21(28)15-12-24-13-25-20(15)29-19-11-14(22)7-8-16(19)23/h3-8,11-13H,2,9-10H2,1H3 FMSAUEPWQMHYRL-UHFFFAOYSA-N 50399961 CHEMBL2181252 G-protein coupled bile acid receptor 1 Homo sapiens 20 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399961 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399961&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71452078 163348985 CHEMBL2181252 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975501 Clc1ccc(Cl)c(Oc2ccncc2C(=O)N2CCN(C3CC3)c3ccccc23)c1 InChI=1S/C23H19Cl2N3O2/c24-15-5-8-18(25)22(13-15)30-21-9-10-26-14-17(21)23(29)28-12-11-27(16-6-7-16)19-3-1-2-4-20(19)28/h1-5,8-10,13-14,16H,6-7,11-12H2 GVSOSQXVSIDDOZ-UHFFFAOYSA-N 50399962 CHEMBL2181239 G-protein coupled bile acid receptor 1 Mus musculus 18 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399962 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399962&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 53311869 163348986 CHEMBL2181239 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50975502 Cc1ccc(Oc2ccncc2C(=O)N2CCN(C3CC3)c3ccccc23)cc1 InChI=1S/C24H23N3O2/c1-17-6-10-19(11-7-17)29-23-12-13-25-16-20(23)24(28)27-15-14-26(18-8-9-18)21-4-2-3-5-22(21)27/h2-7,10-13,16,18H,8-9,14-15H2,1H3 IVICXKCESGCPLP-UHFFFAOYSA-N 50399963 CHEMBL2181225 G-protein coupled bile acid receptor 1 Mus musculus 15 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399963 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399963&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71457418 163348987 CHEMBL2181225 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50975503 Cc1ccc(Oc2ccncc2C(=O)N2CCN(C3CC3)c3ccccc23)cc1 InChI=1S/C24H23N3O2/c1-17-6-10-19(11-7-17)29-23-12-13-25-16-20(23)24(28)27-15-14-26(18-8-9-18)21-4-2-3-5-22(21)27/h2-7,10-13,16,18H,8-9,14-15H2,1H3 IVICXKCESGCPLP-UHFFFAOYSA-N 50399963 CHEMBL2181225 G-protein coupled bile acid receptor 1 Homo sapiens 12 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399963 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399963&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71457418 163348987 CHEMBL2181225 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975504 COc1ccc(OC)c(Oc2ccncc2C(=O)N2CCN(C3CC3)c3ccccc23)c1 InChI=1S/C25H25N3O4/c1-30-18-9-10-23(31-2)24(15-18)32-22-11-12-26-16-19(22)25(29)28-14-13-27(17-7-8-17)20-5-3-4-6-21(20)28/h3-6,9-12,15-17H,7-8,13-14H2,1-2H3 XOAQFQRUIFCJCG-UHFFFAOYSA-N 50399964 CHEMBL2181224 G-protein coupled bile acid receptor 1 Homo sapiens 12 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399964 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399964&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71455633 163348988 CHEMBL2181224 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975505 COc1cccc(Oc2ccncc2C(=O)N2CCN(C3CC3)c3ccccc23)c1 InChI=1S/C24H23N3O3/c1-29-18-5-4-6-19(15-18)30-23-11-12-25-16-20(23)24(28)27-14-13-26(17-9-10-17)21-7-2-3-8-22(21)27/h2-8,11-12,15-17H,9-10,13-14H2,1H3 GMYIRAMSQWVPGP-UHFFFAOYSA-N 50399958 CHEMBL2181223 G-protein coupled bile acid receptor 1 Homo sapiens 12 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399958 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399958&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71455632 163348982 CHEMBL2181223 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975506 c1ccc2c(c1)CCCN2C(=O)c3cccnc3Oc4cc(ccc4Cl)Cl InChI=1S/C21H16Cl2N2O2/c22-15-9-10-17(23)19(13-15)27-20-16(7-3-11-24-20)21(26)25-12-4-6-14-5-1-2-8-18(14)25/h1-3,5,7-11,13H,4,6,12H2 AUSHPRSBIDTALC-UHFFFAOYSA-N 50399965 CHEMBL2181246 G-protein coupled bile acid receptor 1 Homo sapiens 10 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399965 