BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
50928629	O=C(CN1c2ccccc2-n2c(nnc2-c2ccccc2)C(Cc2c[nH]c3ccccc23)C1=O)N1CCCC1c1ccccc1	InChI=1S/C37H32N6O2/c44-34(41-21-11-20-31(41)25-12-3-1-4-13-25)24-42-32-18-9-10-19-33(32)43-35(26-14-5-2-6-15-26)39-40-36(43)29(37(42)45)22-27-23-38-30-17-8-7-16-28(27)30/h1-10,12-19,23,29,31,38H,11,20-22,24H2	VKQTUFNCTCCIAR-UHFFFAOYSA-N	50380721	CHEMBL2017825	Cholecystokinin receptor type A	Homo sapiens				 2116.8					ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380721	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380721&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			70689619	160859804		CHEMBL2017825					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928630	O=C(CN1c2ccccc2-n2c(nnc2-c2ccccc2)C(Cc2c[nH]c3ccccc23)C1=O)N1CCCCC1Cc1ccccn1	InChI=1S/C38H35N7O2/c46-35(43-21-11-9-15-29(43)23-28-14-8-10-20-39-28)25-44-33-18-6-7-19-34(33)45-36(26-12-2-1-3-13-26)41-42-37(45)31(38(44)47)22-27-24-40-32-17-5-4-16-30(27)32/h1-8,10,12-14,16-20,24,29,31,40H,9,11,15,21-23,25H2	GCZGKSLWBKTYMA-UHFFFAOYSA-N	50380722	CHEMBL2017829	Cholecystokinin receptor type A	Homo sapiens				 31.9					ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380722	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380722&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			70681224	160859805		CHEMBL2017829					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928631	O=C(CN1c2ccccc2-n2c(nnc2-c2ccccc2)C(Cc2c[nH]c3ccccc23)C1=O)N1CCCCC1Cc1ccncc1	InChI=1S/C38H35N7O2/c46-35(43-21-9-8-12-29(43)22-26-17-19-39-20-18-26)25-44-33-15-6-7-16-34(33)45-36(27-10-2-1-3-11-27)41-42-37(45)31(38(44)47)23-28-24-40-32-14-5-4-13-30(28)32/h1-7,10-11,13-20,24,29,31,40H,8-9,12,21-23,25H2	WVSOYXIIIWSZHL-UHFFFAOYSA-N	50380723	CHEMBL2017830	Cholecystokinin receptor type A	Homo sapiens				 421					ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380723	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380723&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			70693814	160859806		CHEMBL2017830					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928632	CC(C)N(Cc1ccccc1)C(=O)CN1c2ccccc2-n2c(nnc2-c2ccccc2)[C@H](Cc2n[nH]c3ccccc23)C1=O |r|	InChI=1S/C36H33N7O2/c1-24(2)41(22-25-13-5-3-6-14-25)33(44)23-42-31-19-11-12-20-32(31)43-34(26-15-7-4-8-16-26)39-40-35(43)28(36(42)45)21-30-27-17-9-10-18-29(27)37-38-30/h3-20,24,28H,21-23H2,1-2H3,(H,37,38)	NQJDEFGZTFBIOH-UHFFFAOYSA-N	50380724	CHEMBL2017831	Cholecystokinin receptor type A	Homo sapiens				 380					ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380724	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380724&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			70695934	160859807		CHEMBL2017831					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928633	COCCC1CCCCN1C(=O)CN1c2ccccc2-n2c(nnc2-c2ccccc2)[C@H](Cc2n[nH]c3ccccc23)C1=O |r|	InChI=1S/C34H35N7O3/c1-44-20-18-24-13-9-10-19-39(24)31(42)22-40-29-16-7-8-17-30(29)41-32(23-11-3-2-4-12-23)37-38-33(41)26(34(40)43)21-28-25-14-5-6-15-27(25)35-36-28/h2-8,11-12,14-17,24,26H,9-10,13,18-22H2,1H3,(H,35,36)	WQSSRJFWNHCCOZ-UHFFFAOYSA-N	50380725	CHEMBL2017832	Cholecystokinin receptor type A	Homo sapiens				 2.7					ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380725	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380725&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			46235272	160859808		CHEMBL2017832					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928634	O=C(CN1c2ccccc2-n2c(nnc2-c2ccccc2)[C@H](Cc2n[nH]c3ccccc23)C1=O)N1CCCCC1Cc1ccccc1 |r|	InChI=1S/C38H35N7O2/c46-35(43-22-12-11-17-28(43)23-26-13-3-1-4-14-26)25-44-33-20-9-10-21-34(33)45-36(27-15-5-2-6-16-27)41-42-37(45)30(38(44)47)24-32-29-18-7-8-19-31(29)39-40-32/h1-10,13-16,18-21,28,30H,11-12,17,22-25H2,(H,39,40)	HKGBTCUFUULILA-UHFFFAOYSA-N	50380726	CHEMBL2017833	Cholecystokinin receptor type A	Homo sapiens				 12.9					ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380726	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380726&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			70691750	160859809		CHEMBL2017833					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928635	Cc1cccc(CC2CCCCN2C(=O)CN2c3ccccc3-n3c(nnc3-c3ccccc3)[C@H](Cc3n[nH]c4ccccc34)C2=O)c1 |r|	InChI=1S/C39H37N7O2/c1-26-12-11-13-27(22-26)23-29-16-9-10-21-44(29)36(47)25-45-34-19-7-8-20-35(34)46-37(28-14-3-2-4-15-28)42-43-38(46)31(39(45)48)24-33-30-17-5-6-18-32(30)40-41-33/h2-8,11-15,17-20,22,29,31H,9-10,16,21,23-25H2,1H3,(H,40,41)	DXQILTBKODCQIQ-UHFFFAOYSA-N	50380727	CHEMBL2017834	Cholecystokinin receptor type A	Homo sapiens				 669					ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380727	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380727&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			70683305	160859810		CHEMBL2017834					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928636	Cc1cc(C)cc(C[C@H]2CCCCN2C(=O)CN2c3ccccc3-n3c(nnc3-c3ccccc3)[C@H](Cc3n[nH]c4ccccc34)C2=O)c1 |r|	InChI=1S/C40H39N7O2/c1-26-20-27(2)22-28(21-26)23-30-14-10-11-19-45(30)37(48)25-46-35-17-8-9-18-36(35)47-38(29-12-4-3-5-13-29)43-44-39(47)32(40(46)49)24-34-31-15-6-7-16-33(31)41-42-34/h3-9,12-13,15-18,20-22,30,32H,10-11,14,19,23-25H2,1-2H3,(H,41,42)	ZJGPYSQTJSMQNL-UHFFFAOYSA-N	50380728	CHEMBL2017835	Cholecystokinin receptor type A	Homo sapiens				 25.4					ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380728	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380728&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			46235271	160859811		CHEMBL2017835					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928637	Cc1cc(C)cc(C[C@H]2CCCCN2C(=O)CN2c3ccccc3-n3c(nnc3-c3ccccc3)[C@H](Cc3n[nH]c4ccccc34)C2=O)c1 |r|	InChI=1S/C40H39N7O2/c1-26-20-27(2)22-28(21-26)23-30-14-10-11-19-45(30)37(48)25-46-35-17-8-9-18-36(35)47-38(29-12-4-3-5-13-29)43-44-39(47)32(40(46)49)24-34-31-15-6-7-16-33(31)41-42-34/h3-9,12-13,15-18,20-22,30,32H,10-11,14,19,23-25H2,1-2H3,(H,41,42)	ZJGPYSQTJSMQNL-UHFFFAOYSA-N	50380728	CHEMBL2017835	Cholecystokinin receptor type A	Rattus norvegicus		 14.7							ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380728	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000355&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380728&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			46235271	160859811		CHEMBL2017835					1	