BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50651402 Cc1c(C)c2cc(Cl)cc(Cn3c4ccccc4n(CCC(O)=O)c3=O)c2n1C InChI=1S/C22H22ClN3O3/c1-13-14(2)24(3)21-15(10-16(23)11-17(13)21)12-26-19-7-5-4-6-18(19)25(22(26)29)9-8-20(27)28/h4-7,10-11H,8-9,12H2,1-3H3,(H,27,28) CUTXBCGRPNWRNY-UHFFFAOYSA-N 50349172 CHEMBL1807640 Chymase Homo sapiens 25 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349172 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349172&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 25124204 136355858 CHEMBL1807640 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50651403 Cc1c(C)c2cc(C)cc(Cn3c4ccccc4n(CCC(O)=O)c3=O)c2n1C InChI=1S/C23H25N3O3/c1-14-11-17(22-18(12-14)15(2)16(3)24(22)4)13-26-20-8-6-5-7-19(20)25(23(26)29)10-9-21(27)28/h5-8,11-12H,9-10,13H2,1-4H3,(H,27,28) ILQOUSOBJCSXMV-UHFFFAOYSA-N 50349173 CHEMBL1807638 Chymase Homo sapiens 65 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349173 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349173&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 56670149 136355859 CHEMBL1807638 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50651404 Cc1cccc2scc(Cn3c4ccccc4n(CCC(O)=O)c3=O)c12 InChI=1S/C20H18N2O3S/c1-13-5-4-8-17-19(13)14(12-26-17)11-22-16-7-3-2-6-15(16)21(20(22)25)10-9-18(23)24/h2-8,12H,9-11H2,1H3,(H,23,24) XAIBYEBSDCVCAA-UHFFFAOYSA-N 50349174 CHEMBL1807526 Chymase Homo sapiens 70 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349174 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349174&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 56666720 136355860 CHEMBL1807526 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50651405 Cc1c(C)c2cccc(Cn3c4ccccc4n(CCC(O)=O)c3=O)c2n1C InChI=1S/C22H23N3O3/c1-14-15(2)23(3)21-16(7-6-8-17(14)21)13-25-19-10-5-4-9-18(19)24(22(25)28)12-11-20(26)27/h4-10H,11-13H2,1-3H3,(H,26,27) BPDSRNQUOWYMRI-UHFFFAOYSA-N 50349175 CHEMBL1807637 Chymase Homo sapiens 140 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349175 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349175&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 56673664 136355861 CHEMBL1807637 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50651406 Cc1cccc2n(C)cc(Cn3c4ccccc4n(CCC(O)=O)c3=O)c12 InChI=1S/C21H21N3O3/c1-14-6-5-9-18-20(14)15(12-22(18)2)13-24-17-8-4-3-7-16(17)23(21(24)27)11-10-19(25)26/h3-9,12H,10-11,13H2,1-2H3,(H,25,26) GWKLGCTZOZIBKD-UHFFFAOYSA-N 50349176 CHEMBL1807531 Chymase Homo sapiens 170 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349176 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349176&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 56673658 136355862 CHEMBL1807531 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50651407 COc1cc(Cn2c3ccccc3n(CCC(O)=O)c2=O)c2n(C)c(C)c(C)c2c1 InChI=1S/C23H25N3O4/c1-14-15(2)24(3)22-16(11-17(30-4)12-18(14)22)13-26-20-8-6-5-7-19(20)25(23(26)29)10-9-21(27)28/h5-8,11-12H,9-10,13H2,1-4H3,(H,27,28) AVHYDKUKVRQUSH-UHFFFAOYSA-N 50349177 CHEMBL1807639 Chymase Homo sapiens 220 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349177 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349177&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 56680314 136355863 CHEMBL1807639 