BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50640036 OC(=O)c1cc(-c2ccccc2)c2ccc(OCc3ccccc3)cc2c1 InChI=1S/C24H18O3/c25-24(26)20-13-19-14-21(27-16-17-7-3-1-4-8-17)11-12-22(19)23(15-20)18-9-5-2-6-10-18/h1-15H,16H2,(H,25,26) UKBHCOJXXIXZMO-UHFFFAOYSA-N 50343868 7-(benzyloxy)-4-phenyl-2-naphthoic acid::CHEMBL1774882 P2Y purinoceptor 14 Mus musculus 3500 ChEMBL 10.1016/j.bmcl.2011.03.081 10.7270/Q2NP24S4 21507640 Gauthier, JY; Belley, M; Deschenes, D; Fournier, JF; Gagne, S; Gareau, Y; Hamel, M; Henault, M; Hyjazie, H; Kargman, S; Lavallee, G; Levesque, JF; Li, L; Mamane, Y; Mancini, J; Morin, N; Mulrooney, E; Robichaud, J; Therien, M; Tranmer, G; Wang, Z; Wu, J; Black, WC 5/2/2011 12/4/2011 Merck Frosst Centre For Therapeutic Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50343868 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004749&target=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50343868&enzyme=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search 19027172 131346804 CHEMBL1774882 1 MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELGRKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQPFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL P2Y purinoceptor 14 P2Y14_MOUSE Q9ESG6 50640037 OC(=O)c1cc(-c2ccccc2)c2ccc(Oc3ccccc3)cc2c1 InChI=1S/C23H16O3/c24-23(25)18-13-17-14-20(26-19-9-5-2-6-10-19)11-12-21(17)22(15-18)16-7-3-1-4-8-16/h1-15H,(H,24,25) ZGPCPCXGKKJJBA-UHFFFAOYSA-N 50343869 7-phenoxy-4-phenyl-2-naphthoic acid::CHEMBL1774884 P2Y purinoceptor 14 Mus musculus 4900 ChEMBL 10.1016/j.bmcl.2011.03.081 10.7270/Q2NP24S4 21507640 Gauthier, JY; Belley, M; Deschenes, D; Fournier, JF; Gagne, S; Gareau, Y; Hamel, M; Henault, M; Hyjazie, H; Kargman, S; Lavallee, G; Levesque, JF; Li, L; Mamane, Y; Mancini, J; Morin, N; Mulrooney, E; Robichaud, J; Therien, M; Tranmer, G; Wang, Z; Wu, J; Black, WC 5/2/2011 12/4/2011 Merck Frosst Centre For Therapeutic Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50343869 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004749&target=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50343869&enzyme=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search 54581993 131346805 CHEMBL1774884 1 MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELGRKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQPFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL P2Y purinoceptor 14 P2Y14_MOUSE Q9ESG6 50640038 OC(=O)c1ccc(COc2ccc3c(cc(cc3c2)C(O)=O)-c2ccccc2)cc1 InChI=1S/C25H18O5/c26-24(27)18-8-6-16(7-9-18)15-30-21-10-11-22-19(13-21)12-20(25(28)29)14-23(22)17-4-2-1-3-5-17/h1-14H,15H2,(H,26,27)(H,28,29) IAGJKHKZXITPMF-UHFFFAOYSA-N 50343870 7-(4-carboxybenzyloxy)-4-phenyl-2-naphthoic acid::CHEMBL1774885 P2Y purinoceptor 14 Mus musculus >13000 ChEMBL 10.1016/j.bmcl.2011.03.081 10.7270/Q2NP24S4 21507640 Gauthier, JY; Belley, M; Deschenes, D; Fournier, JF; Gagne, S; Gareau, Y; Hamel, M; Henault, M; Hyjazie, H; Kargman, S; Lavallee, G; Levesque, JF; Li, L; Mamane, Y; Mancini, J; Morin, N; Mulrooney, E; Robichaud, J; Therien, M; Tranmer, G; Wang, Z; Wu, J; Black, WC 5/2/2011 12/4/2011 Merck Frosst Centre For Therapeutic Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50343870 