MSHSPARQHLVESSRMDVVDSLLMNGSNITPPCELGLENETLFCLDQPQPSKEWQSALQILLYSIIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICRPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPSDAMQQSWQTFLLLILFLLPGIVMVVAYGLISLELYQGIKFDASQKKSAKEKKPSTGSSTRYEDSDGCYLQKSRPPRKLELQQLSSGSGGSRLNRIRSSSSAANLIAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTVSAEKHLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGVRGEVGEEEDGRTIRALLSRYSYSHMSTSAPPP		Cholecystokinin receptor type A	CCKAR_RAT	P30551																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																			
50928638	CC(C)N(Cc1ccccc1)C(=O)CN1c2ccccc2-n2c(nnc2-c2ccccc2)[C@H](Cc2c[nH]c3ccccc23)C1=O |r|	InChI=1S/C37H34N6O2/c1-25(2)41(23-26-13-5-3-6-14-26)34(44)24-42-32-19-11-12-20-33(32)43-35(27-15-7-4-8-16-27)39-40-36(43)30(37(42)45)21-28-22-38-31-18-10-9-17-29(28)31/h3-20,22,25,30,38H,21,23-24H2,1-2H3	UBNMGTSDHSQBEL-UHFFFAOYSA-N	50329179	2-((4S)-4-((1H-indol-3-yl)methyl)-5-oxo-1-phenyl-4H-benzo[b][1,2,4]triazolo[4,3-d][1,4]diazepin-6(5H)-yl)-N-benzyl-N-isopropylacetamide::CHEMBL1269258	Cholecystokinin receptor type A	Homo sapiens		 23.6							ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50329179	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50329179&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			52949124	123108294		CHEMBL1269258					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928639	COCCC1CCCCN1C(=O)CN1c2ccccc2-n2c(nnc2-c2ccccc2)C(Cc2c[nH]c3ccccc23)C1=O	InChI=1S/C35H36N6O3/c1-44-20-18-26-13-9-10-19-39(26)32(42)23-40-30-16-7-8-17-31(30)41-33(24-11-3-2-4-12-24)37-38-34(41)28(35(40)43)21-25-22-36-29-15-6-5-14-27(25)29/h2-8,11-12,14-17,22,26,28,36H,9-10,13,18-21,23H2,1H3	HBHITDXIYSZXSX-UHFFFAOYSA-N	50380729	CHEMBL2017690	Cholecystokinin receptor type A	Homo sapiens		 49.3							ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380729	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380729&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			70689603	160859812		CHEMBL2017690					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928640	CCC1CCCCN1C(=O)CN1c2ccccc2-n2c(nnc2-c2ccccc2)C(Cc2c[nH]c3ccccc23)C1=O	InChI=1S/C34H34N6O2/c1-2-25-14-10-11-19-38(25)31(41)22-39-29-17-8-9-18-30(29)40-32(23-12-4-3-5-13-23)36-37-33(40)27(34(39)42)20-24-21-35-28-16-7-6-15-26(24)28/h3-9,12-13,15-18,21,25,27,35H,2,10-11,14,19-20,22H2,1H3	QVSAKQDEIVRNKI-UHFFFAOYSA-N	50380730	CHEMBL2017691	Cholecystokinin receptor type A	Homo sapiens		 36.9							ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380730	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380730&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			70695922	160859813		CHEMBL2017691					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928641	O=C(CN1c2ccccc2-n2c(nnc2-c2ccccc2)C(Cc2c[nH]c3ccccc23)C1=O)N1CCC(Cc2ccccc2)C1	InChI=1S/C38H34N6O2/c45-35(42-20-19-27(24-42)21-26-11-3-1-4-12-26)25-43-33-17-9-10-18-34(33)44-36(28-13-5-2-6-14-28)40-41-37(44)31(38(43)46)22-29-23-39-32-16-8-7-15-30(29)32/h1-18,23,27,31,39H,19-22,24-25H2	ADXYLZDRWMSWLX-UHFFFAOYSA-N	50380731	CHEMBL2017692	Cholecystokinin receptor type A	Homo sapiens		 68.6							ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380731	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380731&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			