BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50219328 CC[C@@H](Cn1nncc1CCCCn1ccc(=O)[nH]c1=O)c1cccc(OCC2CC2)c1 |r| InChI=1S/C24H31N5O3/c1-2-19(20-6-5-8-22(14-20)32-17-18-9-10-18)16-29-21(15-25-27-29)7-3-4-12-28-13-11-23(30)26-24(28)31/h5-6,8,11,13-15,18-19H,2-4,7,9-10,12,16-17H2,1H3,(H,26,30,31) IFBUOQDMVVSERY-UHFFFAOYSA-N 50395031 CHEMBL2163854 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens 50 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395031 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395031&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 60195643 163344055 CHEMBL2163854 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219329 CC[C@@](O)(Cn1nncc1CCCCn1ccc(=O)[nH]c1=O)c1cccc(OC2CCOCC2)c1 |r| InChI=1S/C25H33N5O5/c1-2-25(33,19-6-5-8-22(16-19)35-21-10-14-34-15-11-21)18-30-20(17-26-28-30)7-3-4-12-29-13-9-23(31)27-24(29)32/h5-6,8-9,13,16-17,21,33H,2-4,7,10-12,14-15,18H2,1H3,(H,27,31,32) RVKOHPYEJLMSQG-UHFFFAOYSA-N 50395038 CHEMBL2163862 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens >1000 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395038 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395038&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71456874 163344062 CHEMBL2163862 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219367 CC[C@@](O)(Cn1nncc1CCCCn1ccc(=O)[nH]c1=O)c1cccc(OCC2CCC2)c1 |r| InChI=1S/C25H33N5O4/c1-2-25(33,20-9-6-11-22(15-20)34-17-19-7-5-8-19)18-30-21(16-26-28-30)10-3-4-13-29-14-12-23(31)27-24(29)32/h6,9,11-12,14-16,19,33H,2-5,7-8,10,13,17-18H2,1H3,(H,27,31,32) ULZHHVNYNNMFEM-UHFFFAOYSA-N 50395037 CHEMBL2163863 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens 150 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395037 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395037&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71458726 163344061 CHEMBL2163863 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219374 CC[C@@](O)(Cn1nncc1CCCCn1ccc(=O)[nH]c1=O)c1cccc(OCC(C)C)c1 |r| InChI=1S/C24H33N5O4/c1-4-24(32,19-8-7-10-21(14-19)33-16-18(2)3)17-29-20(15-25-27-29)9-5-6-12-28-13-11-22(30)26-23(28)31/h7-8,10-11,13-15,18,32H,4-6,9,12,16-17H2,1-3H3,(H,26,30,31) OKZDLGKCGTUJAV-UHFFFAOYSA-N 50395040 CHEMBL2163860 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens 550 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395040 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395040&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71462256 163344064 CHEMBL2163860 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219375 CC[C@@](O)(Cn1nncc1CCCCn1ccc(=O)[nH]c1=O)c1cccc(OCC=C)c1 |r| InChI=1S/C23H29N5O4/c1-3-14-32-20-10-7-8-18(15-20)23(31,4-2)17-28-19(16-24-26-28)9-5-6-12-27-13-11-21(29)25-22(27)30/h3,7-8,10-11,13,15-16,31H,1,4-6,9,12,14,17H2,2H3,(H,25,29,30) ZLKCMQINPNOLHH-UHFFFAOYSA-N 50395039 CHEMBL2163861 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens 360 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395039 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395039&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71460544 163344063 CHEMBL2163861 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219376 CC[C@@](O)(Cn1nncc1CCCCn1ccc(=O)[nH]c1=O)c1cccc(OCC2(C)CC2)c1 |r| InChI=1S/C25H33N5O4/c1-3-25(33,19-7-6-9-21(15-19)34-18-24(2)11-12-24)17-30-20(16-26-28-30)8-4-5-13-29-14-10-22(31)27-23(29)32/h6-7,9-10,14-16,33H,3-5,8,11-13,17-18H2,1-2H3,(H,27,31,32) QETQTFCQFSBKNN-UHFFFAOYSA-N 50395041 CHEMBL2163859 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens 630 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395041 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395041&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71456873 163344065 CHEMBL2163859 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219377 O=c1ccn(CCCc2cnnn2CC(c2ccccc2)c2ccccc2)c(=O)[nH]1 InChI=1S/C23H23N5O2/c29-22-13-15-27(23(30)25-22)14-7-12-20-16-24-26-28(20)17-21(18-8-3-1-4-9-18)19-10-5-2-6-11-19/h1-6,8-11,13,15-16,21H,7,12,14,17H2,(H,25,29,30) CLUFWYVEHITWNZ-UHFFFAOYSA-N 