BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 51023453 Cc1nc(C(=O)N2CCCC[C@H]2CNC(=O)c2cccc3occc23)c(s1)-c1ccc(F)cc1 |r| InChI=1S/C26H24FN3O3S/c1-16-29-23(24(34-16)17-8-10-18(27)11-9-17)26(32)30-13-3-2-5-19(30)15-28-25(31)21-6-4-7-22-20(21)12-14-33-22/h4,6-12,14,19H,2-3,5,13,15H2,1H3,(H,28,31) ZJXIUGNEAIHSBI-UHFFFAOYSA-N 50417257 SB-649868 Orexin receptor type 2 Homo sapiens 1.29 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417257 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5447&target=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417257&enzyme=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 25195495 163366281 1 MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAGYIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVSCIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMVLAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARRKTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAANPIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKLSEQVVLTSISTLPAANGAGPLQNW 4S0V,5WS3,5WQC Orexin receptor type 2 OX2R_HUMAN O43614 Q5VTM0 51023454 Cc1nc(C(=O)N2CCCC[C@H]2CNC(=O)c2cccc3occc23)c(s1)-c1ccc(F)cc1 |r| InChI=1S/C26H24FN3O3S/c1-16-29-23(24(34-16)17-8-10-18(27)11-9-17)26(32)30-13-3-2-5-19(30)15-28-25(31)21-6-4-7-22-20(21)12-14-33-22/h4,6-12,14,19H,2-3,5,13,15H2,1H3,(H,28,31) ZJXIUGNEAIHSBI-UHFFFAOYSA-N 50417257 SB-649868 Orexin/Hypocretin receptor type 1 Homo sapiens 0.759 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417257 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5448&target=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417257&enzyme=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 25195495 163366281 1 MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP 4ZJC,4ZJ8 Orexin/Hypocretin receptor type 1 OX1R_HUMAN O43613 A8K3A6 Q9HBV6 51023455 Cc1nc(C(=O)N2CCCC[C@H]2CNC(=O)c2cccc3occc23)c(s1)-c1ccc(F)cc1 |r| InChI=1S/C26H24FN3O3S/c1-16-29-23(24(34-16)17-8-10-18(27)11-9-17)26(32)30-13-3-2-5-19(30)15-28-25(31)21-6-4-7-22-20(21)12-14-33-22/h4,6-12,14,19H,2-3,5,13,15H2,1H3,(H,28,31) ZJXIUGNEAIHSBI-UHFFFAOYSA-N 50417257 SB-649868 Orexin/Hypocretin receptor type 1 Rattus norvegicus 0.117 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417257 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5450&target=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417257&enzyme=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 25195495 163366281 1 MEPSATPGAQPGVPTSSGEPFHLPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFLIALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAVMVPQAAVMECSSVLPELANRTRLFSVCDERWADELYPKIYHSCFFFVTYLAPLGLMGMAYFQIFRKLWGPQIPGTTSALVRNWKRPSEQLEAQHQGLCTEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPSSSARHKSLSLQSRCSVSKVSEHVVLTTVTTVLS 6TQ9,6TP4,6TOT,6TOS,6TO7,4ZJC,4ZJ8 Orexin/Hypocretin receptor type 1 OX1R_RAT P56718 51023456 COc1cccc(c1)C(=O)N1CCCCC1CCOc1ccc(Cl)c(Cl)c1 InChI=1S/C21H23Cl2NO3/c1-26-17-7-4-5-15(13-17)21(25)24-11-3-2-6-16(24)10-12-27-18-8-9-19(22)20(23)14-18/h4-5,7-9,13-14,16H,2-3,6,10-12H2,1H3 CZWWVUYCUQLYEF-UHFFFAOYSA-N 50419130 CHEMBL1830956 Orexin/Hypocretin receptor type 1 Homo sapiens 125.89 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50419130 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5448&target=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50419130&enzyme=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 56670285 163368154 CHEMBL1830956 1 MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP 4ZJC,4ZJ8 Orexin/Hypocretin receptor type 1 OX1R_HUMAN O43613 A8K3A6 Q9HBV6 51023457 