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50651408 Cc1cc(C)c2c(Cn3c4ccccc4n(CCC(O)=O)c3=O)nsc2c1 InChI=1S/C20H19N3O3S/c1-12-9-13(2)19-14(21-27-17(19)10-12)11-23-16-6-4-3-5-15(16)22(20(23)26)8-7-18(24)25/h3-6,9-10H,7-8,11H2,1-2H3,(H,24,25) PURFUAGIJITRCK-UHFFFAOYSA-N 50349178 CHEMBL1807535 Chymase Homo sapiens 280 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349178 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349178&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 56683634 136355864 CHEMBL1807535 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50651409 Cc1cc2cccc(Cn3c4ccccc4n(CCC(O)=O)c3=O)c2n1C InChI=1S/C21H21N3O3/c1-14-12-15-6-5-7-16(20(15)22(14)2)13-24-18-9-4-3-8-17(18)23(21(24)27)11-10-19(25)26/h3-9,12H,10-11,13H2,1-2H3,(H,25,26) ZSHFBKUFTINGGX-UHFFFAOYSA-N 50349179 CHEMBL1807537 Chymase Homo sapiens 570 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349179 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349179&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 56670144 136355865 CHEMBL1807537 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50651410 OC(=O)CCn1c2ccccc2n(Cc2cccc3ccccc23)c1=O InChI=1S/C21H18N2O3/c24-20(25)12-13-22-18-10-3-4-11-19(18)23(21(22)26)14-16-8-5-7-15-6-1-2-9-17(15)16/h1-11H,12-14H2,(H,24,25) YVAUFFDNRVGJTL-UHFFFAOYSA-N 50349180 CHEMBL1807530 Chymase Homo sapiens 600 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349180 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349180&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 56666721 136355866 CHEMBL1807530 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50651411 Cn1ccc2cccc(Cn3c4ccccc4n(CCC(O)=O)c3=O)c12 InChI=1S/C20H19N3O3/c1-21-11-9-14-5-4-6-15(19(14)21)13-23-17-8-3-2-7-16(17)22(20(23)26)12-10-18(24)25/h2-9,11H,10,12-13H2,1H3,(H,24,25) TZCAASKTWHNUDD-UHFFFAOYSA-N 50349181 CHEMBL1807536 Chymase Homo sapiens 620 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349181 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349181&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 56663296 136355867 CHEMBL1807536 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50651412 Cc1cccc2c(cc(Cn3c4ccccc4n(CCC(O)=O)c3=O)n12)C#N InChI=1S/C21H18N4O3/c1-14-5-4-8-17-15(12-22)11-16(25(14)17)13-24-19-7-3-2-6-18(19)23(21(24)28)10-9-20(26)27/h2-8,11H,9-10,13H2,1H3,(H,26,27) SCYHTEYQSXYNIX-UHFFFAOYSA-N 50349182 CHEMBL1807534 Chymase Homo sapiens 640 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349182 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349182&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 56680307 136355868 CHEMBL1807534 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50651413 Cc1cn(C)c2c(Cn3c4ccccc4n(CCC(O)=O)c3=O)cccc12 InChI=1S/C21H21N3O3/c1-14-12-22(2)20-15(6-5-7-16(14)20)13-24-18-9-4-3-8-17(18)23(21(24)27)11-10-19(25)26/h3-9,12H,10-11,13H2,1-2H3,(H,25,26) ZJLQFSBJVCYOKQ-UHFFFAOYSA-N 50349183 CHEMBL1807538 Chymase Homo sapiens 640 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349183 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349183&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 56673659 136355869 CHEMBL1807538 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50651414 