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004749&target=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50343870&enzyme=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search 54583935 131346806 CHEMBL1774885 1 MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELGRKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQPFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL P2Y purinoceptor 14 P2Y14_MOUSE Q9ESG6 50640039 OC(=O)c1cc(-c2ccccc2)c2ccc(OCc3c(Cl)cccc3Cl)cc2c1 InChI=1S/C24H16Cl2O3/c25-22-7-4-8-23(26)21(22)14-29-18-9-10-19-16(12-18)11-17(24(27)28)13-20(19)15-5-2-1-3-6-15/h1-13H,14H2,(H,27,28) OSHNOVRMESSXNM-UHFFFAOYSA-N 50343871 7-(2,6-dichlorobenzyloxy)-4-phenyl-2-naphthoic acid::CHEMBL1774886 P2Y purinoceptor 14 Mus musculus 190 ChEMBL 10.1016/j.bmcl.2011.03.081 10.7270/Q2NP24S4 21507640 Gauthier, JY; Belley, M; Deschenes, D; Fournier, JF; Gagne, S; Gareau, Y; Hamel, M; Henault, M; Hyjazie, H; Kargman, S; Lavallee, G; Levesque, JF; Li, L; Mamane, Y; Mancini, J; Morin, N; Mulrooney, E; Robichaud, J; Therien, M; Tranmer, G; Wang, Z; Wu, J; Black, WC 5/2/2011 12/4/2011 Merck Frosst Centre For Therapeutic Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50343871 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004749&target=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50343871&enzyme=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search 54584877 131346807 CHEMBL1774886 1 MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELGRKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQPFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL P2Y purinoceptor 14 P2Y14_MOUSE Q9ESG6 50640040 Cc1cccc(C)c1COc1ccc2c(cc(cc2c1)C(O)=O)-c1ccccc1 InChI=1S/C26H22O3/c1-17-7-6-8-18(2)25(17)16-29-22-11-12-23-20(14-22)13-21(26(27)28)15-24(23)19-9-4-3-5-10-19/h3-15H,16H2,1-2H3,(H,27,28) HIVWZRSQGPEXRC-UHFFFAOYSA-N 50343872 7-(2,6-dimethylbenzyloxy)-4-phenyl-2-naphthoic acid::CHEMBL1774887 P2Y purinoceptor 14 Mus musculus 110 ChEMBL 10.1016/j.bmcl.2011.03.081 10.7270/Q2NP24S4 21507640 Gauthier, JY; Belley, M; Deschenes, D; Fournier, JF; Gagne, S; Gareau, Y; Hamel, M; Henault, M; Hyjazie, H; Kargman, S; Lavallee, G; Levesque, JF; Li, L; Mamane, Y; Mancini, J; Morin, N; Mulrooney, E; Robichaud, J; Therien, M; Tranmer, G; Wang, Z; Wu, J; Black, WC 5/2/2011 12/4/2011 Merck Frosst Centre For Therapeutic Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50343872 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004749&target=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50343872&enzyme=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search 54584878 131346808 CHEMBL1774887 1 MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELGRKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQPFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL P2Y purinoceptor 14 P2Y14_MOUSE Q9ESG6 50640041 Cc1cccc(C)c1OCc1ccc2c(cc(cc2c1)C(O)=O)-c1ccccc1 InChI=1S/C26H22O3/c1-17-7-6-8-18(2)25(17)29-16-19-11-12-23-21(13-19)14-22(26(27)28)15-24(23)20-9-4-3-5-10-20/h3-15H,16H2,1-2H3,(H,27,28) QANNOEJBUIBKSF-UHFFFAOYSA-N 50343873 7-((2,6-dimethylphenoxy)methyl)-4-phenyl-2-naphthoic acid::CHEMBL1774888 P2Y purinoceptor 14 Mus musculus 2100 ChEMBL 10.1016/j.bmcl.2011.03.081 10.7270/Q2NP24S4 21507640 