Cc1nc(C(=O)N2CCCC[C@H]2CNC(=O)c2cccc3occc23)c(s1)-c1ccc(F)cc1 |r| InChI=1S/C26H24FN3O3S/c1-16-29-23(24(34-16)17-8-10-18(27)11-9-17)26(32)30-13-3-2-5-19(30)15-28-25(31)21-6-4-7-22-20(21)12-14-33-22/h4,6-12,14,19H,2-3,5,13,15H2,1H3,(H,28,31) ZJXIUGNEAIHSBI-UHFFFAOYSA-N 50417257 SB-649868 Orexin/Hypocretin receptor type 1 Homo sapiens 0.316 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417257 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5448&target=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417257&enzyme=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 25195495 163366281 1 MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP 4ZJC,4ZJ8 Orexin/Hypocretin receptor type 1 OX1R_HUMAN O43613 A8K3A6 Q9HBV6 51023458 O=C(NC[C@@H]1CCCCN1C(=O)c1ccccc1-c1ccccc1)Nc1ccccc1 |r| InChI=1S/C26H27N3O2/c30-25(24-17-8-7-16-23(24)20-11-3-1-4-12-20)29-18-10-9-15-22(29)19-27-26(31)28-21-13-5-2-6-14-21/h1-8,11-14,16-17,22H,9-10,15,18-19H2,(H2,27,28,31) VCZBQPUFKCYVDZ-UHFFFAOYSA-N 50419131 CHEMBL1830968 Orexin receptor type 2 Homo sapiens 5.01 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50419131 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5447&target=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50419131&enzyme=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 56673798 163368155 CHEMBL1830968 1 MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAGYIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVSCIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMVLAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARRKTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAANPIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKLSEQVVLTSISTLPAANGAGPLQNW 4S0V,5WS3,5WQC Orexin receptor type 2 OX2R_HUMAN O43614 Q5VTM0 51023459 O=C(CC[C@@H]1CCCCN1C(=O)c1ccccc1-c1ccccc1)c1ccccc1 |r| InChI=1S/C27H27NO2/c29-26(22-13-5-2-6-14-22)19-18-23-15-9-10-20-28(23)27(30)25-17-8-7-16-24(25)21-11-3-1-4-12-21/h1-8,11-14,16-17,23H,9-10,15,18-20H2 PHXCUOPWSBXUHY-UHFFFAOYSA-N 50419132 CHEMBL1830967 Orexin receptor type 2 Homo sapiens 19.95 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50419132 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5447&target=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50419132&enzyme=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 56659966 163368156 CHEMBL1830967 1 MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAGYIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVSCIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMVLAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARRKTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAANPIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKLSEQVVLTSISTLPAANGAGPLQNW 4S0V,5WS3,5WQC Orexin receptor type 2 OX2R_HUMAN O43614 Q5VTM0 51023460 CN(C[C@@H]1CCCCN1C(=O)c1ccccc1-c1ccccc1)C(=O)c1ccc(F)cc1 |r| InChI=1S/C27H27FN2O2/c1-29(26(31)21-14-16-22(28)17-15-21)19-23-11-7-8-18-30(23)27(32)25-13-6-5-12-24(25)20-9-3-2-4-10-20/h2-6,9-10,12-17,23H,7-8,11,18-19H2,1H3 NGTJQUZOKBPHCP-UHFFFAOYSA-N 50419133 CHEMBL1830965 Orexin receptor type 2 Homo sapiens 1258.93 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50419133 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5447&target=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50419133&enzyme=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 56663428 163368157 CHEMBL1830965 1 MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAGYIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVSCIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMVLAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARRKTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAANPIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKLSEQVVLTSISTLPAANGAGPLQNW 