70683295	160859814		CHEMBL2017692					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928642	O=C(CN1c2ccccc2-n2c(nnc2-c2ccccc2)C(Cc2c[nH]c3ccccc23)C1=O)N1CCCC1Cc1ccccn1	InChI=1S/C37H33N7O2/c45-34(42-20-10-14-28(42)22-27-13-8-9-19-38-27)24-43-32-17-6-7-18-33(32)44-35(25-11-2-1-3-12-25)40-41-36(44)30(37(43)46)21-26-23-39-31-16-5-4-15-29(26)31/h1-9,11-13,15-19,23,28,30,39H,10,14,20-22,24H2	ONXZTZUKNBADAJ-UHFFFAOYSA-N	50380732	CHEMBL2017823	Cholecystokinin receptor type A	Homo sapiens		 373							ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380732	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380732&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			70695933	160859815		CHEMBL2017823					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928643	O=C(CN1c2ccccc2-n2c(nnc2-c2ccccc2)C(Cc2c[nH]c3ccccc23)C1=O)N1CCCCC1c1ccccc1	InChI=1S/C38H34N6O2/c45-35(42-22-12-11-19-32(42)26-13-3-1-4-14-26)25-43-33-20-9-10-21-34(33)44-36(27-15-5-2-6-16-27)40-41-37(44)30(38(43)46)23-28-24-39-31-18-8-7-17-29(28)31/h1-10,13-18,20-21,24,30,32,39H,11-12,19,22-23,25H2	BOSVNAQHOMRMEL-UHFFFAOYSA-N	50380733	CHEMBL2017824	Cholecystokinin receptor type A	Homo sapiens		 248							ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380733	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380733&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			70685411	160859816		CHEMBL2017824					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928644	O=C(CN1c2ccccc2-n2c(nnc2-c2ccccc2)C(Cc2c[nH]c3ccccc23)C1=O)N1CCCC1c1ccccc1	InChI=1S/C37H32N6O2/c44-34(41-21-11-20-31(41)25-12-3-1-4-13-25)24-42-32-18-9-10-19-33(32)43-35(26-14-5-2-6-15-26)39-40-36(43)29(37(42)45)22-27-23-38-30-17-8-7-16-28(27)30/h1-10,12-19,23,29,31,38H,11,20-22,24H2	VKQTUFNCTCCIAR-UHFFFAOYSA-N	50380721	CHEMBL2017825	Cholecystokinin receptor type A	Homo sapiens		 168							ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380721	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380721&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			70689619	160859804		CHEMBL2017825					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928645	CC(C)C1CCCCN1C(=O)CN1c2ccccc2-n2c(nnc2-c2ccccc2)C(Cc2c[nH]c3ccccc23)C1=O	InChI=1S/C35H36N6O2/c1-23(2)29-16-10-11-19-39(29)32(42)22-40-30-17-8-9-18-31(30)41-33(24-12-4-3-5-13-24)37-38-34(41)27(35(40)43)20-25-21-36-28-15-7-6-14-26(25)28/h3-9,12-15,17-18,21,23,27,29,36H,10-11,16,19-20,22H2,1-2H3	GOGUYEFIGCXTHW-UHFFFAOYSA-N	50380734	CHEMBL2017826	Cholecystokinin receptor type A	Homo sapiens		 80.1							ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380734	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380734&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			46234820	160859817		CHEMBL2017826					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928646	O=C(CN1c2ccccc2-n2c(nnc2-c2ccccc2)C(Cc2c[nH]c3ccccc23)C1=O)N1CCCCC1Cc1ccccc1	InChI=1S/C39H36N6O2/c46-36(43-22-12-11-17-30(43)23-27-13-3-1-4-14-27)26-44-34-20-9-10-21-35(34)45-37(28-15-5-2-6-16-28)41-42-38(45)32(39(44)47)24-29-25-40-33-19-8-7-18-31(29)33/h1-10,13-16,18-21,25,30,32,40H,11-12,17,22-24,26H2	XXEIMWULYPTOLF-UHFFFAOYSA-N	50380735	