Gauthier, JY; Belley, M; Deschenes, D; Fournier, JF; Gagne, S; Gareau, Y; Hamel, M; Henault, M; Hyjazie, H; Kargman, S; Lavallee, G; Levesque, JF; Li, L; Mamane, Y; Mancini, J; Morin, N; Mulrooney, E; Robichaud, J; Therien, M; Tranmer, G; Wang, Z; Wu, J; Black, WC 5/2/2011 12/4/2011 Merck Frosst Centre For Therapeutic Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50343873 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004749&target=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50343873&enzyme=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search 54582931 131346809 CHEMBL1774888 1 MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELGRKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQPFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL P2Y purinoceptor 14 P2Y14_MOUSE Q9ESG6 50640042 Cc1cccc(C)c1COc1ccc2ccc(cc2c1)C(O)=O InChI=1S/C20H18O3/c1-13-4-3-5-14(2)19(13)12-23-18-9-8-15-6-7-16(20(21)22)10-17(15)11-18/h3-11H,12H2,1-2H3,(H,21,22) VNXWMSFVGNEINS-UHFFFAOYSA-N 50343874 7-(2,6-dimethylbenzyloxy)-2-naphthoic acid::CHEMBL1774889 P2Y purinoceptor 14 Mus musculus 13000 ChEMBL 10.1016/j.bmcl.2011.03.081 10.7270/Q2NP24S4 21507640 Gauthier, JY; Belley, M; Deschenes, D; Fournier, JF; Gagne, S; Gareau, Y; Hamel, M; Henault, M; Hyjazie, H; Kargman, S; Lavallee, G; Levesque, JF; Li, L; Mamane, Y; Mancini, J; Morin, N; Mulrooney, E; Robichaud, J; Therien, M; Tranmer, G; Wang, Z; Wu, J; Black, WC 5/2/2011 12/4/2011 Merck Frosst Centre For Therapeutic Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50343874 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004749&target=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50343874&enzyme=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search 54580937 131346810 CHEMBL1774889 1 MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELGRKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQPFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL P2Y purinoceptor 14 P2Y14_MOUSE Q9ESG6 50640043 Cc1cccc(C)c1COc1ccc2c(OCc3ccccc3)cc(cc2c1)C(O)=O InChI=1S/C27H24O4/c1-18-7-6-8-19(2)25(18)17-30-23-11-12-24-21(14-23)13-22(27(28)29)15-26(24)31-16-20-9-4-3-5-10-20/h3-15H,16-17H2,1-2H3,(H,28,29) UBSJOEUGZCQLLT-UHFFFAOYSA-N 50343875 4-(benzyloxy)-7-(2,6-dimethylbenzyloxy)-2-naphthoic acid::CHEMBL1774890 P2Y purinoceptor 14 Mus musculus 110 ChEMBL 10.1016/j.bmcl.2011.03.081 10.7270/Q2NP24S4 21507640 Gauthier, JY; Belley, M; Deschenes, D; Fournier, JF; Gagne, S; Gareau, Y; Hamel, M; Henault, M; Hyjazie, H; Kargman, S; Lavallee, G; Levesque, JF; Li, L; Mamane, Y; Mancini, J; Morin, N; Mulrooney, E; Robichaud, J; Therien, M; Tranmer, G; Wang, Z; Wu, J; Black, WC 5/2/2011 12/4/2011 Merck Frosst Centre For Therapeutic Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50343875 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004749&target=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50343875&enzyme=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search 54583936 131346811 CHEMBL1774890 1 MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELGRKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQPFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL P2Y purinoceptor 14 P2Y14_MOUSE Q9ESG6 50640044 Cc1cccc(C)c1COc1ccc2c(cc(cc2c1)C(O)=O)-c1ccsc1 