4S0V,5WS3,5WQC Orexin receptor type 2 OX2R_HUMAN O43614 Q5VTM0 51023461 Fc1ccc(cc1)C(=O)NC[C@H]1CCCCN1C(=O)c1ccccc1-c1ccccc1 |r| InChI=1S/C26H25FN2O2/c27-21-15-13-20(14-16-21)25(30)28-18-22-10-6-7-17-29(22)26(31)24-12-5-4-11-23(24)19-8-2-1-3-9-19/h1-5,8-9,11-16,22H,6-7,10,17-18H2,(H,28,30) XHZWYNZVBWJJCI-UHFFFAOYSA-N 50419134 CHEMBL1830964 Orexin receptor type 2 Homo sapiens 31.62 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50419134 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5447&target=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50419134&enzyme=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 56680446 163368158 CHEMBL1830964 1 MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAGYIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVSCIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMVLAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARRKTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAANPIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKLSEQVVLTSISTLPAANGAGPLQNW 4S0V,5WS3,5WQC Orexin receptor type 2 OX2R_HUMAN O43614 Q5VTM0 51023462 O=C(NC[C@@H]1CCCCN1C(=O)c1ccccc1-c1ccccc1)c1ccccc1 |r| InChI=1S/C26H26N2O2/c29-25(21-13-5-2-6-14-21)27-19-22-15-9-10-18-28(22)26(30)24-17-8-7-16-23(24)20-11-3-1-4-12-20/h1-8,11-14,16-17,22H,9-10,15,18-19H2,(H,27,29) VEDWDLGLQNCUCW-UHFFFAOYSA-N 50419135 CHEMBL1830962 Orexin receptor type 2 Homo sapiens 19.95 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50419135 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5447&target=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50419135&enzyme=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 56680445 163368159 CHEMBL1830962 1 MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAGYIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVSCIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMVLAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARRKTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAANPIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKLSEQVVLTSISTLPAANGAGPLQNW 4S0V,5WS3,5WQC Orexin receptor type 2 OX2R_HUMAN O43614 Q5VTM0 51023463 Fc1ccc(OCC[C@@H]2CCCCN2C(=O)c2ccccc2-c2ccccc2)c(F)c1 |r| InChI=1S/C26H25F2NO2/c27-20-13-14-25(24(28)18-20)31-17-15-21-10-6-7-16-29(21)26(30)23-12-5-4-11-22(23)19-8-2-1-3-9-19/h1-5,8-9,11-14,18,21H,6-7,10,15-17H2 DBOQFZYFAREFRH-UHFFFAOYSA-N 50419136 CHEMBL1830961 Orexin receptor type 2 Homo sapiens 0.794 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50419136 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5447&target=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50419136&enzyme=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 56683774 163368160 CHEMBL1830961 1 MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAGYIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVSCIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMVLAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARRKTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAANPIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKLSEQVVLTSISTLPAANGAGPLQNW 4S0V,5WS3,5WQC Orexin receptor type 2 OX2R_HUMAN O43614 Q5VTM0 51023464 Fc1ccc(OCCC2CCCCN2C(=O)c2ccccc2-c2ccccc2)cc1 InChI=1S/C26H26FNO2/c27-21-13-15-23(16-14-21)30-19-17-22-10-6-7-18-28(22)26(29)25-12-5-4-11-24(25)20-8-2-1-3-9-20/h1-5,8-9,11-16,22H,6-7,10,17-19H2 PZTKKGBQVCJMCG-UHFFFAOYSA-N 50419137 CHEMBL1830959 Orexin receptor type 2 Homo sapiens 19.95 