OC(=O)CCn1c2ccccc2n(Cc2csc3ccccc23)c1=O InChI=1S/C19H16N2O3S/c22-18(23)9-10-20-15-6-2-3-7-16(15)21(19(20)24)11-13-12-25-17-8-4-1-5-14(13)17/h1-8,12H,9-11H2,(H,22,23) YTPYKGNAYKDPHG-UHFFFAOYSA-N 50349184 CHEMBL1807527 Chymase Homo sapiens 1900 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349184 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349184&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 56683631 136355870 CHEMBL1807527 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50651415 Cn1cc(Cn2c3ccccc3n(CCC(O)=O)c2=O)c2ccccc12 InChI=1S/C20H19N3O3/c1-21-12-14(15-6-2-3-7-16(15)21)13-23-18-9-5-4-8-17(18)22(20(23)26)11-10-19(24)25/h2-9,12H,10-11,13H2,1H3,(H,24,25) VDDMBFLPHXHTJH-UHFFFAOYSA-N 50349185 CHEMBL1807529 Chymase Homo sapiens 2600 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349185 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349185&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 56683632 136355871 CHEMBL1807529 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50651416 Cc1cn(C)c2cccc(Cn3c4ccccc4n(CCC(O)=O)c3=O)c12 InChI=1S/C21H21N3O3/c1-14-12-22(2)18-9-5-6-15(20(14)18)13-24-17-8-4-3-7-16(17)23(21(24)27)11-10-19(25)26/h3-9,12H,10-11,13H2,1-2H3,(H,25,26) LQNSZXFCWJXNPL-UHFFFAOYSA-N 50349186 CHEMBL1807539 Chymase Homo sapiens 2800 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349186 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349186&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 56666722 136355872 CHEMBL1807539 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50651417 OC(=O)CCn1c2ccccc2n(Cc2nsc3ccccc23)c1=O InChI=1S/C18H15N3O3S/c22-17(23)9-10-20-14-6-2-3-7-15(14)21(18(20)24)11-13-12-5-1-4-8-16(12)25-19-13/h1-8H,9-11H2,(H,22,23) UWTUPAGKZAKECK-UHFFFAOYSA-N 50349187 CHEMBL1807528 Chymase Homo sapiens 4200 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349187 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349187&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 56659828 136355873 CHEMBL1807528 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50651418 OC(=O)CCn1c2ccccc2n(Cc2csc3ccccc23)c1=O InChI=1S/C19H16N2O3S/c22-18(23)9-10-20-15-6-2-3-7-16(15)21(19(20)24)11-13-12-25-17-8-4-1-5-14(13)17/h1-8,12H,9-11H2,(H,22,23) YTPYKGNAYKDPHG-UHFFFAOYSA-N 50349184 CHEMBL1807527 Cathepsin G Homo sapiens >10 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349184 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000683&target=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349184&enzyme=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search 56683631 136355870 CHEMBL1807527 1 MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL 7H6H,7H6G,1KYN,6VTM,1T32,1CGH,1AU8,9ATK,9ASX,8G26,8G25,8G24,8D7K,8D7I,8D4V,8D4S Cathepsin G CATG_HUMAN P08311 Q6IBJ6 Q9UCA5 Q9UCU6 50651419 OC(=O)CCn1c2ccccc2n(Cc2nsc3ccccc23)c1=O InChI=1S/C18H15N3O3S/c22-17(23)9-10-20-14-6-2-3-7-15(14)21(18(20)24)11-13-12-5-1-4-8-16(12)25-19-13/h1-8H,9-11H2,(H,22,23) UWTUPAGKZAKECK-UHFFFAOYSA-N 50349187 CHEMBL1807528 Cathepsin G Homo sapiens >10 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349187 