BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50636904 COc1cc(Cl)c(-c2c(C)nn3c(NCCNC4CCOCC4)cc(C)nc23)c(Cl)c1 |(28.08,-21.34,;29.62,-21.32,;30.38,-19.98,;29.6,-18.65,;30.35,-17.31,;29.57,-15.98,;31.89,-17.31,;32.64,-15.97,;31.74,-14.71,;30.2,-14.71,;32.65,-13.46,;34.12,-13.94,;35.45,-13.17,;35.44,-11.63,;36.78,-10.86,;38.11,-11.63,;39.44,-10.86,;40.77,-11.64,;40.76,-13.17,;42.08,-13.95,;43.42,-13.2,;43.43,-11.66,;42.11,-10.87,;36.78,-13.94,;36.79,-15.49,;38.12,-16.26,;35.45,-16.26,;34.12,-15.49,;32.68,-18.62,;34.22,-18.59,;31.93,-19.96,)| InChI=1S/C22H27Cl2N5O2/c1-13-10-19(26-7-6-25-15-4-8-31-9-5-15)29-22(27-13)20(14(2)28-29)21-17(23)11-16(30-3)12-18(21)24/h10-12,15,25-26H,4-9H2,1-3H3 CVABPTLRAQIZJU-UHFFFAOYSA-N 50342721 N1-(3-(2,6-dichloro-4-methoxyphenyl)-2,5-dimethylpyrazolo[1,5-a]pyrimidin-7-yl)-N2-(tetrahydro-2H-pyran-4-yl)ethane-1,2-diamine::CHEMBL1771259 Neuropeptide Y receptor type 1 Homo sapiens 7 ChEMBL 10.1016/j.bmcl.2010.12.116 10.7270/Q2BP0336 21295475 Griffith, DA; Hargrove, DM; Maurer, TS; Blum, CA; De Lombaert, S; Inthavongsay, JK; Klade, LE; Mack, CM; Rose, CR; Sanders, MJ; Carpino, PA 4/25/2011 12/3/2011 Pfizer http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50342721 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50342721&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 9869041 131345657 CHEMBL1771259 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50636905 COc1cc(Cl)c(-c2c(C)nn3c(NCCNCC(F)F)cc(C)nc23)c(Cl)c1 |(41.2,-48.94,;42.74,-48.92,;43.49,-47.58,;42.71,-46.25,;43.46,-44.91,;42.69,-43.58,;45,-44.9,;45.76,-43.56,;44.85,-42.31,;43.31,-42.31,;45.76,-41.06,;47.23,-41.54,;48.56,-40.77,;48.56,-39.23,;49.89,-38.46,;51.22,-39.22,;52.56,-38.45,;53.88,-39.23,;55.22,-38.47,;55.23,-36.93,;56.55,-39.24,;49.9,-41.53,;49.9,-43.08,;51.24,-43.85,;48.56,-43.86,;47.23,-43.09,;45.79,-46.21,;47.33,-46.19,;45.04,-47.56,)| InChI=1S/C19H21Cl2F2N5O/c1-10-6-16(25-5-4-24-9-15(22)23)28-19(26-10)17(11(2)27-28)18-13(20)7-12(29-3)8-14(18)21/h6-8,15,24-25H,4-5,9H2,1-3H3 WMZIEOXBMBZGQD-UHFFFAOYSA-N 50342722 N1-(3-(2,6-dichloro-4-methoxyphenyl)-2,5-dimethylpyrazolo[1,5-a]pyrimidin-7-yl)-N2-(2,2-difluoroethyl)ethane-1,2-diamine::CHEMBL1771266 Neuropeptide Y receptor type 1 Homo sapiens 383 ChEMBL 10.1016/j.bmcl.2010.12.116 10.7270/Q2BP0336 21295475 Griffith, DA; Hargrove, DM; Maurer, TS; Blum, CA; De Lombaert, S; Inthavongsay, JK; Klade, LE; Mack, CM; Rose, CR; Sanders, MJ; Carpino, PA 4/25/2011 12/3/2011 Pfizer http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50342722 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50342722&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 9911304 131345658 CHEMBL1771266 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50636906 COc1cc(Cl)c(-c2c(C)nn3c(NCCNCCF)cc(C)nc23)c(Cl)c1 |(22.02,-50.44,;23.56,-50.42,;24.32,-49.08,;23.54,-47.75,;24.29,-46.41,;23.51,-45.08,;25.83,-46.4,;26.59,-45.06,;25.68,-43.81,;24.14,-43.81,;26.59,-42.56,;28.06,-43.04,;29.39,-42.27,;29.38,-40.73,;30.72,-39.96,;32.05,-40.73,;33.38,-39.95,;34.71,-40.73,;36.05,-39.97,;36.06,-38.43,;30.72,-43.04,;30.73,-44.59,;32.06,-45.35,;29.39,-45.36,;28.06,-44.59,;26.62,-47.72,;28.16,-47.69,;25.87,-49.06,)| InChI=1S/C19H22Cl2FN5O/c1-11-8-16(24-7-6-23-5-4-22)27-19(25-11)17(12(2)26-27)18-14(20)9-13(28-3)10-15(18)21/h8-10,23-24H,4-7H2,1-3H3 QLJCPZDNIAKTPY-UHFFFAOYSA-N 50342723 N1-(3-(2,6-dichloro-4-methoxyphenyl)-2,5-dimethylpyrazolo[1,5-a]pyrimidin-7-yl)-N2-(2-fluoroethyl)ethane-1,2-diamine::CHEMBL1771265 