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50419137 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5447&target=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50419137&enzyme=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 10201185 163368161 CHEMBL1830959 1 MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAGYIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVSCIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMVLAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARRKTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAANPIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKLSEQVVLTSISTLPAANGAGPLQNW 4S0V,5WS3,5WQC Orexin receptor type 2 OX2R_HUMAN O43614 Q5VTM0 51023465 Clc1ccc(OCCC2CCCCN2C(=O)c2cccc(c2)C#N)cc1Cl InChI=1S/C21H20Cl2N2O2/c22-19-8-7-18(13-20(19)23)27-11-9-17-6-1-2-10-25(17)21(26)16-5-3-4-15(12-16)14-24/h3-5,7-8,12-13,17H,1-2,6,9-11H2 RRBNJFFSLKIBKR-UHFFFAOYSA-N 50419138 CHEMBL1830957 Orexin receptor type 2 Homo sapiens 630.96 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50419138 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5447&target=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50419138&enzyme=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 56680444 163368162 CHEMBL1830957 1 MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAGYIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVSCIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMVLAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARRKTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAANPIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKLSEQVVLTSISTLPAANGAGPLQNW 4S0V,5WS3,5WQC Orexin receptor type 2 OX2R_HUMAN O43614 Q5VTM0 51023466 COc1cccc(c1)C(=O)N1CCCCC1CCOc1ccc(Cl)c(Cl)c1 InChI=1S/C21H23Cl2NO3/c1-26-17-7-4-5-15(13-17)21(25)24-11-3-2-6-16(24)10-12-27-18-8-9-19(22)20(23)14-18/h4-5,7-9,13-14,16H,2-3,6,10-12H2,1H3 CZWWVUYCUQLYEF-UHFFFAOYSA-N 50419130 CHEMBL1830956 Orexin receptor type 2 Homo sapiens 501.19 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50419130 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5447&target=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50419130&enzyme=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 56670285 163368154 CHEMBL1830956 1 MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAGYIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVSCIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMVLAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARRKTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAANPIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKLSEQVVLTSISTLPAANGAGPLQNW 4S0V,5WS3,5WQC Orexin receptor type 2 OX2R_HUMAN O43614 Q5VTM0 51023467 O=C(NC[C@@H]1CCCCN1C(=O)c1ccccc1-c1ccccc1)Nc1ccccc1 |r| InChI=1S/C26H27N3O2/c30-25(24-17-8-7-16-23(24)20-11-3-1-4-12-20)29-18-10-9-15-22(29)19-27-26(31)28-21-13-5-2-6-14-21/h1-8,11-14,16-17,22H,9-10,15,18-19H2,(H2,27,28,31) VCZBQPUFKCYVDZ-UHFFFAOYSA-N 50419131 CHEMBL1830968 Orexin/Hypocretin receptor type 1 Homo sapiens 1 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50419131 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5448&target=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50419131&enzyme=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 56673798 163368155 CHEMBL1830968 1 MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP 4ZJC,4ZJ8 Orexin/Hypocretin receptor type 1 OX1R_HUMAN O43613 A8K3A6 Q9HBV6 51023468 Clc1ccc(OCCC2CCCCN2C(=O)c2cccc(c2)C#N)cc1Cl InChI=1S/C21H20Cl2N2O2/c22-19-8-7-18(13-20(19)23)27-11-9-17-6-1-2-10-25(17)21(26)16-5-3-4-15(12-16)14-24/h3-5,7-8,12-13,17H,1-2,6,9-11H2 