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000683&target=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349187&enzyme=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search 56659828 136355873 CHEMBL1807528 1 MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL 7H6H,7H6G,1KYN,6VTM,1T32,1CGH,1AU8,9ATK,9ASX,8G26,8G25,8G24,8D7K,8D7I,8D4V,8D4S Cathepsin G CATG_HUMAN P08311 Q6IBJ6 Q9UCA5 Q9UCU6 50651420 Cn1cc(Cn2c3ccccc3n(CCC(O)=O)c2=O)c2ccccc12 InChI=1S/C20H19N3O3/c1-21-12-14(15-6-2-3-7-16(15)21)13-23-18-9-5-4-8-17(18)22(20(23)26)11-10-19(24)25/h2-9,12H,10-11,13H2,1H3,(H,24,25) VDDMBFLPHXHTJH-UHFFFAOYSA-N 50349185 CHEMBL1807529 Cathepsin G Homo sapiens >10 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349185 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000683&target=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349185&enzyme=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search 56683632 136355871 CHEMBL1807529 1 MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL 7H6H,7H6G,1KYN,6VTM,1T32,1CGH,1AU8,9ATK,9ASX,8G26,8G25,8G24,8D7K,8D7I,8D4V,8D4S Cathepsin G CATG_HUMAN P08311 Q6IBJ6 Q9UCA5 Q9UCU6 50651421 OC(=O)CCn1c2ccccc2n(Cc2cccc3ccccc23)c1=O InChI=1S/C21H18N2O3/c24-20(25)12-13-22-18-10-3-4-11-19(18)23(21(22)26)14-16-8-5-7-15-6-1-2-9-17(15)16/h1-11H,12-14H2,(H,24,25) YVAUFFDNRVGJTL-UHFFFAOYSA-N 50349180 CHEMBL1807530 Cathepsin G Homo sapiens >10 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349180 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000683&target=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349180&enzyme=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search 56666721 136355866 CHEMBL1807530 1 MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL 7H6H,7H6G,1KYN,6VTM,1T32,1CGH,1AU8,9ATK,9ASX,8G26,8G25,8G24,8D7K,8D7I,8D4V,8D4S Cathepsin G CATG_HUMAN P08311 Q6IBJ6 Q9UCA5 Q9UCU6 50651422 Cc1cccc2ncc(Cn3c4ccccc4n(CCC(O)=O)c3=O)n12 InChI=1S/C19H18N4O3/c1-13-5-4-8-17-20-11-14(23(13)17)12-22-16-7-3-2-6-15(16)21(19(22)26)10-9-18(24)25/h2-8,11H,9-10,12H2,1H3,(H,24,25) HKSFJWVONYBSCN-UHFFFAOYSA-N 50349188 CHEMBL1807532 Cathepsin G Homo sapiens >10 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349188 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000683&target=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349188&enzyme=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search 56683633 136355874 CHEMBL1807532 1 MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL 7H6H,7H6G,1KYN,6VTM,1T32,1CGH,1AU8,9ATK,9ASX,8G26,8G25,8G24,8D7K,8D7I,8D4V,8D4S Cathepsin G CATG_HUMAN P08311 Q6IBJ6 Q9UCA5 Q9UCU6 50651423 Cc1cccn2ncc(Cn3c4ccccc4n(CCC(O)=O)c3=O)c12 InChI=1S/C19H18N4O3/c1-13-5-4-9-23-18(13)14(11-20-23)12-22-16-7-3-2-6-15(16)21(19(22)26)10-8-17(24)25/h2-7,9,11H,8,10,12H2,1H3,(H,24,25) WIWJJHGROUUGDX-UHFFFAOYSA-N 50349189 CHEMBL1807533 Cathepsin G Homo sapiens >10 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349189 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000683&target=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349189&enzyme=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search 56680306 136355875 CHEMBL1807533 1 MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL 7H6H,7H6G,1KYN,6VTM,1T32,1CGH,1AU8,9ATK,9ASX,8G26,8G25,8G24,8D7K,8D7I,8D4V,8D4S