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399965&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search H8I 7XTQ 46195848 163348989 CHEMBL2181246 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975507 Clc1cccc(Oc2ccncc2C(=O)N2CCN(C3CC3)c3ccccc23)c1 InChI=1S/C23H20ClN3O2/c24-16-4-3-5-18(14-16)29-22-10-11-25-15-19(22)23(28)27-13-12-26(17-8-9-17)20-6-1-2-7-21(20)27/h1-7,10-11,14-15,17H,8-9,12-13H2 UMJJEAJBZJJYQD-UHFFFAOYSA-N 50399952 CHEMBL2181222 G-protein coupled bile acid receptor 1 Homo sapiens 7.9 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399952 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399952&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71459274 163348976 CHEMBL2181222 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975508 CCCN1CCN(C(=O)c2cnccc2Oc2cc(Cl)ccc2Cl)c2ccccc12 InChI=1S/C23H21Cl2N3O2/c1-2-11-27-12-13-28(20-6-4-3-5-19(20)27)23(29)17-15-26-10-9-21(17)30-22-14-16(24)7-8-18(22)25/h3-10,14-15H,2,11-13H2,1H3 KPYYZMLWXHSKDH-UHFFFAOYSA-N 50399947 CHEMBL2181236 G-protein coupled bile acid receptor 1 Homo sapiens 7.1 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399947 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399947&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71459276 163348971 CHEMBL2181236 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975509 Cc1ccc(C)c(Oc2ccncc2C(=O)N2CCN(C3CC3)c3ccccc23)c1 InChI=1S/C25H25N3O2/c1-17-7-8-18(2)24(15-17)30-23-11-12-26-16-20(23)25(29)28-14-13-27(19-9-10-19)21-5-3-4-6-22(21)28/h3-8,11-12,15-16,19H,9-10,13-14H2,1-2H3 JQULIQJSYPZQMA-UHFFFAOYSA-N 50399966 CHEMBL2181226 G-protein coupled bile acid receptor 1 Mus musculus 6.2 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399966 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399966&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71450251 163348990 CHEMBL2181226 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50975510 Clc1ccc(Cl)c(Oc2ccncc2C(=O)N2CCN(CC=C)c3ccccc23)c1 InChI=1S/C23H19Cl2N3O2/c1-2-11-27-12-13-28(20-6-4-3-5-19(20)27)23(29)17-15-26-10-9-21(17)30-22-14-16(24)7-8-18(22)25/h2-10,14-15H,1,11-13H2 KQHRXHIZWNAAIR-UHFFFAOYSA-N 50399949 CHEMBL2181238 G-protein coupled bile acid receptor 1 Homo sapiens 6.2 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399949 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399949&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71453901 163348973 CHEMBL2181238 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975511 CCN1CCN(C(=O)c2cnccc2Oc2cc(Cl)ccc2Cl)c2ccccc12 InChI=1S/C22H19Cl2N3O2/c1-2-26-11-12-27(19-6-4-3-5-18(19)26)22(28)16-14-25-10-9-20(16)29-21-13-15(23)7-8-17(21)24/h3-10,13-14H,2,11-12H2,1H3 BBXCEBZWMOSRMC-UHFFFAOYSA-N 50399959 CHEMBL2181235 G-protein coupled bile acid receptor 1 Homo sapiens 3.1 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399959 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399959&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71459275 163348983 CHEMBL2181235 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975512 Clc1ccc(Cl)c(Oc2ncncc2C(=O)N2CCN(C3CC3)c3ccccc23)c1 InChI=1S/C22H18Cl2N4O2/c23-14-5-8-17(24)20(11-14)30-21-16(12-25-13-26-21)22(29)28-10-9-27(15-6-7-15)18-3-1-2-4-19(18)28/h1-5,8,11-13,15H,6-7,9-10H2 BSHORRBKTIOXHU-UHFFFAOYSA-N 50399955 CHEMBL2181256 G-protein coupled bile acid receptor 1 Homo sapiens 2.9 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399955 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399955&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71452080 163348979 CHEMBL2181256 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975513 Clc1ccc(Cl)c(Oc2ccncc2C(=O)N2CCN(C3CCC3)c3ccccc23)c1 