RRBNJFFSLKIBKR-UHFFFAOYSA-N 50419138 CHEMBL1830957 Orexin/Hypocretin receptor type 1 Homo sapiens 398.11 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50419138 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5448&target=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50419138&enzyme=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 56680444 163368162 CHEMBL1830957 1 MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP 4ZJC,4ZJ8 Orexin/Hypocretin receptor type 1 OX1R_HUMAN O43613 A8K3A6 Q9HBV6 51023469 O=C(C[C@@H]1CCCCN1C(=O)c1ccccc1-c1ccccc1)Nc1ccccc1 |r| InChI=1S/C26H26N2O2/c29-25(27-21-13-5-2-6-14-21)19-22-15-9-10-18-28(22)26(30)24-17-8-7-16-23(24)20-11-3-1-4-12-20/h1-8,11-14,16-17,22H,9-10,15,18-19H2,(H,27,29) QFWLXMKJPUIGBV-UHFFFAOYSA-N 50419139 CHEMBL1830966 Orexin/Hypocretin receptor type 1 Homo sapiens 50.12 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50419139 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5448&target=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50419139&enzyme=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 56663429 163368163 CHEMBL1830966 1 MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP 4ZJC,4ZJ8 Orexin/Hypocretin receptor type 1 OX1R_HUMAN O43613 A8K3A6 Q9HBV6 51023470 CN(C[C@@H]1CCCCN1C(=O)c1ccccc1-c1ccccc1)C(=O)c1ccc(F)cc1 |r| InChI=1S/C27H27FN2O2/c1-29(26(31)21-14-16-22(28)17-15-21)19-23-11-7-8-18-30(23)27(32)25-13-6-5-12-24(25)20-9-3-2-4-10-20/h2-6,9-10,12-17,23H,7-8,11,18-19H2,1H3 NGTJQUZOKBPHCP-UHFFFAOYSA-N 50419133 CHEMBL1830965 Orexin/Hypocretin receptor type 1 Homo sapiens 501.19 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50419133 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5448&target=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50419133&enzyme=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 56663428 163368157 CHEMBL1830965 1 MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP 4ZJC,4ZJ8 Orexin/Hypocretin receptor type 1 OX1R_HUMAN O43613 A8K3A6 Q9HBV6 51023471 Fc1ccc(cc1)C(=O)NC[C@H]1CCCCN1C(=O)c1ccccc1-c1ccccc1 |r| InChI=1S/C26H25FN2O2/c27-21-15-13-20(14-16-21)25(30)28-18-22-10-6-7-17-29(22)26(31)24-12-5-4-11-23(24)19-8-2-1-3-9-19/h1-5,8-9,11-16,22H,6-7,10,17-18H2,(H,28,30) XHZWYNZVBWJJCI-UHFFFAOYSA-N 50419134 CHEMBL1830964 Orexin/Hypocretin receptor type 1 Homo sapiens 39.81 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50419134 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5448&target=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50419134&enzyme=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 56680446 163368158 CHEMBL1830964 1 MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP 4ZJC,4ZJ8 Orexin/Hypocretin receptor type 1 OX1R_HUMAN O43613 A8K3A6 Q9HBV6 51023472 O=C(NC[C@@H]1CCCCN1C(=O)c1ccccc1-c1ccccc1)c1ccccc1 |r| InChI=1S/C26H26N2O2/c29-25(21-13-5-2-6-14-21)27-19-22-15-9-10-18-28(22)26(30)24-17-8-7-16-23(24)20-11-3-1-4-12-20/h1-8,11-14,16-17,22H,9-10,15,18-19H2,(H,27,29) VEDWDLGLQNCUCW-UHFFFAOYSA-N 50419135 CHEMBL1830962 Orexin/Hypocretin receptor type 1 Homo sapiens 7.94 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50419135 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5448&target=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50419135&enzyme=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 56680445 163368159 CHEMBL1830962 1 MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP 4ZJC,4ZJ8 Orexin/Hypocretin receptor type 1 OX1R_HUMAN O43613 A8K3A6 Q9HBV6 51023473 Fc1ccc(OCC[C@@H]2CCCCN2C(=O)c2ccccc2-c2ccccc2)c(F)c1 |r| InChI=1S/C26H25F2NO2/c27-20-13-14-25(24(28)18-20)31-17-15-21-10-6-7-16-29(21)26(30)23-12-5-4-11-22(23)19-8-2-1-3-9-19/h1-5,8-9,11-14,18,21H,6-7,10,15-17H2 DBOQFZYFAREFRH-UHFFFAOYSA-N 50419136 CHEMBL1830961 Orexin/Hypocretin receptor type 1 Homo sapiens 0.158 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50419136 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5448&target=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50419136&enzyme=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 56683774 163368160 CHEMBL1830961 1 MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP 4ZJC,4ZJ8 Orexin/Hypocretin receptor type 1 OX1R_HUMAN O43613 A8K3A6 Q9HBV6 51023474 Fc1ccc(OCC[C@@H]2CCCCN2C(=O)c2cccc3ccccc23)cc1 |r| InChI=1S/C24H24FNO2/c25-19-11-13-21(14-12-19)28-17-15-20-8-3-4-16-26(20)24(27)23-10-5-7-18-6-1-2-9-22(18)23/h1-2,5-7,9-14,20H,3-4,8,15-17H2 HZRQWFQNAXXWSG-UHFFFAOYSA-N 50419140 CHEMBL1830960 Orexin/Hypocretin receptor type 1 Homo sapiens 6.31 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50419140 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5448&target=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50419140&enzyme=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 56673797 163368164 CHEMBL1830960 1 MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP 4ZJC,4ZJ8 Orexin/Hypocretin receptor type 1 OX1R_HUMAN O43613 A8K3A6 Q9HBV6 51023475 Fc1ccc(OCCC2CCCCN2C(=O)c2ccccc2-c2ccccc2)cc1 InChI=1S/C26H26FNO2/c27-21-13-15-23(16-14-21)30-19-17-22-10-6-7-18-28(22)26(29)25-12-5-4-11-24(25)20-8-2-1-3-9-20/h1-5,8-9,11-16,22H,6-7,10,17-19H2 PZTKKGBQVCJMCG-UHFFFAOYSA-N 50419137 CHEMBL1830959 Orexin/Hypocretin receptor type 1 Homo sapiens 5.01 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50419137 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5448&target=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50419137&enzyme=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 10201185 163368161 CHEMBL1830959 1 MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP 4ZJC,4ZJ8 Orexin/Hypocretin receptor type 1 OX1R_HUMAN O43613 A8K3A6 Q9HBV6 51023476 Clc1ccc(OCCC2CCCCN2C(=O)c2ccc(Cl)c(Cl)c2)cc1Cl InChI=1S/C20H19Cl4NO2/c21-16-6-4-13(11-18(16)23)20(26)25-9-2-1-3-14(25)8-10-27-15-5-7-17(22)19(24)12-15/h4-7,11-12,14H,1-3,8-10H2 NTLDOCBFCPCJIF-UHFFFAOYSA-N 50419141 CHEMBL1830958 Orexin receptor type 2 Homo sapiens >3162.28 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50419141 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5447&target=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50419141&enzyme=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 56673796 163368165 CHEMBL1830958 1 MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAGYIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVSCIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMVLAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARRKTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAANPIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKLSEQVVLTSISTLPAANGAGPLQNW 4S0V,5WS3,5WQC Orexin receptor type 2 OX2R_HUMAN O43614 Q5VTM0 51023477 Fc1ccc(cc1)C(=O)NC[C@@H]1CCCCN1C(=O)c1ccccc1-c1ccccc1 |r| InChI=1S/C26H25FN2O2/c27-21-15-13-20(14-16-21)25(30)28-18-22-10-6-7-17-29(22)26(31)24-12-5-4-11-23(24)19-8-2-1-3-9-19/h1-5,8-9,11-16,22H,6-7,10,17-18H2,(H,28,30) XHZWYNZVBWJJCI-UHFFFAOYSA-N 50419142 CHEMBL1830963 Orexin receptor type 2 Homo sapiens 0.251 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50419142 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5447&target=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50419142&enzyme=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 