50395033 CHEMBL2163868 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens 1300 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395033 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395033&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 60195478 163344057 CHEMBL2163868 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219378 CC[C@@](O)(Cn1nncc1CCCCn1ccc(=O)[nH]c1=O)c1ccc(F)c(OCC2CC2)c1 |r| InChI=1S/C24H30FN5O4/c1-2-24(33,18-8-9-20(25)21(13-18)34-15-17-6-7-17)16-30-19(14-26-28-30)5-3-4-11-29-12-10-22(31)27-23(29)32/h8-10,12-14,17,33H,2-7,11,15-16H2,1H3,(H,27,31,32) AJBAZWSWGWVORO-UHFFFAOYSA-N 50395030 CHEMBL2163866 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens 67 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395030 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395030&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 60195728 163344054 CHEMBL2163866 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219379 CC[C@](O)(Cn1nncc1CCCCn1ccc(=O)[nH]c1=O)c1ccc(F)c(OCC2CC2)c1 |r| InChI=1S/C24H30FN5O4/c1-2-24(33,18-8-9-20(25)21(13-18)34-15-17-6-7-17)16-30-19(14-26-28-30)5-3-4-11-29-12-10-22(31)27-23(29)32/h8-10,12-14,17,33H,2-7,11,15-16H2,1H3,(H,27,31,32) AJBAZWSWGWVORO-UHFFFAOYSA-N 50395034 CHEMBL2163867 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens 350 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395034 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395034&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 60195729 163344058 CHEMBL2163867 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219380 CC[C@](O)(Cn1nncc1CCCCn1ccc(=O)[nH]c1=O)c1cccc(OCC2CC2)c1 |r| InChI=1S/C24H31N5O4/c1-2-24(32,19-6-5-8-21(14-19)33-16-18-9-10-18)17-29-20(15-25-27-29)7-3-4-12-28-13-11-22(30)26-23(28)31/h5-6,8,11,13-15,18,32H,2-4,7,9-10,12,16-17H2,1H3,(H,26,30,31) QIBBBVHKHDEBPO-UHFFFAOYSA-N 50395036 CHEMBL2163864 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens >1000 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395036 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395036&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 60195726 163344060 CHEMBL2163864 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219381 CN(CC(c1ccccc1)c1ccccc1)C(=O)CCCn1ccc(=O)[nH]c1=O InChI=1S/C23H25N3O3/c1-25(22(28)13-8-15-26-16-14-21(27)24-23(26)29)17-20(18-9-4-2-5-10-18)19-11-6-3-7-12-19/h2-7,9-12,14,16,20H,8,13,15,17H2,1H3,(H,24,27,29) UQSCOWQFVPVPRU-UHFFFAOYSA-N 50386598 CHEMBL2048463 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens 1300 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50386598 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50386598&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 44622388 160865681 CHEMBL2048463 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219382 CC[C@@](O)(Cn1nncc1CCOCn1ccc(=O)[nH]c1=O)c1cccc(OCC2CC2)c1 |r| InChI=1S/C23H29N5O5/c1-2-23(31,18-4-3-5-20(12-18)33-14-17-6-7-17)15-28-19(13-24-26-28)9-11-32-16-27-10-8-21(29)25-22(27)30/h3-5,8,10,12-13,17,31H,2,6-7,9,11,14-16H2,1H3,(H,25,29,30) UGDNRMPDIDFANC-UHFFFAOYSA-N 50395035 CHEMBL2163865 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens 170 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395035 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395035&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 60195727 163344059 CHEMBL2163865 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219383 CC[C@@](O)(Cn1nncc1CCCCn1ccc(=O)[nH]c1=O)c1ccc(F)c(OCC2CC2)c1 |r| InChI=1S/C24H30FN5O4/c1-2-24(33,18-8-9-20(25)21(13-18)34-15-17-6-7-17)16-30-19(14-26-28-30)5-3-4-11-29-12-10-22(31)27-23(29)32/h8-10,12-14,17,33H,2-7,11,15-16H2,1H3,(H,27,31,32) AJBAZWSWGWVORO-UHFFFAOYSA-N 50395030 CHEMBL2163866 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens 70 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395030 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395030&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 60195728 