BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
50720653	CCS(=O)(=O)c1ccc2oc(Nc3ccc(cc3)N3C[C@H](C)O[C@H](C)C3)nc2c1 |r|	InChI=1S/C21H25N3O4S/c1-4-29(25,26)18-9-10-20-19(11-18)23-21(28-20)22-16-5-7-17(8-6-16)24-12-14(2)27-15(3)13-24/h5-11,14-15H,4,12-13H2,1-3H3,(H,22,23)	NOLDAOWZNAVPJE-UHFFFAOYSA-N	50365397	CHEMBL1956849	Neuropeptide Y receptor type 5	Mus musculus		 71							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365397	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365397&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			57328464	136969459		CHEMBL1956849					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50720654	CCS(=O)(=O)c1ccc2oc(Nc3ccc(N4C[C@H](C)O[C@H](C)C4)c(F)c3)nc2c1 |r|	InChI=1S/C21H24FN3O4S/c1-4-30(26,27)16-6-8-20-18(10-16)24-21(29-20)23-15-5-7-19(17(22)9-15)25-11-13(2)28-14(3)12-25/h5-10,13-14H,4,11-12H2,1-3H3,(H,23,24)	HBBPRGGFGKQLJU-UHFFFAOYSA-N	50365398	CHEMBL1956850	Neuropeptide Y receptor type 5	Mus musculus		 155							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365398	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365398&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			57391275	136969460		CHEMBL1956850					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50720655	CCOc1ccc(Nc2nc3cc(ccc3o2)S(C)(=O)=O)cc1	InChI=1S/C16H16N2O4S/c1-3-21-12-6-4-11(5-7-12)17-16-18-14-10-13(23(2,19)20)8-9-15(14)22-16/h4-10H,3H2,1-2H3,(H,17,18)	LFFUEJBHRMXDFU-UHFFFAOYSA-N	50365399	CHEMBL1956925	Neuropeptide Y receptor type 5	Mus musculus		 221							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365399	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365399&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			57401790	136969461		CHEMBL1956925					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50720656	CCOc1ccc(Nc2nc3cc(ccc3o2)S(=O)(=O)C(C)C)cc1	InChI=1S/C18H20N2O4S/c1-4-23-14-7-5-13(6-8-14)19-18-20-16-11-15(9-10-17(16)24-18)25(21,22)12(2)3/h5-12H,4H2,1-3H3,(H,19,20)	YRWOCIQMPSYQGH-UHFFFAOYSA-N	50365400	CHEMBL1956926	Neuropeptide Y receptor type 5	Mus musculus		 99							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365400	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365400&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			57399998	136969462		CHEMBL1956926					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50720657	CCOc1ccc(Nc2nc3cc(ccc3o2)S(=O)(=O)C(C)(C)C)cc1	InChI=1S/C19H22N2O4S/c1-5-24-14-8-6-13(7-9-14)20-18-21-16-12-15(10-11-17(16)25-18)26(22,23)19(2,3)4/h6-12H,5H2,1-4H3,(H,20,21)	PCJHTSIZCDAHDG-UHFFFAOYSA-N	50365401	CHEMBL1956927	Neuropeptide Y receptor type 5	Mus musculus		 643							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365401	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365401&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			57403511	136969463		CHEMBL1956927					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50720658	CCOc1ccc(Nc2nc3cc(NS(=O)(=O)CC)ccc3o2)cc1	InChI=1S/C17H19N3O4S/c1-3-23-14-8-5-12(6-9-14)18-17-19-15-11-13(7-10-16(15)24-17)20-25(21,22)4-2/h5-11,20H,3-4H2,1-2H3,(H,18,19)	FOCNKLNTTBFICX-UHFFFAOYSA-N	50365402	CHEMBL1956928	Neuropeptide Y receptor type 5	Mus musculus		 1680							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365402	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365402&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			57401791	136969464		CHEMBL1956928					