CHEMBL2017827	Cholecystokinin receptor type A	Homo sapiens		 44.7							ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380735	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380735&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			46234970	160859818		CHEMBL2017827					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928647	O=C(CN1c2ccccc2-n2c(nnc2-c2ccccc2)C(Cc2c[nH]c3ccccc23)C1=O)N1CCCCC1CC1CCCCC1	InChI=1S/C39H42N6O2/c46-36(43-22-12-11-17-30(43)23-27-13-3-1-4-14-27)26-44-34-20-9-10-21-35(34)45-37(28-15-5-2-6-16-28)41-42-38(45)32(39(44)47)24-29-25-40-33-19-8-7-18-31(29)33/h2,5-10,15-16,18-21,25,27,30,32,40H,1,3-4,11-14,17,22-24,26H2	SLBVRDIMZMZBJE-UHFFFAOYSA-N	50380736	CHEMBL2017828	Cholecystokinin receptor type A	Homo sapiens		 4.24							ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380736	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380736&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			46234969	160859819		CHEMBL2017828					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928648	O=C(CN1c2ccccc2-n2c(nnc2-c2ccccc2)C(Cc2c[nH]c3ccccc23)C1=O)N1CCCCC1Cc1ccccn1	InChI=1S/C38H35N7O2/c46-35(43-21-11-9-15-29(43)23-28-14-8-10-20-39-28)25-44-33-18-6-7-19-34(33)45-36(26-12-2-1-3-13-26)41-42-37(45)31(38(44)47)22-27-24-40-32-17-5-4-16-30(27)32/h1-8,10,12-14,16-20,24,29,31,40H,9,11,15,21-23,25H2	GCZGKSLWBKTYMA-UHFFFAOYSA-N	50380722	CHEMBL2017829	Cholecystokinin receptor type A	Homo sapiens		 93.3							ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380722	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380722&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			70681224	160859805		CHEMBL2017829					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928649	O=C(CN1c2ccccc2-n2c(nnc2-c2ccccc2)C(Cc2c[nH]c3ccccc23)C1=O)N1CCCCC1Cc1ccncc1	InChI=1S/C38H35N7O2/c46-35(43-21-9-8-12-29(43)22-26-17-19-39-20-18-26)25-44-33-15-6-7-16-34(33)45-36(27-10-2-1-3-11-27)41-42-37(45)31(38(44)47)23-28-24-40-32-14-5-4-13-30(28)32/h1-7,10-11,13-20,24,29,31,40H,8-9,12,21-23,25H2	WVSOYXIIIWSZHL-UHFFFAOYSA-N	50380723	CHEMBL2017830	Cholecystokinin receptor type A	Homo sapiens		 340							ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380723	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380723&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			70693814	160859806		CHEMBL2017830					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928650	CC(C)N(Cc1ccccc1)C(=O)CN1c2ccccc2-n2c(nnc2-c2ccccc2)[C@H](Cc2n[nH]c3ccccc23)C1=O |r|	InChI=1S/C36H33N7O2/c1-24(2)41(22-25-13-5-3-6-14-25)33(44)23-42-31-19-11-12-20-32(31)43-34(26-15-7-4-8-16-26)39-40-35(43)28(36(42)45)21-30-27-17-9-10-18-29(27)37-38-30/h3-20,24,28H,21-23H2,1-2H3,(H,37,38)	NQJDEFGZTFBIOH-UHFFFAOYSA-N	50380724	CHEMBL2017831	Cholecystokinin receptor type A	Homo sapiens		 38.1							ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380724	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380724&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			70695934	160859807		CHEMBL2017831					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928651	COCCC1CCCCN1C(=O)CN1c2ccccc2-n2c(nnc2-c2ccccc2)[C@H](Cc2n[nH]c3ccccc23)C1=O |r|	