163344054 CHEMBL2163866 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219384 O=c1ccn(CCCc2cnnn2CC(c2ccccc2)c2ccccc2)c(=O)[nH]1 InChI=1S/C23H23N5O2/c29-22-13-15-27(23(30)25-22)14-7-12-20-16-24-26-28(20)17-21(18-8-3-1-4-9-18)19-10-5-2-6-11-19/h1-6,8-11,13,15-16,21H,7,12,14,17H2,(H,25,29,30) CLUFWYVEHITWNZ-UHFFFAOYSA-N 50395033 CHEMBL2163868 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens 1100 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395033 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395033&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 60195478 163344057 CHEMBL2163868 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219385 O=c1ccn(CCCCc2cnnn2CCc2cccc(OCC3CC3)c2)c(=O)[nH]1 InChI=1S/C22H27N5O3/c28-21-10-12-26(22(29)24-21)11-2-1-5-19-15-23-25-27(19)13-9-17-4-3-6-20(14-17)30-16-18-7-8-18/h3-4,6,10,12,14-15,18H,1-2,5,7-9,11,13,16H2,(H,24,28,29) DAEJBNOQVMAMEV-UHFFFAOYSA-N 50395032 CHEMBL2163851 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens 210 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395032 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395032&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 60195640 163344056 CHEMBL2163851 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219386 O=c1ccn(CCCCc2cnnn2CCc2ccccc2)c(=O)[nH]1 InChI=1S/C18H21N5O2/c24-17-10-12-22(18(25)20-17)11-5-4-8-16-14-19-21-23(16)13-9-15-6-2-1-3-7-15/h1-3,6-7,10,12,14H,4-5,8-9,11,13H2,(H,20,24,25) PVCTZRDNLPDDMQ-UHFFFAOYSA-N 50395052 CHEMBL2163873 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens 3500 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395052 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395052&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 60195562 163344076 CHEMBL2163873 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219387 C[C@@H](Cn1nncc1CCCCn1ccc(=O)[nH]c1=O)c1cccc(OCC2CC2)c1 |r| InChI=1S/C23H29N5O3/c1-17(19-5-4-7-21(13-19)31-16-18-8-9-18)15-28-20(14-24-26-28)6-2-3-11-27-12-10-22(29)25-23(27)30/h4-5,7,10,12-14,17-18H,2-3,6,8-9,11,15-16H2,1H3,(H,25,29,30) ICTFRAJLVSTQHM-UHFFFAOYSA-N 50395047 CHEMBL2163852 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens 58 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395047 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395047&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 60195641 163344071 CHEMBL2163852 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219388 COc1ccccc1CCn1nncc1CCCCn1ccc(=O)[nH]c1=O InChI=1S/C19H23N5O3/c1-27-17-8-3-2-6-15(17)9-13-24-16(14-20-22-24)7-4-5-11-23-12-10-18(25)21-19(23)26/h2-3,6,8,10,12,14H,4-5,7,9,11,13H2,1H3,(H,21,25,26) SZBFWIDOIKQGEW-UHFFFAOYSA-N 50395051 CHEMBL2163874 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens 5700 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395051 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395051&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 60195563 163344075 CHEMBL2163874 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219389 O=c1ccn(CCCCc2cnnn2C(c2ccccc2)c2ccccc2)c(=O)[nH]1 InChI=1S/C23H23N5O2/c29-21-14-16-27(23(30)25-21)15-8-7-13-20-17-24-26-28(20)22(18-9-3-1-4-10-18)19-11-5-2-6-12-19/h1-6,9-12,14,16-17,22H,7-8,13,15H2,(H,25,29,30) QWFGBFXOOZVULQ-UHFFFAOYSA-N 50395054 CHEMBL2163871 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens 1600 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395054 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395054&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 60195560 163344078 CHEMBL2163871 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219390 O=c1ccn(CCCc2cnnn2CCc2ccccc2)c(=O)[nH]1 InChI=1S/C17H19N5O2/c23-16-9-11-21(17(24)19-16)10-4-7-15-13-18-20-22(15)12-8-14-5-2-1-3-6-14/h1-3,5-6,9,11,13H,4,7-8,10,12H2,(H,19,23,24) SOIDRELTZYKGAI-UHFFFAOYSA-N 50395053 CHEMBL2163872 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens >10000 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395053 