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50720659	CCOc1ccc(Nc2nc3ccc(cc3o2)S(=O)(=O)CC)cc1	InChI=1S/C17H18N2O4S/c1-3-22-13-7-5-12(6-8-13)18-17-19-15-10-9-14(11-16(15)23-17)24(20,21)4-2/h5-11H,3-4H2,1-2H3,(H,18,19)	CREVDWHDDGOBCK-UHFFFAOYSA-N	50365403	CHEMBL1956929	Neuropeptide Y receptor type 5	Mus musculus		 489							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365403	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365403&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			57394791	136969465		CHEMBL1956929					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50720660	CCOc1ccc(Nc2nc3ccc(NS(=O)(=O)CC)cc3o2)cc1	InChI=1S/C17H19N3O4S/c1-3-23-14-8-5-12(6-9-14)18-17-19-15-10-7-13(11-16(15)24-17)20-25(21,22)4-2/h5-11,20H,3-4H2,1-2H3,(H,18,19)	SGPIURPAQSBJFB-UHFFFAOYSA-N	50365404	CHEMBL1956930	Neuropeptide Y receptor type 5	Mus musculus		 35							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365404	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365404&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			57403512	136969466		CHEMBL1956930					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50720661	CCOc1ccc(Nc2nc3ccc(NS(=O)(=O)C(C)(C)C)cc3o2)cc1	InChI=1S/C19H23N3O4S/c1-5-25-15-9-6-13(7-10-15)20-18-21-16-11-8-14(12-17(16)26-18)22-27(23,24)19(2,3)4/h6-12,22H,5H2,1-4H3,(H,20,21)	GGHMIQWVKJVQMA-UHFFFAOYSA-N	50365405	CHEMBL1956931	Neuropeptide Y receptor type 5	Mus musculus		 2.3							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365405	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365405&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			57396549	136969467		CHEMBL1956931					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50720662	C[C@H]1CN(C[C@@H](C)O1)c1ccc(Nc2nc3ccc(NS(=O)(=O)C(C)(C)C)cc3o2)cc1 |r|	InChI=1S/C23H30N4O4S/c1-15-13-27(14-16(2)30-15)19-9-6-17(7-10-19)24-22-25-20-11-8-18(12-21(20)31-22)26-32(28,29)23(3,4)5/h6-12,15-16,26H,13-14H2,1-5H3,(H,24,25)	UQFDONSOHCWLLV-UHFFFAOYSA-N	50365406	CHEMBL1956932	Neuropeptide Y receptor type 5	Mus musculus		 5290							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365406	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365406&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			57403513	136969468		CHEMBL1956932					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50720663	CCS(=O)(=O)c1ccc2oc(NC3CCCCC3)nc2c1	InChI=1S/C15H20N2O3S/c1-2-21(18,19)12-8-9-14-13(10-12)17-15(20-14)16-11-6-4-3-5-7-11/h8-11H,2-7H2,1H3,(H,16,17)	AGLLNFLYGDJDIO-UHFFFAOYSA-N	50365407	CHEMBL1956933	Neuropeptide Y receptor type 5	Mus musculus		 1400							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365407	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365407&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			57398333	136969469		CHEMBL1956933					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50720664	CCS(=O)(=O)c1ccc2oc(NC3CCC(CC3)C(C)(C)C)nc2c1 |(-7.55,-49.75,;-6.23,-50.52,;-4.9,-49.75,;-5.68,-48.41,;-4.13,-48.4,;-3.56,-50.52,;-3.57,-52.06,;-2.23,-52.83,;-.9,-52.06,;.58,-52.54,;1.49,-51.28,;3.03,-51.28,;3.8,-49.95,;5.34,-49.95,;6.11,-48.63,;5.34,-47.29,;3.8,-47.29,;3.02,-48.62,;6.12,-45.96,;7.66,-45.96,;5.35,-44.62,;6.88,-44.62,;.57,-50.03,;-.9,-50.51,;-2.24,-49.75,)|	InChI=1S/C19H28N2O3S/c1-5-25(22,23)15-10-11-17-16(12-15)21-18(24-17)20-14-8-6-13(7-9-14)19(2,3)4/h10-14H,5-9H2,1-4H3,(H,20,21)	IZPDQNLWHCJYOW-UHFFFAOYSA-N	