InChI=1S/C34H35N7O3/c1-44-20-18-24-13-9-10-19-39(24)31(42)22-40-29-16-7-8-17-30(29)41-32(23-11-3-2-4-12-23)37-38-33(41)26(34(40)43)21-28-25-14-5-6-15-27(25)35-36-28/h2-8,11-12,14-17,24,26H,9-10,13,18-22H2,1H3,(H,35,36)	WQSSRJFWNHCCOZ-UHFFFAOYSA-N	50380725	CHEMBL2017832	Cholecystokinin receptor type A	Homo sapiens		 9.9							ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380725	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380725&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			46235272	160859808		CHEMBL2017832					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928652	O=C(CN1c2ccccc2-n2c(nnc2-c2ccccc2)[C@H](Cc2n[nH]c3ccccc23)C1=O)N1CCCCC1Cc1ccccc1 |r|	InChI=1S/C38H35N7O2/c46-35(43-22-12-11-17-28(43)23-26-13-3-1-4-14-26)25-44-33-20-9-10-21-34(33)45-36(27-15-5-2-6-16-27)41-42-37(45)30(38(44)47)24-32-29-18-7-8-19-31(29)39-40-32/h1-10,13-16,18-21,28,30H,11-12,17,22-25H2,(H,39,40)	HKGBTCUFUULILA-UHFFFAOYSA-N	50380726	CHEMBL2017833	Cholecystokinin receptor type A	Homo sapiens		 36							ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380726	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380726&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			70691750	160859809		CHEMBL2017833					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928653	Cc1cccc(CC2CCCCN2C(=O)CN2c3ccccc3-n3c(nnc3-c3ccccc3)[C@H](Cc3n[nH]c4ccccc34)C2=O)c1 |r|	InChI=1S/C39H37N7O2/c1-26-12-11-13-27(22-26)23-29-16-9-10-21-44(29)36(47)25-45-34-19-7-8-20-35(34)46-37(28-14-3-2-4-15-28)42-43-38(46)31(39(45)48)24-33-30-17-5-6-18-32(30)40-41-33/h2-8,11-15,17-20,22,29,31H,9-10,16,21,23-25H2,1H3,(H,40,41)	DXQILTBKODCQIQ-UHFFFAOYSA-N	50380727	CHEMBL2017834	Cholecystokinin receptor type A	Homo sapiens		 87.6							ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380727	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380727&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			70683305	160859810		CHEMBL2017834					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928654	CC(C)N(Cc1ccccc1)C(=O)CN1c2ccccc2-n2c(nnc2-c2ccccc2)[C@H](Cc2c[nH]c3ccccc23)C1=O |r|	InChI=1S/C37H34N6O2/c1-25(2)41(23-26-13-5-3-6-14-26)34(44)24-42-32-19-11-12-20-33(32)43-35(27-15-7-4-8-16-27)39-40-36(43)30(37(42)45)21-28-22-38-31-18-10-9-17-29(28)31/h3-20,22,25,30,38H,21,23-24H2,1-2H3	UBNMGTSDHSQBEL-UHFFFAOYSA-N	50329179	2-((4S)-4-((1H-indol-3-yl)methyl)-5-oxo-1-phenyl-4H-benzo[b][1,2,4]triazolo[4,3-d][1,4]diazepin-6(5H)-yl)-N-benzyl-N-isopropylacetamide::CHEMBL1269258	Cholecystokinin receptor type A	Homo sapiens				 123					ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50329179	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50329179&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			52949124	123108294		CHEMBL1269258					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928655	COCCC1CCCCN1C(=O)CN1c2ccccc2-n2c(nnc2-c2ccccc2)C(Cc2c[nH]c3ccccc23)C1=O	InChI=1S/C35H36N6O3/c1-44-20-18-26-13-9-10-19-39(26)32(42)23-40-30-16-7-8-17-31(30)41-33(24-11-3-2-4-12-24)37-38-34(41)28(35(40)43)21-25-22-36-29-15-6-5-14-27(25)29/h2-8,11-12,14-17,22,26,28,36H,9-10,13,18-21,23H2,1H3	HBHITDXIYSZXSX-UHFFFAOYSA-N	50380729	CHEMBL2017690	Cholecystokinin receptor type A	Homo sapiens				 52.5					ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380729	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380729&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			70689603	160859812		CHEMBL2017690					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928656	CCC1CCCCN1C(=O)CN1c2ccccc2-n2c(nnc2-c2ccccc2)C(Cc2c[nH]c3ccccc23)C1=O	InChI=1S/C34H34N6O2/c1-2-25-14-10-11-19-38(25)31(41)22-39-29-17-8-9-18-30(29)40-32(23-12-4-3-5-13-23)36-37-33(40)27(34(39)42)20-24-21-35-28-16-7-6-15-26(24)28/h3-9,12-13,15-18,21,25,27,35H,2,10-11,14,19-20,22H2,1H3	QVSAKQDEIVRNKI-UHFFFAOYSA-N	50380730	CHEMBL2017691	Cholecystokinin receptor type A	Homo sapiens				 400					ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380730	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380730&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			70695922	160859813		CHEMBL2017691					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928657	O=C(CN1c2ccccc2-n2c(nnc2-c2ccccc2)C(Cc2c[nH]c3ccccc23)C1=O)N1CCC(Cc2ccccc2)C1	InChI=1S/C38H34N6O2/c45-35(42-20-19-27(24-42)21-26-11-3-1-4-12-26)25-43-33-17-9-10-18-34(33)44-36(28-13-5-2-6-14-28)40-41-37(44)31(38(43)46)22-29-23-39-32-16-8-7-15-30(29)32/h1-18,23,27,31,39H,19-22,24-25H2	ADXYLZDRWMSWLX-UHFFFAOYSA-N	50380731	CHEMBL2017692	Cholecystokinin receptor type A	Homo sapiens				 1310					ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380731	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380731&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			70683295	160859814		CHEMBL2017692					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928658	O=C(CN1c2ccccc2-n2c(nnc2-c2ccccc2)C(Cc2c[nH]c3ccccc23)C1=O)N1CCCC1Cc1ccccn1	InChI=1S/C37H33N7O2/c45-34(42-20-10-14-28(42)22-27-13-8-9-19-38-27)24-43-32-17-6-7-18-33(32)44-35(25-11-2-1-3-12-25)40-41-36(44)30(37(43)46)21-26-23-39-31-16-5-4-15-29(26)31/h1-9,11-13,15-19,23,28,30,39H,10,14,20-22,24H2	ONXZTZUKNBADAJ-UHFFFAOYSA-N	50380732	CHEMBL2017823	Cholecystokinin receptor type A	Homo sapiens				 560					ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380732	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380732&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			70695933	160859815		CHEMBL2017823					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928659	O=C(CN1c2ccccc2-n2c(nnc2-c2ccccc2)C(Cc2c[nH]c3ccccc23)C1=O)N1CCCCC1c1ccccc1	InChI=1S/C38H34N6O2/c45-35(42-22-12-11-19-32(42)26-13-3-1-4-14-26)25-43-33-20-9-10-21-34(33)44-36(27-15-5-2-6-16-27)40-41-37(44)30(38(43)46)23-28-24-39-31-18-8-7-17-29(28)31/h1-10,13-18,20-21,24,30,32,39H,11-12,19,22-23,25H2	BOSVNAQHOMRMEL-UHFFFAOYSA-N	50380733	CHEMBL2017824	Cholecystokinin receptor type A	Homo sapiens				 1670					ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380733	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380733&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			70685411	160859816		CHEMBL2017824					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928660	CC(C)C1CCCCN1C(=O)CN1c2ccccc2-n2c(nnc2-c2ccccc2)C(Cc2c[nH]c3ccccc23)C1=O	InChI=1S/C35H36N6O2/c1-23(2)29-16-10-11-19-39(29)32(42)22-40-30-17-8-9-18-31(30)41-33(24-12-4-3-5-13-24)37-38-34(41)27(35(40)43)20-25-21-36-28-15-7-6-14-26(25)28/h3-9,12-15,17-18,21,23,27,29,36H,10-11,16,19-20,22H2,1-2H3	