InChI=1S/C24H21Cl2N3O2/c25-16-8-9-19(26)23(14-16)31-22-10-11-27-15-18(22)24(30)29-13-12-28(17-4-3-5-17)20-6-1-2-7-21(20)29/h1-2,6-11,14-15,17H,3-5,12-13H2 MTODFZWWDNJEKP-UHFFFAOYSA-N 50399953 CHEMBL2181240 G-protein coupled bile acid receptor 1 Homo sapiens 2.8 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399953 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399953&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71450252 163348977 CHEMBL2181240 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975514 CCc1cc(Cl)c(Oc2ccncc2C(=O)N2CCN(C3CC3)c3ccccc23)cc1Cl InChI=1S/C25H23Cl2N3O2/c1-2-16-13-20(27)24(14-19(16)26)32-23-9-10-28-15-18(23)25(31)30-12-11-29(17-7-8-17)21-5-3-4-6-22(21)30/h3-6,9-10,13-15,17H,2,7-8,11-12H2,1H3 PVTBMUVMEDUPKW-UHFFFAOYSA-N 50399967 CHEMBL2181230 G-protein coupled bile acid receptor 1 Mus musculus 2.3 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399967 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399967&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71461054 163348991 CHEMBL2181230 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50975515 Cc1cc(C)c(Oc2ccncc2C(=O)N2CCN(C3CC3)c3ccccc23)cc1C InChI=1S/C26H27N3O2/c1-17-14-19(3)25(15-18(17)2)31-24-10-11-27-16-21(24)26(30)29-13-12-28(20-8-9-20)22-6-4-5-7-23(22)29/h4-7,10-11,14-16,20H,8-9,12-13H2,1-3H3 ZQVTVBLIJQMUIL-UHFFFAOYSA-N 50399968 CHEMBL2181228 G-protein coupled bile acid receptor 1 Mus musculus 2.1 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399968 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399968&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71462786 163348992 CHEMBL2181228 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50975516 Clc1cc(Cl)c(Oc2ccncc2C(=O)N2CCN(C3CC3)c3ccccc23)cc1Cl InChI=1S/C23H18Cl3N3O2/c24-16-11-18(26)22(12-17(16)25)31-21-7-8-27-13-15(21)23(30)29-10-9-28(14-5-6-14)19-3-1-2-4-20(19)29/h1-4,7-8,11-14H,5-6,9-10H2 SLFOKMKKDLQLST-UHFFFAOYSA-N 50399969 CHEMBL2181227 G-protein coupled bile acid receptor 1 Mus musculus 2 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399969 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399969&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71455634 163348993 CHEMBL2181227 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50975517 Clc1ccc(Cl)c(Oc2ccncc2C(=O)N2CCN(C3CC3)c3ccccc23)c1 InChI=1S/C23H19Cl2N3O2/c24-15-5-8-18(25)22(13-15)30-21-9-10-26-14-17(21)23(29)28-12-11-27(16-6-7-16)19-3-1-2-4-20(19)28/h1-5,8-10,13-14,16H,6-7,11-12H2 GVSOSQXVSIDDOZ-UHFFFAOYSA-N 50399962 CHEMBL2181239 G-protein coupled bile acid receptor 1 Homo sapiens 1.5 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399962 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399962&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 53311869 163348986 CHEMBL2181239 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975518 Cc1cc(Cl)c(Oc2ccncc2C(=O)N2CCN(C3CC3)c3ccccc23)cc1Cl InChI=1S/C24H21Cl2N3O2/c1-15-12-19(26)23(13-18(15)25)31-22-8-9-27-14-17(22)24(30)29-11-10-28(16-6-7-16)20-4-2-3-5-21(20)29/h2-5,8-9,12-14,16H,6-7,10-11H2,1H3 WLHPQSGIRLTJGX-UHFFFAOYSA-N 50399970 CHEMBL2181229 G-protein coupled bile acid receptor 1 Mus musculus 0.98 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399970 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004590&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399970&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71462787 163348994 CHEMBL2181229 1 MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN G-protein coupled bile acid receptor 1 GPBAR_MOUSE Q80SS6 50975519 CCc1cc(Cl)c(Oc2ccncc2C(=O)N2CCN(C3CC3)c3ccccc23)cc1Cl InChI=1S/C25H23Cl2N3O2/c1-2-16-13-20(27)24(14-19(16)26)32-23-9-10-28-15-18(23)25(31)30-12-11-29(17-7-8-17)21-5-3-4-6-22(21)30/h3-6,9-10,13-15,17H,2,7-8,11-12H2,1H3 