50365408	CHEMBL1956934	Neuropeptide Y receptor type 5	Mus musculus		 723							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365408	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365408&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			57396550	136969470		CHEMBL1956934					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50720665	CCS(=O)(=O)c1ccc2oc(NCc3ccccc3)nc2c1	InChI=1S/C16H16N2O3S/c1-2-22(19,20)13-8-9-15-14(10-13)18-16(21-15)17-11-12-6-4-3-5-7-12/h3-10H,2,11H2,1H3,(H,17,18)	CTZQGEJIRVALEK-UHFFFAOYSA-N	50365409	CHEMBL1956935	Neuropeptide Y receptor type 5	Mus musculus		 1080							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365409	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365409&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			57399999	136969471		CHEMBL1956935					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50720666	CCS(=O)(=O)c1ccc2oc(NC(C)(C)c3ccccc3)nc2c1	InChI=1S/C18H20N2O3S/c1-4-24(21,22)14-10-11-16-15(12-14)19-17(23-16)20-18(2,3)13-8-6-5-7-9-13/h5-12H,4H2,1-3H3,(H,19,20)	ZENOHQSNJFAVPD-UHFFFAOYSA-N	50365410	CHEMBL1956936	Neuropeptide Y receptor type 5	Mus musculus		>10000							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365410	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365410&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			57400000	136969472		CHEMBL1956936					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50720667	CCS(=O)(=O)c1ccc2oc(Nc3ccc(nc3)C(F)(F)F)nc2c1	InChI=1S/C15H12F3N3O3S/c1-2-25(22,23)10-4-5-12-11(7-10)21-14(24-12)20-9-3-6-13(19-8-9)15(16,17)18/h3-8H,2H2,1H3,(H,20,21)	HKYVJOGYMCPXID-UHFFFAOYSA-N	50365411	CHEMBL1956937	Neuropeptide Y receptor type 5	Mus musculus		 795							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365411	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365411&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			57398334	136969473		CHEMBL1956937					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50720668	CCS(=O)(=O)c1ccc2oc(Nc3ccc(cn3)C(F)(F)F)nc2c1	InChI=1S/C15H12F3N3O3S/c1-2-25(22,23)10-4-5-12-11(7-10)20-14(24-12)21-13-6-3-9(8-19-13)15(16,17)18/h3-8H,2H2,1H3,(H,19,20,21)	WMSIURBYHHBXNS-UHFFFAOYSA-N	50365412	CHEMBL1956938	Neuropeptide Y receptor type 5	Mus musculus		 1040							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365412	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365412&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			57391285	136969474		CHEMBL1956938					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50720669	CCS(=O)(=O)c1ccc2oc(Nc3ccc(nc3)N3CCOCC3)nc2c1	InChI=1S/C18H20N4O4S/c1-2-27(23,24)14-4-5-16-15(11-14)21-18(26-16)20-13-3-6-17(19-12-13)22-7-9-25-10-8-22/h3-6,11-12H,2,7-10H2,1H3,(H,20,21)	QDACXVFLMYEEMN-UHFFFAOYSA-N	50365413	CHEMBL1956939	Neuropeptide Y receptor type 5	Mus musculus		 651							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365413	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365413&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			57393069	136969475		CHEMBL1956939					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50720670	CCS(=O)(=O)c1ccc2oc(Nc3ccc(nc3)N3C[C@H](C)O[C@H](C)C3)nc2c1 |r|	InChI=1S/C20H24N4O4S/c1-4-29(25,26)16-6-7-18-17(9-16)23-20(28-18)22-15-5-8-19(21-10-15)24-11-13(2)27-14(3)12-24/h5-10,13-14H,4,11-12H2,1-3H3,(H,22,23)	FGWDZIOQOUXYCJ-UHFFFAOYSA-N	50365414	CHEMBL1956923	Neuropeptide