Neuropeptide Y receptor type 1 Homo sapiens 22 ChEMBL 10.1016/j.bmcl.2010.12.116 10.7270/Q2BP0336 21295475 Griffith, DA; Hargrove, DM; Maurer, TS; Blum, CA; De Lombaert, S; Inthavongsay, JK; Klade, LE; Mack, CM; Rose, CR; Sanders, MJ; Carpino, PA 4/25/2011 12/3/2011 Pfizer http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50342723 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50342723&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 54587431 131345659 CHEMBL1771265 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50636907 COc1cc(Cl)c(-c2c(C)nn3c(NCCNC4CCCCC4F)cc(C)nc23)c(Cl)c1 |(6.22,-49.39,;7.76,-49.38,;8.52,-48.03,;7.73,-46.71,;8.49,-45.37,;7.71,-44.04,;10.02,-45.36,;10.78,-44.02,;9.87,-42.77,;8.33,-42.76,;10.78,-41.52,;12.26,-42,;13.58,-41.23,;13.58,-39.69,;14.91,-38.92,;16.25,-39.68,;17.58,-38.91,;18.91,-39.69,;18.89,-41.23,;20.21,-42.01,;21.55,-41.25,;21.57,-39.71,;20.24,-38.93,;20.25,-37.39,;14.92,-41.99,;14.92,-43.54,;16.26,-44.31,;13.59,-44.32,;12.25,-43.54,;10.81,-46.67,;12.35,-46.65,;10.06,-48.01,)| InChI=1S/C23H28Cl2FN5O/c1-13-10-20(28-9-8-27-19-7-5-4-6-18(19)26)31-23(29-13)21(14(2)30-31)22-16(24)11-15(32-3)12-17(22)25/h10-12,18-19,27-28H,4-9H2,1-3H3 BWLZMTCKRMQEHI-UHFFFAOYSA-N 50342724 N1-(3-(2,6-dichloro-4-methoxyphenyl)-2,5-dimethylpyrazolo[1,5-a]pyrimidin-7-yl)-N2-(2-fluorocyclohexyl)ethane-1,2-diamine::CHEMBL1771264 Neuropeptide Y receptor type 1 Homo sapiens 5 ChEMBL 10.1016/j.bmcl.2010.12.116 10.7270/Q2BP0336 21295475 Griffith, DA; Hargrove, DM; Maurer, TS; Blum, CA; De Lombaert, S; Inthavongsay, JK; Klade, LE; Mack, CM; Rose, CR; Sanders, MJ; Carpino, PA 4/25/2011 12/3/2011 Pfizer http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50342724 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50342724&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 9956814 131345660 CHEMBL1771264 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50636908 COc1cc(Cl)c(-c2c(C)nn3c(NCC(C)(C)NC4CCOCC4)cc(C)nc23)c(Cl)c1 |(-12.37,-47.14,;-10.82,-47.12,;-10.07,-45.78,;-10.85,-44.45,;-10.09,-43.11,;-10.87,-41.78,;-8.56,-43.11,;-7.8,-41.76,;-8.71,-40.51,;-10.25,-40.51,;-7.8,-39.26,;-6.33,-39.74,;-5,-38.97,;-5,-37.43,;-3.67,-36.66,;-2.33,-37.43,;-3.11,-38.76,;-1.57,-38.76,;-1,-36.66,;.33,-37.43,;.31,-38.97,;1.63,-39.75,;2.97,-39,;2.99,-37.46,;1.66,-36.67,;-3.66,-39.74,;-3.66,-41.29,;-2.32,-42.06,;-4.99,-42.06,;-6.33,-41.29,;-7.77,-44.42,;-6.23,-44.39,;-8.52,-45.76,)| InChI=1S/C24H31Cl2N5O2/c1-14-10-20(27-13-24(3,4)29-16-6-8-33-9-7-16)31-23(28-14)21(15(2)30-31)22-18(25)11-17(32-5)12-19(22)26/h10-12,16,27,29H,6-9,13H2,1-5H3 ATUVDIADSMQSEJ-UHFFFAOYSA-N 50342725 N1-(3-(2,6-dichloro-4-methoxyphenyl)-2,5-dimethylpyrazolo[1,5-a]pyrimidin-7-yl)-2-methyl-N2-(tetrahydro-2H-pyran-4-yl)propane-1,2-diamine::CHEMBL1771263 Neuropeptide Y receptor type 1 Homo sapiens 141 ChEMBL 10.1016/j.bmcl.2010.12.116 10.7270/Q2BP0336 21295475 Griffith, DA; Hargrove, DM; Maurer, TS; Blum, CA; De Lombaert, S; Inthavongsay, JK; Klade, LE; Mack, CM; Rose, CR; Sanders, MJ; Carpino, PA 4/25/2011 12/3/2011 Pfizer http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50342725 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50342725&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 54583519 131345661 CHEMBL1771263 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50636909 COc1cc(Cl)c(-c2c(C)nn3c(NCC(C)NC4CCOCC4)cc(C)nc23)c(Cl)c1 |(34.35,-35.54,;35.89,-35.52,;36.65,-34.18,;35.86,-32.85,;36.62,-31.51,;35.84,-30.19,;38.16,-31.51,;38.91,-30.17,;38.01,-28.91,;36.47,-28.91,;38.92,-27.66,;40.39,-28.14,;41.72,-27.38,;41.71,-25.84,;43.04,-25.06,;44.38,-25.83,;44.38,-27.37,;45.71,-25.06,;47.04,-25.84,;47.02,-27.38,;48.34,-28.16,;49.69,-27.4,;49.7,-25.86,;48.37,-25.07,;43.05,-28.14,;43.06,-29.69,;44.39,-30.46,;41.72,-30.46,;40.39,-29.69,;38.94,-32.82,;40.48,-32.8,;38.2,-34.16,)| InChI=1S/C23H29Cl2N5O2/c1-13-9-20(26-12-14(2)27-16-5-7-32-8-6-16)30-23(28-13)21(15(3)29-30)22-18(24)10-17(31-4)11-19(22)25/h9-11,14,16,26-27H,5-8,12H2,1-4H3 LFQHATSISOZURQ-UHFFFAOYSA-N 50342726 N1-(3-(2,6-dichloro-4-methoxyphenyl)-2,5-dimethylpyrazolo[1,5-a]pyrimidin-7-yl)-N2-(tetrahydro-2H-pyran-4-yl)propane-1,2-diamine::CHEMBL1771262 Neuropeptide Y receptor type 1 Homo sapiens 5 ChEMBL 10.1016/j.bmcl.2010.12.116 10.7270/Q2BP0336 21295475 Griffith, DA; Hargrove, DM; Maurer, TS; Blum, CA; De Lombaert, S; Inthavongsay, JK; Klade, LE; Mack, CM; Rose, CR; Sanders, MJ; Carpino, PA 4/25/2011 12/3/2011 Pfizer http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50342726 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50342726&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 54583518 131345662 CHEMBL1771262 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50636910 CCCOc1cc(Cl)c(-c2c(C)nn3c(NCCNC4CCOCC4)cc(C)nc23)c(Cl)c1 |(5.54,-21.28,;7.08,-21.27,;7.87,-22.59,;9.41,-22.57,;10.16,-21.23,;9.38,-19.9,;10.14,-18.56,;9.36,-17.24,;11.67,-18.56,;12.43,-17.22,;11.52,-15.96,;9.98,-15.96,;12.43,-14.71,;13.9,-15.19,;15.23,-14.43,;15.23,-12.89,;16.56,-12.11,;17.9,-12.88,;19.23,-12.11,;20.56,-12.89,;20.54,-14.43,;21.86,-15.21,;23.2,-14.45,;23.22,-12.91,;21.89,-12.12,;16.57,-15.19,;16.57,-16.74,;17.91,-17.51,;15.24,-17.51,;13.9,-16.74,;12.46,-19.87,;14,-19.85,;11.71,-21.21,)| InChI=1S/C24H31Cl2N5O2/c1-4-9-33-18-13-19(25)23(20(26)14-18)22-16(3)30-31-21(12-15(2)29-24(22)31)28-8-7-27-17-5-10-32-11-6-17/h12-14,17,27-28H,4-11H2,1-3H3 BDXJFKAUYFPXFH-UHFFFAOYSA-N 50342727 N1-(3-(2,6-dichloro-4-propoxyphenyl)-2,5-dimethylpyrazolo[1,5-a]pyrimidin-7-yl)-N2-(tetrahydro-2H-pyran-4-yl)ethane-1,2-diamine::CHEMBL1771261 Neuropeptide Y receptor type 1 Homo sapiens 8 ChEMBL 10.1016/j.bmcl.2010.12.116 10.7270/Q2BP0336 21295475 Griffith, DA; Hargrove, DM; Maurer, TS; Blum, CA; De Lombaert, S; Inthavongsay, JK; Klade, LE; Mack, CM; Rose, CR; Sanders, MJ; Carpino, PA 4/25/2011 12/3/2011 Pfizer http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50342727 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50342727&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 9805674 131345663 CHEMBL1771261 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50636911 CCOc1cc(Cl)c(-c2c(C)nn3c(NCCNC4CCOCC4)cc(C)nc23)c(Cl)c1 |(-10.58,-34.36,;-9.79,-35.68,;-8.25,-35.66,;-7.5,-34.32,;-8.28,-32.99,;-7.53,-31.65,;-8.3,-30.33,;-5.99,-31.65,;-5.23,-30.31,;-6.14,-29.05,;-7.68,-29.05,;-5.23,-27.8,;-3.76,-28.28,;-2.43,-27.52,;-2.43,-25.98,;-1.1,-25.2,;.23,-25.97,;1.57,-25.2,;2.89,-25.98,;2.88,-27.52,;4.2,-28.3,;5.54,-27.54,;5.56,-26,;4.23,-25.21,;-1.1,-28.28,;-1.09,-29.83,;.25,-30.6,;-2.43,-30.6,;-3.76,-29.83,;-5.2,-32.96,;-3.66,-32.94,;-5.95,-34.3,)| InChI=1S/C23H29Cl2N5O2/c1-4-32-17-12-18(24)22(19(25)13-17)21-15(3)29-30-20(11-14(2)28-23(21)30)27-8-7-26-16-5-9-31-10-6-16/h11-13,16,26-27H,4-10H2,1-3H3 KXVKWNPVAHBIOP-UHFFFAOYSA-N 50342728 N1-(3-(2,6-dichloro-4-ethoxyphenyl)-2,5-dimethylpyrazolo[1,5-a]pyrimidin-7-yl)-N2-(tetrahydro-2H-pyran-4-yl)ethane-1,2-diamine::CHEMBL1771260 