InChI=1S/C24H20O3S/c1-15-4-3-5-16(2)23(15)13-27-20-6-7-21-18(11-20)10-19(24(25)26)12-22(21)17-8-9-28-14-17/h3-12,14H,13H2,1-2H3,(H,25,26) VQPZAISPIXNHAJ-UHFFFAOYSA-N 50343876 7-(2,6-dimethylbenzyloxy)-4-(thiophen-3-yl)-2-naphthoic acid::CHEMBL1774891 P2Y purinoceptor 14 Mus musculus 26 ChEMBL 10.1016/j.bmcl.2011.03.081 10.7270/Q2NP24S4 21507640 Gauthier, JY; Belley, M; Deschenes, D; Fournier, JF; Gagne, S; Gareau, Y; Hamel, M; Henault, M; Hyjazie, H; Kargman, S; Lavallee, G; Levesque, JF; Li, L; Mamane, Y; Mancini, J; Morin, N; Mulrooney, E; Robichaud, J; Therien, M; Tranmer, G; Wang, Z; Wu, J; Black, WC 5/2/2011 12/4/2011 Merck Frosst Centre For Therapeutic Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50343876 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004749&target=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50343876&enzyme=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search 54581994 131346812 CHEMBL1774891 1 MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELGRKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQPFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL P2Y purinoceptor 14 P2Y14_MOUSE Q9ESG6 50640045 Cc1cc(F)cc(C)c1COc1ccc2c(cc(cc2c1)C(O)=O)-c1ccsc1 InChI=1S/C24H19FO3S/c1-14-7-19(25)8-15(2)23(14)12-28-20-3-4-21-17(10-20)9-18(24(26)27)11-22(21)16-5-6-29-13-16/h3-11,13H,12H2,1-2H3,(H,26,27) BZTYQKZVXFALHW-UHFFFAOYSA-N 50343877 7-(4-fluoro-2,6-dimethylbenzyloxy)-4-(thiophen-3-yl)-2-naphthoic acid::CHEMBL1774892 P2Y purinoceptor 14 Mus musculus 14 ChEMBL 10.1016/j.bmcl.2011.03.081 10.7270/Q2NP24S4 21507640 Gauthier, JY; Belley, M; Deschenes, D; Fournier, JF; Gagne, S; Gareau, Y; Hamel, M; Henault, M; Hyjazie, H; Kargman, S; Lavallee, G; Levesque, JF; Li, L; Mamane, Y; Mancini, J; Morin, N; Mulrooney, E; Robichaud, J; Therien, M; Tranmer, G; Wang, Z; Wu, J; Black, WC 5/2/2011 12/4/2011 Merck Frosst Centre For Therapeutic Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50343877 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004749&target=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50343877&enzyme=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search 42628974 131346813 CHEMBL1774892 1 MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELGRKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQPFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL P2Y purinoceptor 14 P2Y14_MOUSE Q9ESG6 50640046 OC(=O)c1cc(-c2ccsc2)c2ccc(cc2c1)-c1ccc(OC(F)(F)F)cc1 InChI=1S/C22H13F3O3S/c23-22(24,25)28-18-4-1-13(2-5-18)14-3-6-19-16(9-14)10-17(21(26)27)11-20(19)15-7-8-29-12-15/h1-12H,(H,26,27) GKGGDVCJQYSQAU-UHFFFAOYSA-N 50343878 4-(thiophen-3-yl)-7-(4-(trifluoromethoxy)phenyl)-2-naphthoic acid::CHEMBL1774893 P2Y purinoceptor 14 Mus musculus 54 ChEMBL 10.1016/j.bmcl.2011.03.081 10.7270/Q2NP24S4 21507640 Gauthier, JY; Belley, M; Deschenes, D; Fournier, JF; Gagne, S; Gareau, Y; Hamel, M; Henault, M; Hyjazie, H; Kargman, S; Lavallee, G; Levesque, JF; Li, L; Mamane, Y; Mancini, J; Morin, N; Mulrooney, E; Robichaud, J; Therien, M; Tranmer, G; Wang, Z; Wu, J; Black, WC 5/2/2011 12/4/2011 Merck Frosst Centre For Therapeutic Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50343878 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004749&target=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50343878&enzyme=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search 