Y receptor type 5	Mus musculus		 310							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365414	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365414&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			57399997	136969476		CHEMBL1956923					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50720671	CCOc1ccc(Nc2nc3cc(ccc3o2)S(=O)(=O)CC)cc1	InChI=1S/C17H18N2O4S/c1-3-22-13-7-5-12(6-8-13)18-17-19-15-11-14(24(20,21)4-2)9-10-16(15)23-17/h5-11H,3-4H2,1-2H3,(H,18,19)	RTAHDXWBBOXUTR-UHFFFAOYSA-N	50365415	CHEMBL1510429	Neuropeptide Y receptor type 5	Mus musculus		 51							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365415	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365415&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			2387945	136969477		CHEMBL1510429					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50720672	Clc1cccc(CSc2nc3ccc(cc3[nH]2)S(=O)(=O)N2CCOCC2)c1	InChI=1S/C18H18ClN3O3S2/c19-14-3-1-2-13(10-14)12-26-18-20-16-5-4-15(11-17(16)21-18)27(23,24)22-6-8-25-9-7-22/h1-5,10-11H,6-9,12H2,(H,20,21)	BBEBKAGLYIMBCE-UHFFFAOYSA-N	50365416	CHEMBL1585484	Neuropeptide Y receptor type 5	Mus musculus		 20							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365416	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365416&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			2350190	136969478		CHEMBL1585484					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50720673	CCS(=O)(=O)c1ccc2oc(Nc3ccccc3)nc2c1	InChI=1S/C15H14N2O3S/c1-2-21(18,19)12-8-9-14-13(10-12)17-15(20-14)16-11-6-4-3-5-7-11/h3-10H,2H2,1H3,(H,16,17)	CXIPOZYVHWILNX-UHFFFAOYSA-N	50365417	CHEMBL1956841	Neuropeptide Y receptor type 5	Mus musculus		 1470							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365417	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365417&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			2418871	136969479		CHEMBL1956841					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50720674	CCS(=O)(=O)c1ccc2oc(Nc3ccc(Cl)cc3)nc2c1	InChI=1S/C15H13ClN2O3S/c1-2-22(19,20)12-7-8-14-13(9-12)18-15(21-14)17-11-5-3-10(16)4-6-11/h3-9H,2H2,1H3,(H,17,18)	NLILSYJGPHCGDH-UHFFFAOYSA-N	50365418	CHEMBL1956842	Neuropeptide Y receptor type 5	Mus musculus		 329							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365418	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365418&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			57403501	136969480		CHEMBL1956842					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50720675	CCS(=O)(=O)c1ccc2oc(Nc3ccc(cc3)C(F)(F)F)nc2c1	InChI=1S/C16H13F3N2O3S/c1-2-25(22,23)12-7-8-14-13(9-12)21-15(24-14)20-11-5-3-10(4-6-11)16(17,18)19/h3-9H,2H2,1H3,(H,20,21)	WPLIVZSQWJFXAP-UHFFFAOYSA-N	50365419	CHEMBL1956843	Neuropeptide Y receptor type 5	Mus musculus		 100							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365419	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365419&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			57393057	136969481		CHEMBL1956843					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50720676	CCS(=O)(=O)c1ccc2oc(Nc3cccc(c3)C(F)(F)F)nc2c1	InChI=1S/C16H13F3N2O3S/c1-2-25(22,23)12-6-7-14-13(9-12)21-15(24-14)20-11-5-3-4-10(8-11)16(17,18)19/h3-9H,2H2,1H3,(H,20,21)	AKYMZPXRNMDMCI-UHFFFAOYSA-N	50365420	CHEMBL1956844	Neuropeptide Y receptor type 5	Mus musculus		 144							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365420	