Neuropeptide Y receptor type 1 Homo sapiens 3 ChEMBL 10.1016/j.bmcl.2010.12.116 10.7270/Q2BP0336 21295475 Griffith, DA; Hargrove, DM; Maurer, TS; Blum, CA; De Lombaert, S; Inthavongsay, JK; Klade, LE; Mack, CM; Rose, CR; Sanders, MJ; Carpino, PA 4/25/2011 12/3/2011 Pfizer http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50342728 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50342728&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 9869677 131345664 CHEMBL1771260 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50636912 COc1cc(Cl)c(-c2c(C)nn3c(NCCNC4CCOCC4)cc(C)nc23)c(Cl)c1 |(28.08,-21.34,;29.62,-21.32,;30.38,-19.98,;29.6,-18.65,;30.35,-17.31,;29.57,-15.98,;31.89,-17.31,;32.64,-15.97,;31.74,-14.71,;30.2,-14.71,;32.65,-13.46,;34.12,-13.94,;35.45,-13.17,;35.44,-11.63,;36.78,-10.86,;38.11,-11.63,;39.44,-10.86,;40.77,-11.64,;40.76,-13.17,;42.08,-13.95,;43.42,-13.2,;43.43,-11.66,;42.11,-10.87,;36.78,-13.94,;36.79,-15.49,;38.12,-16.26,;35.45,-16.26,;34.12,-15.49,;32.68,-18.62,;34.22,-18.59,;31.93,-19.96,)| InChI=1S/C22H27Cl2N5O2/c1-13-10-19(26-7-6-25-15-4-8-31-9-5-15)29-22(27-13)20(14(2)28-29)21-17(23)11-16(30-3)12-18(21)24/h10-12,15,25-26H,4-9H2,1-3H3 CVABPTLRAQIZJU-UHFFFAOYSA-N 50342721 N1-(3-(2,6-dichloro-4-methoxyphenyl)-2,5-dimethylpyrazolo[1,5-a]pyrimidin-7-yl)-N2-(tetrahydro-2H-pyran-4-yl)ethane-1,2-diamine::CHEMBL1771259 Neuropeptide Y receptor type 1 Homo sapiens 1 ChEMBL 10.1016/j.bmcl.2010.12.116 10.7270/Q2BP0336 21295475 Griffith, DA; Hargrove, DM; Maurer, TS; Blum, CA; De Lombaert, S; Inthavongsay, JK; Klade, LE; Mack, CM; Rose, CR; Sanders, MJ; Carpino, PA 4/25/2011 12/3/2011 Pfizer http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50342721 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50342721&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 9869041 131345657 CHEMBL1771259 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50636913 Cc1nn2c(NCCNC3CCOCC3)cc(C)nc2c1-c1c(Cl)cccc1Cl |(6.47,-15.43,;8.01,-15.43,;8.93,-14.18,;10.4,-14.66,;11.73,-13.89,;11.72,-12.35,;13.05,-11.58,;14.39,-12.34,;15.72,-11.57,;17.05,-12.35,;17.03,-13.89,;18.35,-14.67,;19.7,-13.92,;19.71,-12.37,;18.38,-11.59,;13.06,-14.65,;13.07,-16.2,;14.4,-16.97,;11.73,-16.98,;10.39,-16.21,;8.92,-16.68,;8.16,-18.02,;6.63,-18.03,;5.85,-16.7,;5.87,-19.37,;6.66,-20.7,;8.2,-20.68,;8.95,-19.33,;10.49,-19.31,)| InChI=1S/C21H25Cl2N5O/c1-13-12-18(25-9-8-24-15-6-10-29-11-7-15)28-21(26-13)19(14(2)27-28)20-16(22)4-3-5-17(20)23/h3-5,12,15,24-25H,6-11H2,1-2H3 URLFCWFWFYOCGV-UHFFFAOYSA-N 50342729 N1-(3-(2,6-dichlorophenyl)-2,5-dimethylpyrazolo[1,5-a]pyrimidin-7-yl)-N2-(tetrahydro-2H-pyran-4-yl)ethane-1,2-diamine::CHEMBL1771258 Neuropeptide Y receptor type 1 Homo sapiens 7 ChEMBL 10.1016/j.bmcl.2010.12.116 10.7270/Q2BP0336 21295475 Griffith, DA; Hargrove, DM; Maurer, TS; Blum, CA; De Lombaert, S; Inthavongsay, JK; Klade, LE; Mack, CM; Rose, CR; Sanders, MJ; Carpino, PA 4/25/2011 12/3/2011 Pfizer http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50342729 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50342729&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 9932616 131345665 CHEMBL1771258 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50636914 Cc1nn2c(NCCNC3CCCC3)cc(C)nc2c1-c1c(Cl)cccc1Cl |(-9.32,-14.84,;-7.78,-14.84,;-6.87,-13.59,;-5.4,-14.07,;-4.07,-13.31,;-4.08,-11.77,;-2.74,-10.99,;-1.41,-11.76,;-.08,-10.99,;1.12,-11.96,;1.04,-13.49,;2.48,-14.04,;3.45,-12.84,;2.61,-11.55,;-2.74,-14.07,;-2.73,-15.62,;-1.4,-16.39,;-4.07,-16.39,;-5.4,-15.62,;-6.87,-16.1,;-7.63,-17.44,;-9.17,-17.44,;-9.95,-16.12,;-9.92,-18.78,;-9.14,-20.11,;-7.59,-20.09,;-6.84,-18.75,;-5.3,-18.73,)| InChI=1S/C21H25Cl2N5/c1-13-12-18(25-11-10-24-15-6-3-4-7-15)28-21(26-13)19(14(2)27-28)20-16(22)8-5-9-17(20)23/h5,8-9,12,15,24-25H,3-4,6-7,10-11H2,1-2H3 QWBDMPTVXYWNBF-UHFFFAOYSA-N 50342730 N1-cyclopentyl-N2-(3-(2,6-dichlorophenyl)-2,5-dimethylpyrazolo[1,5-a]pyrimidin-7-yl)ethane-1,2-diamine::CHEMBL1771257 Neuropeptide Y receptor type 1 Homo sapiens 38 ChEMBL 10.1016/j.bmcl.2010.12.116 10.7270/Q2BP0336 21295475 Griffith, DA; Hargrove, DM; Maurer, TS; Blum, CA; De Lombaert, S; Inthavongsay, JK; Klade, LE; Mack, CM; Rose, CR; Sanders, MJ; Carpino, PA 4/25/2011 12/3/2011 Pfizer http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50342730 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50342730&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 54580549 131345666 CHEMBL1771257 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50636915 Cc1nn2c(NCCNC3CCCC3)cc(C)nc2c1-c1c(C)cc(C)cc1C |(25.6,-3.01,;27.14,-3.01,;28.05,-1.76,;29.52,-2.24,;30.85,-1.48,;30.85,.06,;32.18,.84,;33.51,.07,;34.85,.84,;36.1,-.05,;36.11,-1.58,;37.58,-2.05,;38.47,-.79,;37.56,.45,;32.19,-2.24,;32.19,-3.79,;33.53,-4.56,;30.85,-4.56,;29.52,-3.79,;28.05,-4.27,;27.29,-5.61,;25.75,-5.61,;24.98,-4.29,;25,-6.95,;25.78,-8.28,;25.03,-9.62,;27.33,-8.26,;28.08,-6.92,;29.62,-6.9,)| InChI=1S/C24H33N5/c1-15-12-16(2)22(17(3)13-15)23-19(5)28-29-21(14-18(4)27-24(23)29)26-11-10-25-20-8-6-7-9-20/h12-14,20,25-26H,6-11H2,1-5H3 DVEWGRXTKZEQIV-UHFFFAOYSA-N 50342731 N1-cyclopentyl-N2-(3-mesityl-2,5-dimethylpyrazolo[1,5-a]pyrimidin-7-yl)ethane-1,2-diamine::CHEMBL1771256 Neuropeptide Y receptor type 1 Homo sapiens 21 ChEMBL 10.1016/j.bmcl.2010.12.116 10.7270/Q2BP0336 21295475 Griffith, DA; Hargrove, DM; Maurer, TS; Blum, CA; De Lombaert, S; Inthavongsay, JK; Klade, LE; Mack, CM; Rose, CR; Sanders, MJ; Carpino, PA 4/25/2011 12/3/2011 Pfizer http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50342731 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50342731&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 9908496 131345667 CHEMBL1771256 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50636916 COc1ccc(CCNCCNc2cc(C)nc3c(c(C)nn23)-c2c(C)cc(C)cc2C)cc1 |(23.86,-.34,;22.53,-1.12,;21.19,-.35,;19.86,-1.13,;18.52,-.36,;18.53,1.18,;17.19,1.94,;15.86,1.17,;14.52,1.94,;13.19,1.17,;11.86,1.93,;10.52,1.16,;10.53,-.38,;11.86,-1.14,;11.87,-2.69,;13.2,-3.46,;10.53,-3.47,;9.2,-2.7,;7.72,-3.17,;6.82,-1.92,;5.28,-1.92,;7.73,-.67,;9.2,-1.15,;6.97,-4.51,;5.43,-4.52,;4.65,-3.19,;4.68,-5.86,;5.46,-7.19,;4.7,-8.53,;7.01,-7.17,;7.76,-5.82,;9.3,-5.8,;19.85,1.95,;21.18,1.19,)| InChI=1S/C28H35N5O/c1-18-15-19(2)26(20(3)16-18)27-22(5)32-33-25(17-21(4)31-28(27)33)30-14-13-29-12-11-23-7-9-24(34-6)10-8-23/h7-10,15-17,29-30H,11-14H2,1-6H3 QJJMKLJWZWFUNB-UHFFFAOYSA-N 50342732 N1-(3-mesityl-2,5-dimethylpyrazolo[1,5-a]pyrimidin-7-yl)-N2-(4-methoxyphenethyl)ethane-1,2-diamine::CHEMBL1771255 Neuropeptide Y receptor type 1 Homo sapiens 29 ChEMBL 10.1016/j.bmcl.2010.12.116 10.7270/Q2BP0336 21295475 Griffith, DA; Hargrove, DM; Maurer, TS; Blum, CA; De Lombaert, S; Inthavongsay, JK; Klade, LE; Mack, CM; Rose, CR; Sanders, MJ; Carpino, PA 4/25/2011 12/3/2011 Pfizer http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50342732 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50342732&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 