PVTBMUVMEDUPKW-UHFFFAOYSA-N 50399967 CHEMBL2181230 G-protein coupled bile acid receptor 1 Homo sapiens 0.72 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399967 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399967&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71461054 163348991 CHEMBL2181230 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975520 Cc1ccc(C)c(Oc2ccncc2C(=O)N2CCN(C3CC3)c3ccccc23)c1 InChI=1S/C25H25N3O2/c1-17-7-8-18(2)24(15-17)30-23-11-12-26-16-20(23)25(29)28-14-13-27(19-9-10-19)21-5-3-4-6-22(21)28/h3-8,11-12,15-16,19H,9-10,13-14H2,1-2H3 JQULIQJSYPZQMA-UHFFFAOYSA-N 50399966 CHEMBL2181226 G-protein coupled bile acid receptor 1 Homo sapiens 0.72 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399966 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399966&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71450251 163348990 CHEMBL2181226 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975521 Cc1cc(C)c(Oc2ccncc2C(=O)N2CCN(C3CC3)c3ccccc23)cc1C InChI=1S/C26H27N3O2/c1-17-14-19(3)25(15-18(17)2)31-24-10-11-27-16-21(24)26(30)29-13-12-28(20-8-9-20)22-6-4-5-7-23(22)29/h4-7,10-11,14-16,20H,8-9,12-13H2,1-3H3 ZQVTVBLIJQMUIL-UHFFFAOYSA-N 50399968 CHEMBL2181228 G-protein coupled bile acid receptor 1 Homo sapiens 0.60 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399968 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399968&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71462786 163348992 CHEMBL2181228 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975522 Clc1cc(Cl)c(Oc2ccncc2C(=O)N2CCN(C3CC3)c3ccccc23)cc1Cl InChI=1S/C23H18Cl3N3O2/c24-16-11-18(26)22(12-17(16)25)31-21-7-8-27-13-15(21)23(30)29-10-9-28(14-5-6-14)19-3-1-2-4-20(19)29/h1-4,7-8,11-14H,5-6,9-10H2 SLFOKMKKDLQLST-UHFFFAOYSA-N 50399969 CHEMBL2181227 G-protein coupled bile acid receptor 1 Homo sapiens 0.46 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399969 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399969&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71455634 163348993 CHEMBL2181227 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975523 Cc1cc(Cl)c(Oc2ccncc2C(=O)N2CCN(C3CC3)c3ccccc23)cc1Cl InChI=1S/C24H21Cl2N3O2/c1-15-12-19(26)23(13-18(15)25)31-22-8-9-27-14-17(22)24(30)29-11-10-28(16-6-7-16)20-4-2-3-5-21(20)29/h2-5,8-9,12-14,16H,6-7,10-11H2,1H3 WLHPQSGIRLTJGX-UHFFFAOYSA-N 50399970 CHEMBL2181229 G-protein coupled bile acid receptor 1 Homo sapiens 0.31 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399970 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399970&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 71462787 163348994 CHEMBL2181229 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35 50975524 Fc1ccccc1-c1ccnc2OCC(=O)N(Cc3cc(cc(c3)C(F)(F)F)C(F)(F)F)Cc12 InChI=1S/C23H15F7N2O2/c24-19-4-2-1-3-17(19)16-5-6-31-21-18(16)11-32(20(33)12-34-21)10-13-7-14(22(25,26)27)9-15(8-13)23(28,29)30/h1-9H,10-12H2 ZIXNJVGTAXRKAP-UHFFFAOYSA-N 50399971 CHEMBL2181247 G-protein coupled bile acid receptor 1 Homo sapiens 0.23 ChEMBL 10.1021/jm301071h 10.7270/Q2H70H0W 23148522 Duan, H; Ning, M; Chen, X; Zou, Q; Zhang, L; Feng, Y; Zhang, L; Leng, Y; Shen, J 12/13/2012 5/17/2013 Chinese Academy of Sciences http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50399971 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2178&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50399971&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 11656002 163348995 CHEMBL2181247 1 MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN 9GYO,7XTQ,7CFN,7CFM,7BW0 G-protein coupled bile acid receptor 1 GPBAR_HUMAN Q8TDU6 B3KV35