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365420&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			57391273	136969482		CHEMBL1956844					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50720677	CCS(=O)(=O)c1ccc2oc(Nc3ccccc3C(F)(F)F)nc2c1	InChI=1S/C16H13F3N2O3S/c1-2-25(22,23)10-7-8-14-13(9-10)21-15(24-14)20-12-6-4-3-5-11(12)16(17,18)19/h3-9H,2H2,1H3,(H,20,21)	BTWIYBIENHHQGR-UHFFFAOYSA-N	50365421	CHEMBL1956845	Neuropeptide Y receptor type 5	Mus musculus		>10000							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365421	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365421&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			25346017	136969483		CHEMBL1956845					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50720678	CCS(=O)(=O)c1ccc2oc(Nc3ccc(cc3)C(C)(C)C)nc2c1	InChI=1S/C19H22N2O3S/c1-5-25(22,23)15-10-11-17-16(12-15)21-18(24-17)20-14-8-6-13(7-9-14)19(2,3)4/h6-12H,5H2,1-4H3,(H,20,21)	VMXLFQBJJMJNJY-UHFFFAOYSA-N	50365422	CHEMBL1578465	Neuropeptide Y receptor type 5	Mus musculus		 728							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365422	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365422&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			2418891	136969484		CHEMBL1578465					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50720679	CCS(=O)(=O)c1ccc2oc(Nc3ccc(OC(F)(F)F)cc3)nc2c1	InChI=1S/C16H13F3N2O4S/c1-2-26(22,23)12-7-8-14-13(9-12)21-15(24-14)20-10-3-5-11(6-4-10)25-16(17,18)19/h3-9H,2H2,1H3,(H,20,21)	PDDVJXJUKUXLDQ-UHFFFAOYSA-N	50365423	CHEMBL1956846	Neuropeptide Y receptor type 5	Mus musculus		 31							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365423	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365423&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			25346026	136969485		CHEMBL1956846					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50720680	CCS(=O)(=O)c1ccc2oc(Nc3ccc(OC(C)C)cc3)nc2c1	InChI=1S/C18H20N2O4S/c1-4-25(21,22)15-9-10-17-16(11-15)20-18(24-17)19-13-5-7-14(8-6-13)23-12(2)3/h5-12H,4H2,1-3H3,(H,19,20)	NYQQNQQELNMGGF-UHFFFAOYSA-N	50365424	CHEMBL1956847	Neuropeptide Y receptor type 5	Mus musculus		 9.1							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365424	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365424&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			57393058	136969486		CHEMBL1956847					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
50720681	CCS(=O)(=O)c1ccc2oc(Nc3ccc(cc3)N3CCOCC3)nc2c1	InChI=1S/C19H21N3O4S/c1-2-27(23,24)16-7-8-18-17(13-16)21-19(26-18)20-14-3-5-15(6-4-14)22-9-11-25-12-10-22/h3-8,13H,2,9-12H2,1H3,(H,20,21)	MDPFEFWECSNFRH-UHFFFAOYSA-N	50365425	CHEMBL1956848	Neuropeptide Y receptor type 5	Mus musculus		 219							ChEMBL	10.1016/j.bmcl.2012.01.027	10.7270/Q23F4Q41	22300657			Omori, N; Kouyama, N; Yukimasa, A; Watanabe, K; Yokota, Y; Tanioka, H; Nambu, H; Yukioka, H; Sato, N; Tanaka, Y; Sekiguchi, K; Okuno, T	2/21/2012	7/23/2012	Shionogi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365425	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6048&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365425&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search			57391274	136969487		CHEMBL1956848					1	MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS		Neuropeptide Y receptor type 5	NPY5R_MOUSE	O70342	O35380 Q9JMK1																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