9868731 131345668 CHEMBL1771255 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50636917 Cc1nn2c(NCCN)cc(C)nc2c1-c1c(C)cc(C)cc1C |(-6.18,-.74,;-4.64,-.74,;-3.73,.51,;-2.26,.03,;-.93,.79,;-.93,2.33,;.4,3.11,;1.73,2.34,;3.07,3.11,;.41,.03,;.41,-1.52,;1.75,-2.29,;-.93,-2.29,;-2.26,-1.52,;-3.73,-2,;-4.49,-3.34,;-6.03,-3.34,;-6.8,-2.01,;-6.78,-4.68,;-6,-6.01,;-6.75,-7.35,;-4.45,-5.99,;-3.7,-4.65,;-2.16,-4.63,)| InChI=1S/C19H25N5/c1-11-8-12(2)17(13(3)9-11)18-15(5)23-24-16(21-7-6-20)10-14(4)22-19(18)24/h8-10,21H,6-7,20H2,1-5H3 UVAHCYCPGXCPIU-UHFFFAOYSA-N 50342733 N1-(3-mesityl-2,5-dimethylpyrazolo[1,5-a]pyrimidin-7-yl)ethane-1,2-diamine::CHEMBL1771254 Neuropeptide Y receptor type 1 Homo sapiens 2300 ChEMBL 10.1016/j.bmcl.2010.12.116 10.7270/Q2BP0336 21295475 Griffith, DA; Hargrove, DM; Maurer, TS; Blum, CA; De Lombaert, S; Inthavongsay, JK; Klade, LE; Mack, CM; Rose, CR; Sanders, MJ; Carpino, PA 4/25/2011 12/3/2011 Pfizer http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50342733 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50342733&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 22617869 131345669 CHEMBL1771254 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50636918 COc1cc(Cl)c(-c2c(C)nn3c(NCCNC4CCOCC4)cc(C)nc23)c(Cl)c1 |(28.08,-21.34,;29.62,-21.32,;30.38,-19.98,;29.6,-18.65,;30.35,-17.31,;29.57,-15.98,;31.89,-17.31,;32.64,-15.97,;31.74,-14.71,;30.2,-14.71,;32.65,-13.46,;34.12,-13.94,;35.45,-13.17,;35.44,-11.63,;36.78,-10.86,;38.11,-11.63,;39.44,-10.86,;40.77,-11.64,;40.76,-13.17,;42.08,-13.95,;43.42,-13.2,;43.43,-11.66,;42.11,-10.87,;36.78,-13.94,;36.79,-15.49,;38.12,-16.26,;35.45,-16.26,;34.12,-15.49,;32.68,-18.62,;34.22,-18.59,;31.93,-19.96,)| InChI=1S/C22H27Cl2N5O2/c1-13-10-19(26-7-6-25-15-4-8-31-9-5-15)29-22(27-13)20(14(2)28-29)21-17(23)11-16(30-3)12-18(21)24/h10-12,15,25-26H,4-9H2,1-3H3 CVABPTLRAQIZJU-UHFFFAOYSA-N 50342721 N1-(3-(2,6-dichloro-4-methoxyphenyl)-2,5-dimethylpyrazolo[1,5-a]pyrimidin-7-yl)-N2-(tetrahydro-2H-pyran-4-yl)ethane-1,2-diamine::CHEMBL1771259 Neuropeptide Y receptor type 1 Rattus norvegicus 3.5 ChEMBL 10.1016/j.bmcl.2010.12.116 10.7270/Q2BP0336 21295475 Griffith, DA; Hargrove, DM; Maurer, TS; Blum, CA; De Lombaert, S; Inthavongsay, JK; Klade, LE; Mack, CM; Rose, CR; Sanders, MJ; Carpino, PA 4/25/2011 12/3/2011 Pfizer http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50342721 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000837&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50342721&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 9869041 131345657 CHEMBL1771259 1 MNSTLFSRVENYSVHYNVSENSPFLAFENDDCHLPLAVIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAVMCLPFTFVYTLMDHWVFGETMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYIGITVIWVLAVASSLPFVIYQILTDEPFQNVSLAAFKDKYVCFDKFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKIRDSKYRSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKISMNDNEKI Neuropeptide Y receptor type 1 NPY1R_RAT P21555 50636919 CCOc1cc(Cl)c(-c2c(C)nn3c(NCCNC4CCOCC4)cc(C)nc23)c(Cl)c1 |(-10.58,-34.36,;-9.79,-35.68,;-8.25,-35.66,;-7.5,-34.32,;-8.28,-32.99,;-7.53,-31.65,;-8.3,-30.33,;-5.99,-31.65,;-5.23,-30.31,;-6.14,-29.05,;-7.68,-29.05,;-5.23,-27.8,;-3.76,-28.28,;-2.43,-27.52,;-2.43,-25.98,;-1.1,-25.2,;.23,-25.97,;1.57,-25.2,;2.89,-25.98,;2.88,-27.52,;4.2,-28.3,;5.54,-27.54,;5.56,-26,;4.23,-25.21,;-1.1,-28.28,;-1.09,-29.83,;.25,-30.6,;-2.43,-30.6,;-3.76,-29.83,;-5.2,-32.96,;-3.66,-32.94,;-5.95,-34.3,)| InChI=1S/C23H29Cl2N5O2/c1-4-32-17-12-18(24)22(19(25)13-17)21-15(3)29-30-20(11-14(2)28-23(21)30)27-8-7-26-16-5-9-31-10-6-16/h11-13,16,26-27H,4-10H2,1-3H3 