42630806 131346814 CHEMBL1774893 1 MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELGRKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQPFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL P2Y purinoceptor 14 P2Y14_MOUSE Q9ESG6 50640047 OC(=O)c1cc2cc(ccc2c(-c2ccsc2)c1F)-c1ccc(OC(F)(F)F)cc1 InChI=1S/C22H12F4O3S/c23-20-18(21(27)28)10-15-9-13(3-6-17(15)19(20)14-7-8-30-11-14)12-1-4-16(5-2-12)29-22(24,25)26/h1-11H,(H,27,28) UCVZALDHMMNEQF-UHFFFAOYSA-N 50343879 3-fluoro-4-(thiophen-3-yl)-7-(4-(trifluoromethoxy)phenyl)-2-naphthoic acid::CHEMBL1774894 P2Y purinoceptor 14 Mus musculus 380 ChEMBL 10.1016/j.bmcl.2011.03.081 10.7270/Q2NP24S4 21507640 Gauthier, JY; Belley, M; Deschenes, D; Fournier, JF; Gagne, S; Gareau, Y; Hamel, M; Henault, M; Hyjazie, H; Kargman, S; Lavallee, G; Levesque, JF; Li, L; Mamane, Y; Mancini, J; Morin, N; Mulrooney, E; Robichaud, J; Therien, M; Tranmer, G; Wang, Z; Wu, J; Black, WC 5/2/2011 12/4/2011 Merck Frosst Centre For Therapeutic Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50343879 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004749&target=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50343879&enzyme=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search 54582932 131346815 CHEMBL1774894 1 MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELGRKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQPFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL P2Y purinoceptor 14 P2Y14_MOUSE Q9ESG6 50640048 OC(=O)c1cc2cc(ccc2c(-c2ccsc2)c1O)-c1ccc(OC(F)(F)F)cc1 InChI=1S/C22H13F3O4S/c23-22(24,25)29-16-4-1-12(2-5-16)13-3-6-17-15(9-13)10-18(21(27)28)20(26)19(17)14-7-8-30-11-14/h1-11,26H,(H,27,28) JRIQYEPUGBZBHP-UHFFFAOYSA-N 50343880 3-hydroxy-4-(thiophen-3-yl)-7-(4-(trifluoromethoxy)phenyl)-2-naphthoic acid::CHEMBL1774895 P2Y purinoceptor 14 Mus musculus 1300 ChEMBL 10.1016/j.bmcl.2011.03.081 10.7270/Q2NP24S4 21507640 Gauthier, JY; Belley, M; Deschenes, D; Fournier, JF; Gagne, S; Gareau, Y; Hamel, M; Henault, M; Hyjazie, H; Kargman, S; Lavallee, G; Levesque, JF; Li, L; Mamane, Y; Mancini, J; Morin, N; Mulrooney, E; Robichaud, J; Therien, M; Tranmer, G; Wang, Z; Wu, J; Black, WC 5/2/2011 12/4/2011 Merck Frosst Centre For Therapeutic Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50343880 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004749&target=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50343880&enzyme=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search 54584879 131346816 CHEMBL1774895 1 MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELGRKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQPFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL P2Y purinoceptor 14 P2Y14_MOUSE Q9ESG6 50640049 OC(=O)c1cc(-c2cscc2C(O)(C(F)(F)F)C(F)(F)F)c2ccc(cc2c1)-c1ccc(OC(F)(F)F)cc1 InChI=1S/C25H13F9O4S/c26-23(27,28)22(37,24(29,30)31)20-11-39-10-19(20)18-9-15(21(35)36)8-14-7-13(3-6-17(14)18)12-1-4-16(5-2-12)38-25(32,33)34/h1-11,37H,(H,35,36) QFWPUZBCALDZQR-UHFFFAOYSA-N 50343881 4-(4-(1,1,1,3,3,3-hexafluoro-2-hydroxypropan-2-yl)thiophen-3-yl)-7-(4-(trifluoromethoxy)phenyl)-2-naphthoic acid::CHEMBL1774896 P2Y purinoceptor 14 Mus musculus 350 ChEMBL 10.1016/j.bmcl.2011.03.081 10.7270/Q2NP24S4 21507640 