56683775 163368166 CHEMBL1830963 1 MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAGYIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVSCIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMVLAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARRKTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAANPIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKLSEQVVLTSISTLPAANGAGPLQNW 4S0V,5WS3,5WQC Orexin receptor type 2 OX2R_HUMAN O43614 Q5VTM0 51023478 Cc1nc(C(=O)N2CCCC[C@H]2CNC(=O)c2cccc3occc23)c(s1)-c1ccc(F)cc1 |r| InChI=1S/C26H24FN3O3S/c1-16-29-23(24(34-16)17-8-10-18(27)11-9-17)26(32)30-13-3-2-5-19(30)15-28-25(31)21-6-4-7-22-20(21)12-14-33-22/h4,6-12,14,19H,2-3,5,13,15H2,1H3,(H,28,31) ZJXIUGNEAIHSBI-UHFFFAOYSA-N 50417257 SB-649868 Orexin receptor type 2 Rattus norvegicus 0.0776 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417257 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5449&target=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417257&enzyme=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 25195495 163366281 1 MSSTKLEDSLPRRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAGYIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVVIWIVSCIIMIPQAIVMERSSMLPGLANKTTLFTVCDERWGGEVYPKMYHICFFLVTYMAPLCLMVLAYLQIFRKLWCRQIPGTSSVVQRKWKQPQPVSQPRGSGQQSKARISAVAAEIKQIRARRKTARMLMVVLLVFAICYLPISILNVLKRVFGMFTHTEDRETVYAWFTFSHWLVYANSAANPIIYNFLSGKFREEFKAAFSCCLGVHRRQGDRLARGRTSTESRKSLTTQISNFDNVSKLSEHVALTSISTLPAANGAGPLQNWYLQQGVPSSLLSTWLEV Orexin receptor type 2 OX2R_RAT P56719 51023479 O=C(C[C@@H]1CCCCN1C(=O)c1ccccc1-c1ccccc1)Nc1ccccc1 |r| InChI=1S/C26H26N2O2/c29-25(27-21-13-5-2-6-14-21)19-22-15-9-10-18-28(22)26(30)24-17-8-7-16-23(24)20-11-3-1-4-12-20/h1-8,11-14,16-17,22H,9-10,15,18-19H2,(H,27,29) QFWLXMKJPUIGBV-UHFFFAOYSA-N 50419139 CHEMBL1830966 Orexin receptor type 2 Homo sapiens 31.62 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50419139 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5447&target=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50419139&enzyme=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 56663429 163368163 CHEMBL1830966 1 MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAGYIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVSCIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMVLAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARRKTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAANPIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKLSEQVVLTSISTLPAANGAGPLQNW 4S0V,5WS3,5WQC Orexin receptor type 2 OX2R_HUMAN O43614 Q5VTM0 51023480 Fc1ccc(OCC[C@@H]2CCCCN2C(=O)c2cccc3ccccc23)cc1 |r| InChI=1S/C24H24FNO2/c25-19-11-13-21(14-12-19)28-17-15-20-8-3-4-16-26(20)24(27)23-10-5-7-18-6-1-2-9-22(18)23/h1-2,5-7,9-14,20H,3-4,8,15-17H2 HZRQWFQNAXXWSG-UHFFFAOYSA-N 50419140 CHEMBL1830960 Orexin receptor type 2 Homo sapiens 125.89 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50419140 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5447&target=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50419140&enzyme=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 56673797 163368164 CHEMBL1830960 1 MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAGYIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVSCIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMVLAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARRKTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAANPIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKLSEQVVLTSISTLPAANGAGPLQNW 4S0V,5WS3,5WQC Orexin receptor type 