KXVKWNPVAHBIOP-UHFFFAOYSA-N 50342728 N1-(3-(2,6-dichloro-4-ethoxyphenyl)-2,5-dimethylpyrazolo[1,5-a]pyrimidin-7-yl)-N2-(tetrahydro-2H-pyran-4-yl)ethane-1,2-diamine::CHEMBL1771260 Neuropeptide Y receptor type 1 Homo sapiens 15 ChEMBL 10.1016/j.bmcl.2010.12.116 10.7270/Q2BP0336 21295475 Griffith, DA; Hargrove, DM; Maurer, TS; Blum, CA; De Lombaert, S; Inthavongsay, JK; Klade, LE; Mack, CM; Rose, CR; Sanders, MJ; Carpino, PA 4/25/2011 12/3/2011 Pfizer http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50342728 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50342728&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 9869677 131345664 CHEMBL1771260 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50636920 CCCOc1cc(Cl)c(-c2c(C)nn3c(NCCNC4CCOCC4)cc(C)nc23)c(Cl)c1 |(5.54,-21.28,;7.08,-21.27,;7.87,-22.59,;9.41,-22.57,;10.16,-21.23,;9.38,-19.9,;10.14,-18.56,;9.36,-17.24,;11.67,-18.56,;12.43,-17.22,;11.52,-15.96,;9.98,-15.96,;12.43,-14.71,;13.9,-15.19,;15.23,-14.43,;15.23,-12.89,;16.56,-12.11,;17.9,-12.88,;19.23,-12.11,;20.56,-12.89,;20.54,-14.43,;21.86,-15.21,;23.2,-14.45,;23.22,-12.91,;21.89,-12.12,;16.57,-15.19,;16.57,-16.74,;17.91,-17.51,;15.24,-17.51,;13.9,-16.74,;12.46,-19.87,;14,-19.85,;11.71,-21.21,)| InChI=1S/C24H31Cl2N5O2/c1-4-9-33-18-13-19(25)23(20(26)14-18)22-16(3)30-31-21(12-15(2)29-24(22)31)28-8-7-27-17-5-10-32-11-6-17/h12-14,17,27-28H,4-11H2,1-3H3 BDXJFKAUYFPXFH-UHFFFAOYSA-N 50342727 N1-(3-(2,6-dichloro-4-propoxyphenyl)-2,5-dimethylpyrazolo[1,5-a]pyrimidin-7-yl)-N2-(tetrahydro-2H-pyran-4-yl)ethane-1,2-diamine::CHEMBL1771261 Neuropeptide Y receptor type 1 Homo sapiens 207 ChEMBL 10.1016/j.bmcl.2010.12.116 10.7270/Q2BP0336 21295475 Griffith, DA; Hargrove, DM; Maurer, TS; Blum, CA; De Lombaert, S; Inthavongsay, JK; Klade, LE; Mack, CM; Rose, CR; Sanders, MJ; Carpino, PA 4/25/2011 12/3/2011 Pfizer http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50342727 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50342727&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 9805674 131345663 CHEMBL1771261 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 50636921 COc1cc(Cl)c(-c2c(C)nn3c(NCCNC4CCOCC4)cc(C)nc23)c(Cl)c1 |(28.08,-21.34,;29.62,-21.32,;30.38,-19.98,;29.6,-18.65,;30.35,-17.31,;29.57,-15.98,;31.89,-17.31,;32.64,-15.97,;31.74,-14.71,;30.2,-14.71,;32.65,-13.46,;34.12,-13.94,;35.45,-13.17,;35.44,-11.63,;36.78,-10.86,;38.11,-11.63,;39.44,-10.86,;40.77,-11.64,;40.76,-13.17,;42.08,-13.95,;43.42,-13.2,;43.43,-11.66,;42.11,-10.87,;36.78,-13.94,;36.79,-15.49,;38.12,-16.26,;35.45,-16.26,;34.12,-15.49,;32.68,-18.62,;34.22,-18.59,;31.93,-19.96,)| InChI=1S/C22H27Cl2N5O2/c1-13-10-19(26-7-6-25-15-4-8-31-9-5-15)29-22(27-13)20(14(2)28-29)21-17(23)11-16(30-3)12-18(21)24/h10-12,15,25-26H,4-9H2,1-3H3 CVABPTLRAQIZJU-UHFFFAOYSA-N 50342721 N1-(3-(2,6-dichloro-4-methoxyphenyl)-2,5-dimethylpyrazolo[1,5-a]pyrimidin-7-yl)-N2-(tetrahydro-2H-pyran-4-yl)ethane-1,2-diamine::CHEMBL1771259 Neuropeptide Y receptor type 2 Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2010.12.116 10.7270/Q2BP0336 21295475 Griffith, DA; Hargrove, DM; Maurer, TS; Blum, CA; De Lombaert, S; Inthavongsay, JK; Klade, LE; Mack, CM; Rose, CR; Sanders, MJ; Carpino, PA 4/25/2011 12/3/2011 Pfizer http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50342721 