Gauthier, JY; Belley, M; Deschenes, D; Fournier, JF; Gagne, S; Gareau, Y; Hamel, M; Henault, M; Hyjazie, H; Kargman, S; Lavallee, G; Levesque, JF; Li, L; Mamane, Y; Mancini, J; Morin, N; Mulrooney, E; Robichaud, J; Therien, M; Tranmer, G; Wang, Z; Wu, J; Black, WC 5/2/2011 12/4/2011 Merck Frosst Centre For Therapeutic Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50343881 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004749&target=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50343881&enzyme=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search 54584880 131346817 CHEMBL1774896 1 MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELGRKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQPFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL P2Y purinoceptor 14 P2Y14_MOUSE Q9ESG6 50640050 CS(=O)(=O)c1cscc1-c1cc(cc2cc(ccc12)-c1ccc(OC(F)(F)F)cc1)C(O)=O InChI=1S/C23H15F3O5S2/c1-33(29,30)21-12-32-11-20(21)19-10-16(22(27)28)9-15-8-14(4-7-18(15)19)13-2-5-17(6-3-13)31-23(24,25)26/h2-12H,1H3,(H,27,28) LVZLAIVAPOSHEX-UHFFFAOYSA-N 50343882 4-(4-(methylsulfonyl)thiophen-3-yl)-7-(4-(trifluoromethoxy)phenyl)-2-naphthoic acid::CHEMBL1774897 P2Y purinoceptor 14 Mus musculus 330 ChEMBL 10.1016/j.bmcl.2011.03.081 10.7270/Q2NP24S4 21507640 Gauthier, JY; Belley, M; Deschenes, D; Fournier, JF; Gagne, S; Gareau, Y; Hamel, M; Henault, M; Hyjazie, H; Kargman, S; Lavallee, G; Levesque, JF; Li, L; Mamane, Y; Mancini, J; Morin, N; Mulrooney, E; Robichaud, J; Therien, M; Tranmer, G; Wang, Z; Wu, J; Black, WC 5/2/2011 12/4/2011 Merck Frosst Centre For Therapeutic Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50343882 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004749&target=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50343882&enzyme=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search 54585842 131346818 CHEMBL1774897 1 MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELGRKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQPFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL P2Y purinoceptor 14 P2Y14_MOUSE Q9ESG6 50640051 CS(=O)(=O)c1cscc1-c1cc(cc2cc(ccc12)-c1ccc(cc1)C(F)(F)F)C(O)=O InChI=1S/C23H15F3O4S2/c1-32(29,30)21-12-31-11-20(21)19-10-16(22(27)28)9-15-8-14(4-7-18(15)19)13-2-5-17(6-3-13)23(24,25)26/h2-12H,1H3,(H,27,28) FHMKKRBKVCSGEH-UHFFFAOYSA-N 50343883 4-(4-(methylsulfonyl)thiophen-3-yl)-7-(4-(trifluoromethyl)phenyl)-2-naphthoic acid::CHEMBL1774898 P2Y purinoceptor 14 Mus musculus 190 ChEMBL 10.1016/j.bmcl.2011.03.081 10.7270/Q2NP24S4 21507640 Gauthier, JY; Belley, M; Deschenes, D; Fournier, JF; Gagne, S; Gareau, Y; Hamel, M; Henault, M; Hyjazie, H; Kargman, S; Lavallee, G; Levesque, JF; Li, L; Mamane, Y; Mancini, J; Morin, N; Mulrooney, E; Robichaud, J; Therien, M; Tranmer, G; Wang, Z; Wu, J; Black, WC 5/2/2011 12/4/2011 Merck Frosst Centre For Therapeutic Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50343883 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004749&target=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50343883&enzyme=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search 54583937 131346819 CHEMBL1774898 1 MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELGRKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQPFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL P2Y purinoceptor 14 P2Y14_MOUSE Q9ESG6 50640052 CS(=O)(=O)c1ccc(cc1)-c1cc(cc2cc(ccc12)-c1ccc(cc1)C(F)(F)F)C(O)=O InChI=1S/C25H17F3O4S/c1-33(31,32)21-9-4-16(5-10-21)23-14-19(24(29)30)13-18-12-17(6-11-22(18)23)15-2-7-20(8-3-15)25(26,27)28/h2-14H,1H3,(H,29,30) MEVAMFHWVSTRKE-UHFFFAOYSA-N 50343884 4-(4-(methylsulfonyl)phenyl)-7-(4-(trifluoromethyl)phenyl)-2-naphthoic acid::CHEMBL1774899 P2Y purinoceptor 14 Mus musculus 20 ChEMBL 10.1016/j.bmcl.2011.03.081 10.7270/Q2NP24S4 21507640 Gauthier, JY; Belley, M; Deschenes, D; Fournier, JF; Gagne, S; Gareau, Y; Hamel, M; Henault, M; Hyjazie, H; Kargman, S; Lavallee, G; Levesque, JF; Li, L; Mamane, Y; Mancini, J; Morin, N; Mulrooney, E; Robichaud, J; Therien, M; Tranmer, G; Wang, Z; Wu, J; Black, WC 5/2/2011 12/4/2011 Merck Frosst Centre For Therapeutic Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50343884 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004749&target=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50343884&enzyme=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search 54585843 131346820 CHEMBL1774899 1 MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELGRKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQPFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL P2Y purinoceptor 14 P2Y14_MOUSE Q9ESG6 50640053 OC(c1ccc(cc1)-c1cc(cc2cc(ccc12)-c1ccc(cc1)C(F)(F)F)C(O)=O)C(F)(F)F InChI=1S/C26H16F6O3/c27-25(28,29)20-8-5-14(6-9-20)17-7-10-21-18(11-17)12-19(24(34)35)13-22(21)15-1-3-16(4-2-15)23(33)26(30,31)32/h1-13,23,33H,(H,34,35) UTXQUOONYQJDAF-UHFFFAOYSA-N 50343885 4-(4-(2,2,2-trifluoro-1-hydroxyethyl)phenyl)-7-(4-(trifluoromethyl)phenyl)-2-naphthoic acid::CHEMBL1774900 P2Y purinoceptor 14 Mus musculus 13 ChEMBL 10.1016/j.bmcl.2011.03.081 10.7270/Q2NP24S4 21507640 Gauthier, JY; Belley, M; Deschenes, D; Fournier, JF; Gagne, S; Gareau, Y; Hamel, M; Henault, M; Hyjazie, H; Kargman, S; Lavallee, G; Levesque, JF; Li, L; Mamane, Y; Mancini, J; Morin, N; Mulrooney, E; Robichaud, J; Therien, M; Tranmer, G; Wang, Z; Wu, J; Black, WC 5/2/2011 12/4/2011 Merck Frosst Centre For Therapeutic Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50343885 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004749&target=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50343885&enzyme=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search 54586809 131346821 CHEMBL1774900 1 MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELGRKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQPFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL P2Y purinoceptor 14 P2Y14_MOUSE Q9ESG6 50640054 O[C@H](c1ccc(cc1)-c1cc(cc2cc(ccc12)-c1ccc(cc1)C(F)(F)F)C(O)=O)C(F)(F)F |r| InChI=1S/C26H16F6O3/c27-25(28,29)20-8-5-14(6-9-20)17-7-10-21-18(11-17)12-19(24(34)35)13-22(21)15-1-3-16(4-2-15)23(33)26(30,31)32/h1-13,23,33H,(H,34,35) UTXQUOONYQJDAF-UHFFFAOYSA-N 50343886 (R)-4-(4-(2,2,2-trifluoro-1-hydroxyethyl)phenyl)-7-(4-(trifluoromethyl)phenyl)-2-naphthoic acid::CHEMBL1774901 P2Y purinoceptor 14 Mus musculus 4 ChEMBL 10.1016/j.bmcl.2011.03.081 10.7270/Q2NP24S4 21507640 Gauthier, JY; Belley, M; Deschenes, D; Fournier, JF; Gagne, S; Gareau, Y; Hamel, M; Henault, M; Hyjazie, H; Kargman, S; Lavallee, G; Levesque, JF; Li, L; Mamane, Y; Mancini, J; Morin, N; Mulrooney, E; Robichaud, J; Therien, M; Tranmer, G; Wang, Z; Wu, J; Black, WC 