GOGUYEFIGCXTHW-UHFFFAOYSA-N	50380734	CHEMBL2017826	Cholecystokinin receptor type A	Homo sapiens				 494					ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380734	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380734&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			46234820	160859817		CHEMBL2017826					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928661	O=C(CN1c2ccccc2-n2c(nnc2-c2ccccc2)C(Cc2c[nH]c3ccccc23)C1=O)N1CCCCC1Cc1ccccc1	InChI=1S/C39H36N6O2/c46-36(43-22-12-11-17-30(43)23-27-13-3-1-4-14-27)26-44-34-20-9-10-21-35(34)45-37(28-15-5-2-6-16-28)41-42-38(45)32(39(44)47)24-29-25-40-33-19-8-7-18-31(29)33/h1-10,13-16,18-21,25,30,32,40H,11-12,17,22-24,26H2	XXEIMWULYPTOLF-UHFFFAOYSA-N	50380735	CHEMBL2017827	Cholecystokinin receptor type A	Homo sapiens				 84.2					ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380735	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380735&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			46234970	160859818		CHEMBL2017827					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928662	O=C(CN1c2ccccc2-n2c(nnc2-c2ccccc2)C(Cc2c[nH]c3ccccc23)C1=O)N1CCCCC1CC1CCCCC1	InChI=1S/C39H42N6O2/c46-36(43-22-12-11-17-30(43)23-27-13-3-1-4-14-27)26-44-34-20-9-10-21-35(34)45-37(28-15-5-2-6-16-28)41-42-38(45)32(39(44)47)24-29-25-40-33-19-8-7-18-31(29)33/h2,5-10,15-16,18-21,25,27,30,32,40H,1,3-4,11-14,17,22-24,26H2	SLBVRDIMZMZBJE-UHFFFAOYSA-N	50380736	CHEMBL2017828	Cholecystokinin receptor type A	Homo sapiens				 256					ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380736	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380736&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			46234969	160859819		CHEMBL2017828					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50928663	Cc1cc(C)cc(C[C@H]2CCCCN2C(=O)CN2c3ccccc3-n3c(nnc3-c3ccccc3)[C@H](Cc3n[nH]c4ccccc34)C2=O)c1 |r|	InChI=1S/C40H39N7O2/c1-26-20-27(2)22-28(21-26)23-30-14-10-11-19-45(30)37(48)25-46-35-17-8-9-18-36(35)47-38(29-12-4-3-5-13-29)43-44-39(47)32(40(46)49)24-34-31-15-6-7-16-33(31)41-42-34/h3-9,12-13,15-18,20-22,30,32H,10-11,14,19,23-25H2,1-2H3,(H,41,42)	ZJGPYSQTJSMQNL-UHFFFAOYSA-N	50380728	CHEMBL2017835	Cholecystokinin receptor type A	Homo sapiens		 20.3							ChEMBL	10.1016/j.bmcl.2012.02.049	10.7270/Q2K35VP4	22424974			Cameron, KO; Beretta, EE; Chen, Y; Chu-Moyer, M; Fernando, D; Gao, H; Kohrt, J; Lavergne, S; Jardine, Pda S; Guzman-Perez, A; Hoth, C; Perry, DA; Hadcock, JR; Gautreau, D; Makowski, M; Perez, S; Polivkova, J; Rogers, L; Scott, DO; Swick, AG; Thiede, L; Trebino, CE; Trilles, RV; Wilmowski, J; Zhang, Y	4/6/2012	2/7/2013	Pfizer	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50380728	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2125&target=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50380728&enzyme=Cholecystokinin+receptor+type+A&column=ki&startPg=0&Increment=50&submit=Search			46235271	160859811		CHEMBL2017835					1	MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ	7XOV,7XOU,7EZM,7EZK,7EZH,7MBX,7MBY	Cholecystokinin receptor type A	CCKAR_HUMAN	P32238	B2R9Z5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