Cathepsin G CATG_HUMAN P08311 Q6IBJ6 Q9UCA5 Q9UCU6 50651424 Cc1cccc2c(cc(Cn3c4ccccc4n(CCC(O)=O)c3=O)n12)C#N InChI=1S/C21H18N4O3/c1-14-5-4-8-17-15(12-22)11-16(25(14)17)13-24-19-7-3-2-6-18(19)23(21(24)28)10-9-20(26)27/h2-8,11H,9-10,13H2,1H3,(H,26,27) SCYHTEYQSXYNIX-UHFFFAOYSA-N 50349182 CHEMBL1807534 Cathepsin G Homo sapiens >10 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349182 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000683&target=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349182&enzyme=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search 56680307 136355868 CHEMBL1807534 1 MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL 7H6H,7H6G,1KYN,6VTM,1T32,1CGH,1AU8,9ATK,9ASX,8G26,8G25,8G24,8D7K,8D7I,8D4V,8D4S Cathepsin G CATG_HUMAN P08311 Q6IBJ6 Q9UCA5 Q9UCU6 50651425 Cn1ccc2cccc(Cn3c4ccccc4n(CCC(O)=O)c3=O)c12 InChI=1S/C20H19N3O3/c1-21-11-9-14-5-4-6-15(19(14)21)13-23-17-8-3-2-7-16(17)22(20(23)26)12-10-18(24)25/h2-9,11H,10,12-13H2,1H3,(H,24,25) TZCAASKTWHNUDD-UHFFFAOYSA-N 50349181 CHEMBL1807536 Cathepsin G Homo sapiens >10 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349181 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000683&target=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349181&enzyme=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search 56663296 136355867 CHEMBL1807536 1 MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL 7H6H,7H6G,1KYN,6VTM,1T32,1CGH,1AU8,9ATK,9ASX,8G26,8G25,8G24,8D7K,8D7I,8D4V,8D4S Cathepsin G CATG_HUMAN P08311 Q6IBJ6 Q9UCA5 Q9UCU6 50651426 Cc1cc2cccc(Cn3c4ccccc4n(CCC(O)=O)c3=O)c2n1C InChI=1S/C21H21N3O3/c1-14-12-15-6-5-7-16(20(15)22(14)2)13-24-18-9-4-3-8-17(18)23(21(24)27)11-10-19(25)26/h3-9,12H,10-11,13H2,1-2H3,(H,25,26) ZSHFBKUFTINGGX-UHFFFAOYSA-N 50349179 CHEMBL1807537 Cathepsin G Homo sapiens >10 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349179 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000683&target=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349179&enzyme=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search 56670144 136355865 CHEMBL1807537 1 MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL 7H6H,7H6G,1KYN,6VTM,1T32,1CGH,1AU8,9ATK,9ASX,8G26,8G25,8G24,8D7K,8D7I,8D4V,8D4S Cathepsin G CATG_HUMAN P08311 Q6IBJ6 Q9UCA5 Q9UCU6 50651427 Cc1cn(C)c2cccc(Cn3c4ccccc4n(CCC(O)=O)c3=O)c12 InChI=1S/C21H21N3O3/c1-14-12-22(2)18-9-5-6-15(20(14)18)13-24-17-8-4-3-7-16(17)23(21(24)27)11-10-19(25)26/h3-9,12H,10-11,13H2,1-2H3,(H,25,26) LQNSZXFCWJXNPL-UHFFFAOYSA-N 50349186 CHEMBL1807539 Cathepsin G Homo sapiens >10 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349186 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000683&target=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349186&enzyme=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search 56666722 136355872 CHEMBL1807539 1 MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL 7H6H,7H6G,1KYN,6VTM,1T32,1CGH,1AU8,9ATK,9ASX,8G26,8G25,8G24,8D7K,8D7I,8D4V,8D4S Cathepsin G CATG_HUMAN P08311 Q6IBJ6 Q9UCA5 Q9UCU6 50651428 Cc1c(C)c2cccc(Cn3c4ccccc4n(CCC(O)=O)c3=O)c2n1C