5/2/2011 12/4/2011 Merck Frosst Centre For Therapeutic Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50343886 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004749&target=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50343886&enzyme=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search 42630802 131346822 CHEMBL1774901 1 MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELGRKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQPFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL P2Y purinoceptor 14 P2Y14_MOUSE Q9ESG6 50640055 O[C@@H](c1ccc(cc1)-c1cc(cc2cc(ccc12)-c1ccc(cc1)C(F)(F)F)C(O)=O)C(F)(F)F |r| InChI=1S/C26H16F6O3/c27-25(28,29)20-8-5-14(6-9-20)17-7-10-21-18(11-17)12-19(24(34)35)13-22(21)15-1-3-16(4-2-15)23(33)26(30,31)32/h1-13,23,33H,(H,34,35) UTXQUOONYQJDAF-UHFFFAOYSA-N 50343887 (S)-4-(4-(2,2,2-trifluoro-1-hydroxyethyl)phenyl)-7-(4-(trifluoromethyl)phenyl)-2-naphthoic acid::CHEMBL1774902 P2Y purinoceptor 14 Mus musculus 51 ChEMBL 10.1016/j.bmcl.2011.03.081 10.7270/Q2NP24S4 21507640 Gauthier, JY; Belley, M; Deschenes, D; Fournier, JF; Gagne, S; Gareau, Y; Hamel, M; Henault, M; Hyjazie, H; Kargman, S; Lavallee, G; Levesque, JF; Li, L; Mamane, Y; Mancini, J; Morin, N; Mulrooney, E; Robichaud, J; Therien, M; Tranmer, G; Wang, Z; Wu, J; Black, WC 5/2/2011 12/4/2011 Merck Frosst Centre For Therapeutic Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50343887 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004749&target=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50343887&enzyme=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search 54581995 131346823 CHEMBL1774902 1 MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELGRKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQPFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL P2Y purinoceptor 14 P2Y14_MOUSE Q9ESG6 50640056 O[C@@H](C(F)F)c1ccc(cc1)-c1cc(cc2cc(ccc12)-c1ccc(cc1)C(F)(F)F)C(O)=O |r| InChI=1S/C26H17F5O3/c27-24(28)23(32)16-3-1-15(2-4-16)22-13-19(25(33)34)12-18-11-17(7-10-21(18)22)14-5-8-20(9-6-14)26(29,30)31/h1-13,23-24,32H,(H,33,34) PLNKQIULCCRLIX-UHFFFAOYSA-N 50343888 (R)-4-(4-(2,2-difluoro-1-hydroxyethyl)phenyl)-7-(4-(trifluoromethyl)phenyl)-2-naphthoic acid::CHEMBL1774903 P2Y purinoceptor 14 Mus musculus 8 ChEMBL 10.1016/j.bmcl.2011.03.081 10.7270/Q2NP24S4 21507640 Gauthier, JY; Belley, M; Deschenes, D; Fournier, JF; Gagne, S; Gareau, Y; Hamel, M; Henault, M; Hyjazie, H; Kargman, S; Lavallee, G; Levesque, JF; Li, L; Mamane, Y; Mancini, J; Morin, N; Mulrooney, E; Robichaud, J; Therien, M; Tranmer, G; Wang, Z; Wu, J; Black, WC 5/2/2011 12/4/2011 Merck Frosst Centre For Therapeutic Research http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50343888 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004749&target=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50343888&enzyme=P2Y+purinoceptor+14&column=ki&startPg=0&Increment=50&submit=Search 42630568 131346824 CHEMBL1774903 1 MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELGRKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQPFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL P2Y purinoceptor 14 P2Y14_MOUSE Q9ESG6