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395053&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 60195561 163344077 CHEMBL2163872 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219391 O=c1ccn(CCCCc2cnnn2CC(c2ccccc2)c2ccccc2)c(=O)[nH]1 InChI=1S/C24H25N5O2/c30-23-14-16-28(24(31)26-23)15-8-7-13-21-17-25-27-29(21)18-22(19-9-3-1-4-10-19)20-11-5-2-6-12-20/h1-6,9-12,14,16-17,22H,7-8,13,15,18H2,(H,26,30,31) KWPNKXVDNPZIDR-UHFFFAOYSA-N 50395056 CHEMBL2163869 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens 740 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395056 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395056&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 60195479 163344080 CHEMBL2163869 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219392 O=c1ccn(CCCc2cnnn2C(c2ccccc2)c2ccccc2)c(=O)[nH]1 InChI=1S/C22H21N5O2/c28-20-13-15-26(22(29)24-20)14-7-12-19-16-23-25-27(19)21(17-8-3-1-4-9-17)18-10-5-2-6-11-18/h1-6,8-11,13,15-16,21H,7,12,14H2,(H,24,28,29) CLIPGCPBBAVCJP-UHFFFAOYSA-N 50395055 CHEMBL2163870 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens >10000 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395055 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395055&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 60195559 163344079 CHEMBL2163870 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219393 CC[C@@](O)(Cn1nncc1CCCCn1ccc(=O)[nH]c1=O)c1cccc(OC2CCCC2)c1 |r| InChI=1S/C25H33N5O4/c1-2-25(33,19-8-7-12-22(16-19)34-21-10-3-4-11-21)18-30-20(17-26-28-30)9-5-6-14-29-15-13-23(31)27-24(29)32/h7-8,12-13,15-17,21,33H,2-6,9-11,14,18H2,1H3,(H,27,31,32) XLTATGZZTOCZPD-UHFFFAOYSA-N 50395043 CHEMBL2163857 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens 210 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395043 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395043&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71455073 163344067 CHEMBL2163857 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219394 CCOc1cccc(c1)[C@@](O)(CC)Cn1nncc1CCCCn1ccc(=O)[nH]c1=O |r| InChI=1S/C22H29N5O4/c1-3-22(30,17-8-7-10-19(14-17)31-4-2)16-27-18(15-23-25-27)9-5-6-12-26-13-11-20(28)24-21(26)29/h7-8,10-11,13-15,30H,3-6,9,12,16H2,1-2H3,(H,24,28,29) XDOJGANBRUMDSE-UHFFFAOYSA-N 50395042 CHEMBL2163858 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens >1000 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395042 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395042&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71449722 163344066 CHEMBL2163858 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219395 CC[C@H](Cn1nncc1CCCCn1ccc(=O)[nH]c1=O)c1cccc(OCC2CC2)c1 |r| InChI=1S/C24H31N5O3/c1-2-19(20-6-5-8-22(14-20)32-17-18-9-10-18)16-29-21(15-25-27-29)7-3-4-12-28-13-11-23(30)26-24(28)31/h5-6,8,11,13-15,18-19H,2-4,7,9-10,12,16-17H2,1H3,(H,26,30,31) IFBUOQDMVVSERY-UHFFFAOYSA-N 50395045 CHEMBL2163855 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens 720 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395045 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395045&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 60195644 163344069 CHEMBL2163855 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219396 O=c1ccn(CCCCc2cnnn2CCc2ccccc2OCC2CC2)c(=O)[nH]1 InChI=1S/C22H27N5O3/c28-21-11-13-26(22(29)24-21)12-4-3-6-19-15-23-25-27(19)14-10-18-5-1-2-7-20(18)30-16-17-8-9-17/h1-2,5,7,11,13,15,17H,3-4,6,8-10,12,14,16H2,(H,24,28,29) IHEQFZYCKOUSDY-UHFFFAOYSA-N 50395048 CHEMBL2163877 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens 390 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395048 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395048&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 60195639 163344072 CHEMBL2163877 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219397 CC[C@@](O)(Cn1nncc1CCCCn1ccc(=O)[nH]c1=O)c1cccc(OCC2CC2)c1 |r| InChI=1S/C24H31N5O4/c1-2-24(32,19-6-5-8-21(14-19)33-16-18-9-10-18)17-29-20(15-25-27-29)7-3-4-12-28-13-11-22(30)26-23(28)31/h5-6,8,11,13-15,18,32H,2-4,7,9-10,12,16-17H2,1H3,(H,26,30,31) QIBBBVHKHDEBPO-UHFFFAOYSA-N 