InChI=1S/C22H23N3O3/c1-14-15(2)23(3)21-16(7-6-8-17(14)21)13-25-19-10-5-4-9-18(19)24(22(25)28)12-11-20(26)27/h4-10H,11-13H2,1-3H3,(H,26,27) BPDSRNQUOWYMRI-UHFFFAOYSA-N 50349175 CHEMBL1807637 Cathepsin G Homo sapiens >10 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349175 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000683&target=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349175&enzyme=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search 56673664 136355861 CHEMBL1807637 1 MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL 7H6H,7H6G,1KYN,6VTM,1T32,1CGH,1AU8,9ATK,9ASX,8G26,8G25,8G24,8D7K,8D7I,8D4V,8D4S Cathepsin G CATG_HUMAN P08311 Q6IBJ6 Q9UCA5 Q9UCU6 50651429 COc1cc(Cn2c3ccccc3n(CCC(O)=O)c2=O)c2n(C)c(C)c(C)c2c1 InChI=1S/C23H25N3O4/c1-14-15(2)24(3)22-16(11-17(30-4)12-18(14)22)13-26-20-8-6-5-7-19(20)25(23(26)29)10-9-21(27)28/h5-8,11-12H,9-10,13H2,1-4H3,(H,27,28) AVHYDKUKVRQUSH-UHFFFAOYSA-N 50349177 CHEMBL1807639 Cathepsin G Homo sapiens >10 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349177 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000683&target=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349177&enzyme=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search 56680314 136355863 CHEMBL1807639 1 MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL 7H6H,7H6G,1KYN,6VTM,1T32,1CGH,1AU8,9ATK,9ASX,8G26,8G25,8G24,8D7K,8D7I,8D4V,8D4S Cathepsin G CATG_HUMAN P08311 Q6IBJ6 Q9UCA5 Q9UCU6 50651430 Cc1c(C)c2ccc(Cl)c(Cn3c4ccccc4n(CCC(O)=O)c3=O)c2n1C InChI=1S/C22H22ClN3O3/c1-13-14(2)24(3)21-15(13)8-9-17(23)16(21)12-26-19-7-5-4-6-18(19)25(22(26)29)11-10-20(27)28/h4-9H,10-12H2,1-3H3,(H,27,28) UJHRTHARCWKXDA-UHFFFAOYSA-N 50349190 CHEMBL1807641 Cathepsin G Homo sapiens >10 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349190 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000683&target=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349190&enzyme=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search 56676983 136355876 CHEMBL1807641 1 MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL 7H6H,7H6G,1KYN,6VTM,1T32,1CGH,1AU8,9ATK,9ASX,8G26,8G25,8G24,8D7K,8D7I,8D4V,8D4S Cathepsin G CATG_HUMAN P08311 Q6IBJ6 Q9UCA5 Q9UCU6 50651431 Cc1cccc2ncc(Cn3c4ccccc4n(CCC(O)=O)c3=O)n12 InChI=1S/C19H18N4O3/c1-13-5-4-8-17-20-11-14(23(13)17)12-22-16-7-3-2-6-15(16)21(19(22)26)10-9-18(24)25/h2-8,11H,9-10,12H2,1H3,(H,24,25) HKSFJWVONYBSCN-UHFFFAOYSA-N 50349188 CHEMBL1807532 Chymase Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349188 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349188&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 56683633 136355874 CHEMBL1807532 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50651432 Cc1cccn2ncc(Cn3c4ccccc4n(CCC(O)=O)c3=O)c12 InChI=1S/C19H18N4O3/c1-13-5-4-9-23-18(13)14(11-20-23)12-22-16-7-3-2-6-15(16)21(19(22)26)10-8-17(24)25/h2-7,9,11H,8,10,12H2,1H3,(H,24,25) WIWJJHGROUUGDX-UHFFFAOYSA-N 50349189 CHEMBL1807533 Chymase Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349189 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349189&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 56680306 136355875 CHEMBL1807533 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50651433 Cc1c(C)c2ccc(Cl)c(Cn3c4ccccc4n(CCC(O)=O)c3=O)c2n1C