2 OX2R_HUMAN O43614 Q5VTM0 51023481 O=C(CC[C@@H]1CCCCN1C(=O)c1ccccc1-c1ccccc1)c1ccccc1 |r| InChI=1S/C27H27NO2/c29-26(22-13-5-2-6-14-22)19-18-23-15-9-10-20-28(23)27(30)25-17-8-7-16-24(25)21-11-3-1-4-12-21/h1-8,11-14,16-17,23H,9-10,15,18-20H2 PHXCUOPWSBXUHY-UHFFFAOYSA-N 50419132 CHEMBL1830967 Orexin/Hypocretin receptor type 1 Homo sapiens 10 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50419132 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5448&target=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50419132&enzyme=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 56659966 163368156 CHEMBL1830967 1 MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP 4ZJC,4ZJ8 Orexin/Hypocretin receptor type 1 OX1R_HUMAN O43613 A8K3A6 Q9HBV6 51023482 Fc1ccc(cc1)C(=O)NC[C@@H]1CCCCN1C(=O)c1ccccc1-c1ccccc1 |r| InChI=1S/C26H25FN2O2/c27-21-15-13-20(14-16-21)25(30)28-18-22-10-6-7-17-29(22)26(31)24-12-5-4-11-23(24)19-8-2-1-3-9-19/h1-5,8-9,11-16,22H,6-7,10,17-18H2,(H,28,30) XHZWYNZVBWJJCI-UHFFFAOYSA-N 50419142 CHEMBL1830963 Orexin/Hypocretin receptor type 1 Homo sapiens 0.126 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50419142 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5448&target=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50419142&enzyme=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 56683775 163368166 CHEMBL1830963 1 MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP 4ZJC,4ZJ8 Orexin/Hypocretin receptor type 1 OX1R_HUMAN O43613 A8K3A6 Q9HBV6 51023483 Clc1ccc(OCCC2CCCCN2C(=O)c2ccc(Cl)c(Cl)c2)cc1Cl InChI=1S/C20H19Cl4NO2/c21-16-6-4-13(11-18(16)23)20(26)25-9-2-1-3-14(25)8-10-27-15-5-7-17(22)19(24)12-15/h4-7,11-12,14H,1-3,8-10H2 NTLDOCBFCPCJIF-UHFFFAOYSA-N 50419141 CHEMBL1830958 Orexin/Hypocretin receptor type 1 Homo sapiens 2511.89 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50419141 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5448&target=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50419141&enzyme=Orexin%2FHypocretin+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 56673796 163368165 CHEMBL1830958 1 MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP 4ZJC,4ZJ8 Orexin/Hypocretin receptor type 1 OX1R_HUMAN O43613 A8K3A6 Q9HBV6 51023484 Cc1nc(C(=O)N2CCCC[C@H]2CNC(=O)c2cccc3occc23)c(s1)-c1ccc(F)cc1 |r| InChI=1S/C26H24FN3O3S/c1-16-29-23(24(34-16)17-8-10-18(27)11-9-17)26(32)30-13-3-2-5-19(30)15-28-25(31)21-6-4-7-22-20(21)12-14-33-22/h4,6-12,14,19H,2-3,5,13,15H2,1H3,(H,28,31) ZJXIUGNEAIHSBI-UHFFFAOYSA-N 50417257 SB-649868 Orexin receptor type 2 Homo sapiens 0.398 ChEMBL 10.1016/j.bmcl.2011.06.086 10.7270/Q29K4CGM 21831639 Di Fabio, R; Pellacani, A; Faedo, S; Roth, A; Piccoli, L; Gerrard, P; Porter, RA; Johnson, CN; Thewlis, K; Donati, D; Stasi, L; Spada, S; Stemp, G; Nash, D; Branch, C; Kindon, L; Massagrande, M; Poffe, A; Braggio, S; Chiarparin, E; Marchioro, C; Ratti, E; Corsi, M 8/22/2011 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417257 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5447&target=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417257&enzyme=Orexin+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 25195495 163366281 1 MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAGYIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVSCIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMVLAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARRKTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAANPIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKLSEQVVLTSISTLPAANGAGPLQNW 4S0V,5WS3,5WQC Orexin receptor type 2 OX2R_HUMAN O43614 Q5VTM0