50395044 CHEMBL2163856 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens 150 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395044 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395044&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 60195725 163344068 CHEMBL2163856 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219398 O=c1ccn(CCCCc2cnnn2CCc2cccc(OCC3CC3)c2)c(=O)[nH]1 InChI=1S/C22H27N5O3/c28-21-10-12-26(22(29)24-21)11-2-1-5-19-15-23-25-27(19)13-9-17-4-3-6-20(14-17)30-16-18-7-8-18/h3-4,6,10,12,14-15,18H,1-2,5,7-9,11,13,16H2,(H,24,28,29) DAEJBNOQVMAMEV-UHFFFAOYSA-N 50395032 CHEMBL2163851 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens 260 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395032 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395032&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 60195640 163344056 CHEMBL2163851 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219399 C[C@H](Cn1nncc1CCCCn1ccc(=O)[nH]c1=O)c1cccc(OCC2CC2)c1 |r| InChI=1S/C23H29N5O3/c1-17(19-5-4-7-21(13-19)31-16-18-8-9-18)15-28-20(14-24-26-28)6-2-3-11-27-12-10-22(29)25-23(27)30/h4-5,7,10,12-14,17-18H,2-3,6,8-9,11,15-16H2,1H3,(H,25,29,30) ICTFRAJLVSTQHM-UHFFFAOYSA-N 50395046 CHEMBL2163853 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens 870 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395046 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395046&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 60195642 163344070 CHEMBL2163853 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219400 COc1cccc(CCn2nncc2CCCCn2ccc(=O)[nH]c2=O)c1 InChI=1S/C19H23N5O3/c1-27-17-7-4-5-15(13-17)8-12-24-16(14-20-22-24)6-2-3-10-23-11-9-18(25)21-19(23)26/h4-5,7,9,11,13-14H,2-3,6,8,10,12H2,1H3,(H,21,25,26) MLZSCJHBKLKQEL-UHFFFAOYSA-N 50395050 CHEMBL2163875 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens 4100 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395050 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395050&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 60195564 163344074 CHEMBL2163875 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219401 CC[C@@H](Cn1nncc1CCCCn1ccc(=O)[nH]c1=O)c1cccc(OCC2CC2)c1 |r| InChI=1S/C24H31N5O3/c1-2-19(20-6-5-8-22(14-20)32-17-18-9-10-18)16-29-21(15-25-27-29)7-3-4-12-28-13-11-23(30)26-24(28)31/h5-6,8,11,13-15,18-19H,2-4,7,9-10,12,16-17H2,1H3,(H,26,30,31) IFBUOQDMVVSERY-UHFFFAOYSA-N 50395031 CHEMBL2163854 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens 29 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395031 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395031&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 60195643 163344055 CHEMBL2163854 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 50219402 COc1ccc(CCn2nncc2CCCCn2ccc(=O)[nH]c2=O)cc1 InChI=1S/C19H23N5O3/c1-27-17-7-5-15(6-8-17)9-13-24-16(14-20-22-24)4-2-3-11-23-12-10-18(25)21-19(23)26/h5-8,10,12,14H,2-4,9,11,13H2,1H3,(H,21,25,26) OORUMGWNRSMGFY-UHFFFAOYSA-N 50395049 CHEMBL2163876 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Homo sapiens >10000 ChEMBL 10.1021/jm3004174 10.7270/Q2XS5WJR 22715973 Miyakoshi, H; Miyahara, S; Yokogawa, T; Endoh, K; Muto, T; Yano, W; Wakasa, T; Ueno, H; Chong, KT; Taguchi, J; Nomura, M; Takao, Y; Fujioka, A; Hashimoto, A; Itou, K; Yamamura, K; Shuto, S; Nagasawa, H; Fukuoka, M 7/26/2012 5/17/2013 Taiho Pharmaceutical http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50395049 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5589&target=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50395049&enzyme=Deoxyuridine+5%27-triphosphate+nucleotidohydrolase%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 60195565 163344073 CHEMBL2163876 1 MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN 5H4J,3EHW,3ARN,3ARA,2HQU,7PWJ,1Q5U,1Q5H,8C8I Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial DUT_HUMAN P33316 A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81