InChI=1S/C22H22ClN3O3/c1-13-14(2)24(3)21-15(13)8-9-17(23)16(21)12-26-19-7-5-4-6-18(19)25(22(26)29)11-10-20(27)28/h4-9H,10-12H2,1-3H3,(H,27,28) UJHRTHARCWKXDA-UHFFFAOYSA-N 50349190 CHEMBL1807641 Chymase Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349190 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349190&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 56676983 136355876 CHEMBL1807641 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50651434 Cc1c(C)c2cc(C)cc(Cn3c4ccccc4n(CCC(O)=O)c3=O)c2n1C InChI=1S/C23H25N3O3/c1-14-11-17(22-18(12-14)15(2)16(3)24(22)4)13-26-20-8-6-5-7-19(20)25(23(26)29)10-9-21(27)28/h5-8,11-12H,9-10,13H2,1-4H3,(H,27,28) ILQOUSOBJCSXMV-UHFFFAOYSA-N 50349173 CHEMBL1807638 Cathepsin G Homo sapiens 7 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349173 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000683&target=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349173&enzyme=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search 56670149 136355859 CHEMBL1807638 1 MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL 7H6H,7H6G,1KYN,6VTM,1T32,1CGH,1AU8,9ATK,9ASX,8G26,8G25,8G24,8D7K,8D7I,8D4V,8D4S Cathepsin G CATG_HUMAN P08311 Q6IBJ6 Q9UCA5 Q9UCU6 50651435 Cc1cn(C)c2c(Cn3c4ccccc4n(CCC(O)=O)c3=O)cccc12 InChI=1S/C21H21N3O3/c1-14-12-22(2)20-15(6-5-7-16(14)20)13-24-18-9-4-3-8-17(18)23(21(24)27)11-10-19(25)26/h3-9,12H,10-11,13H2,1-2H3,(H,25,26) ZJLQFSBJVCYOKQ-UHFFFAOYSA-N 50349183 CHEMBL1807538 Cathepsin G Homo sapiens 8.8 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349183 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000683&target=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349183&enzyme=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search 56673659 136355869 CHEMBL1807538 1 MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL 7H6H,7H6G,1KYN,6VTM,1T32,1CGH,1AU8,9ATK,9ASX,8G26,8G25,8G24,8D7K,8D7I,8D4V,8D4S Cathepsin G CATG_HUMAN P08311 Q6IBJ6 Q9UCA5 Q9UCU6 50651436 Cc1cc(C)c2c(Cn3c4ccccc4n(CCC(O)=O)c3=O)nsc2c1 InChI=1S/C20H19N3O3S/c1-12-9-13(2)19-14(21-27-17(19)10-12)11-23-16-6-4-3-5-15(16)22(20(23)26)8-7-18(24)25/h3-6,9-10H,7-8,11H2,1-2H3,(H,24,25) PURFUAGIJITRCK-UHFFFAOYSA-N 50349178 CHEMBL1807535 Cathepsin G Homo sapiens 9.5 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349178 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000683&target=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349178&enzyme=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search 56683634 136355864 CHEMBL1807535 1 MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL 7H6H,7H6G,1KYN,6VTM,1T32,1CGH,1AU8,9ATK,9ASX,8G26,8G25,8G24,8D7K,8D7I,8D4V,8D4S Cathepsin G CATG_HUMAN P08311 Q6IBJ6 Q9UCA5 Q9UCU6 50651437 Cc1c(C)c2cc(Cl)cc(Cn3c4ccccc4n(CCC(O)=O)c3=O)c2n1C InChI=1S/C22H22ClN3O3/c1-13-14(2)24(3)21-15(10-16(23)11-17(13)21)12-26-19-7-5-4-6-18(19)25(22(26)29)9-8-20(27)28/h4-7,10-11H,8-9,12H2,1-3H3,(H,27,28) CUTXBCGRPNWRNY-UHFFFAOYSA-N 50349172 CHEMBL1807640 Cathepsin G Homo sapiens 22 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349172 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000683&target=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349172&enzyme=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search 25124204 136355858 CHEMBL1807640 1 MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL 7H6H,7H6G,1KYN,6VTM,1T32,1CGH,1AU8,9ATK,9ASX,8G26,8G25,8G24,8D7K,8D7I,8D4V,8D4S Cathepsin G CATG_HUMAN P08311 Q6IBJ6 Q9UCA5 Q9UCU6 50651438 Cc1cccc2n(C)cc(Cn3c4ccccc4n(CCC(O)=O)c3=O)c12 InChI=1S/C21H21N3O3/c1-14-6-5-9-18-20(14)15(12-22(18)2)13-24-17-8-4-3-7-16(17)23(21(24)27)11-10-19(25)26/h3-9,12H,10-11,13H2,1-2H3,(H,25,26) GWKLGCTZOZIBKD-UHFFFAOYSA-N 50349176 CHEMBL1807531 Cathepsin G Homo sapiens 4.8 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349176 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000683&target=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349176&enzyme=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search 56673658 136355862 CHEMBL1807531 1 MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL 7H6H,7H6G,1KYN,6VTM,1T32,1CGH,1AU8,9ATK,9ASX,8G26,8G25,8G24,8D7K,8D7I,8D4V,8D4S Cathepsin G CATG_HUMAN P08311 Q6IBJ6 Q9UCA5 Q9UCU6 50651439 Cc1cccc2c1c(cs2)Cn3c4ccccc4nc3SCCCC(=O)O InChI=1S/C21H20N2O2S2/c1-14-6-4-9-18-20(14)15(13-27-18)12-23-17-8-3-2-7-16(17)22-21(23)26-11-5-10-19(24)25/h2-4,6-9,13H,5,10-12H2,1H3,(H,24,25) YSOMBHFITHOMPW-UHFFFAOYSA-N 50349191 CHEMBL1807642 Chymase Homo sapiens 22 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349191 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349191&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search KPK 4KP0 9800909 136355877 CHEMBL1807642 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50651440 Cc1cccc2c1c(cs2)CN3c4ccccc4N(C3=O)CCCC(=O)O InChI=1S/C21H20N2O3S/c1-14-6-4-9-18-20(14)15(13-27-18)12-23-17-8-3-2-7-16(17)22(21(23)26)11-5-10-19(24)25/h2-4,6-9,13H,5,10-12H2,1H3,(H,24,25) WYBNXPWKJQJMLG-UHFFFAOYSA-N 50349192 CHEMBL1807643 Chymase Homo sapiens 180 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349192 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1719&target=Chymase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349192&enzyme=Chymase&column=ki&startPg=0&Increment=50&submit=Search 0BB 3S0N 53249965 136355878 CHEMBL1807643 1 MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 1NN6,4KP0,4AG2,4AG1,4AFZ,4AFU,4AFS,4AFQ Chymase CMA1_HUMAN P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5 50651441 Cc1cccc2scc(Cn3c4ccccc4n(CCC(O)=O)c3=O)c12 InChI=1S/C20H18N2O3S/c1-13-5-4-8-17-19(13)14(12-26-17)11-22-16-7-3-2-6-15(16)21(20(22)25)10-9-18(23)24/h2-8,12H,9-11H2,1H3,(H,23,24) XAIBYEBSDCVCAA-UHFFFAOYSA-N 50349174 CHEMBL1807526 Cathepsin G Homo sapiens 2.1 ChEMBL 10.1016/j.bmcl.2011.05.126 10.7270/Q23B60H0 21733690 Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S 7/18/2011 3/23/2012 Boehringer Ingelheim Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50349174 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000683&target=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50349174&enzyme=Cathepsin+G&column=ki&startPg=0&Increment=50&submit=Search 56666720 136355860 CHEMBL1807526 1 MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL 7H6H,7H6G,1KYN,6VTM,1T32,1CGH,1AU8,9ATK,9ASX,8G26,8G25,8G24,8D7K,8D7I,8D4V,8D4S Cathepsin G CATG_HUMAN P08311 Q6IBJ6 Q9UCA5 Q9UCU6