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50342721&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 9869041 131345657 CHEMBL1771259 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 50636922 COc1cc(Cl)c(-c2c(C)nn3c(NCCNC4CCOCC4)cc(C)nc23)c(Cl)c1 |(28.08,-21.34,;29.62,-21.32,;30.38,-19.98,;29.6,-18.65,;30.35,-17.31,;29.57,-15.98,;31.89,-17.31,;32.64,-15.97,;31.74,-14.71,;30.2,-14.71,;32.65,-13.46,;34.12,-13.94,;35.45,-13.17,;35.44,-11.63,;36.78,-10.86,;38.11,-11.63,;39.44,-10.86,;40.77,-11.64,;40.76,-13.17,;42.08,-13.95,;43.42,-13.2,;43.43,-11.66,;42.11,-10.87,;36.78,-13.94,;36.79,-15.49,;38.12,-16.26,;35.45,-16.26,;34.12,-15.49,;32.68,-18.62,;34.22,-18.59,;31.93,-19.96,)| InChI=1S/C22H27Cl2N5O2/c1-13-10-19(26-7-6-25-15-4-8-31-9-5-15)29-22(27-13)20(14(2)28-29)21-17(23)11-16(30-3)12-18(21)24/h10-12,15,25-26H,4-9H2,1-3H3 CVABPTLRAQIZJU-UHFFFAOYSA-N 50342721 N1-(3-(2,6-dichloro-4-methoxyphenyl)-2,5-dimethylpyrazolo[1,5-a]pyrimidin-7-yl)-N2-(tetrahydro-2H-pyran-4-yl)ethane-1,2-diamine::CHEMBL1771259 Neuropeptide Y receptor type 5 Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2010.12.116 10.7270/Q2BP0336 21295475 Griffith, DA; Hargrove, DM; Maurer, TS; Blum, CA; De Lombaert, S; Inthavongsay, JK; Klade, LE; Mack, CM; Rose, CR; Sanders, MJ; Carpino, PA 4/25/2011 12/3/2011 Pfizer http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50342721 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50342721&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 9869041 131345657 CHEMBL1771259 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 50636923 Cc1nn2c(NCCN)cc(C)nc2c1-c1c(C)cc(C)cc1C |(-6.18,-.74,;-4.64,-.74,;-3.73,.51,;-2.26,.03,;-.93,.79,;-.93,2.33,;.4,3.11,;1.73,2.34,;3.07,3.11,;.41,.03,;.41,-1.52,;1.75,-2.29,;-.93,-2.29,;-2.26,-1.52,;-3.73,-2,;-4.49,-3.34,;-6.03,-3.34,;-6.8,-2.01,;-6.78,-4.68,;-6,-6.01,;-6.75,-7.35,;-4.45,-5.99,;-3.7,-4.65,;-2.16,-4.63,)| InChI=1S/C19H25N5/c1-11-8-12(2)17(13(3)9-11)18-15(5)23-24-16(21-7-6-20)10-14(4)22-19(18)24/h8-10,21H,6-7,20H2,1-5H3 UVAHCYCPGXCPIU-UHFFFAOYSA-N 50342733 N1-(3-mesityl-2,5-dimethylpyrazolo[1,5-a]pyrimidin-7-yl)ethane-1,2-diamine::CHEMBL1771254 Corticotropin-releasing factor receptor 1 Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2010.12.116 10.7270/Q2BP0336 21295475 Griffith, DA; Hargrove, DM; Maurer, TS; Blum, CA; De Lombaert, S; Inthavongsay, JK; Klade, LE; Mack, CM; Rose, CR; Sanders, MJ; Carpino, PA 4/25/2011 12/3/2011 Pfizer http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50342733 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5588&target=Corticotropin-releasing+factor+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50342733&enzyme=Corticotropin-releasing+factor+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 22617869 131345669 CHEMBL1771254 1 MGGHPQLRLVKALLLLGLNPVSASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTMSPEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIRARVARAMSIPTSPTRVSFHSIKQSTAV 6PB0,3EHT,3EHS,3EHU,2L27 Corticotropin-releasing factor receptor 1 CRFR1_HUMAN P34998 B4DIE9 Q13008 Q4QRJ1 Q9UK64 50636924 CCN(CCN)c1nc(C)nc2n(-c3c(C)cc(C)cc3C)c3ccccc3c12 |(1.53,-.87,;2.87,-.1,;4.2,-.86,;5.53,-.09,;6.87,-.86,;8.2,-.08,;4.2,-2.4,;5.54,-3.17,;5.54,-4.72,;6.88,-5.48,;4.21,-5.49,;2.87,-4.72,;1.4,-5.19,;.64,-6.53,;-.89,-6.54,;-1.67,-5.21,;-1.65,-7.88,;-.86,-9.21,;-1.62,-10.55,;.68,-9.19,;1.43,-7.85,;2.97,-7.82,;.49,-3.94,;-1.04,-3.78,;-1.67,-2.38,;-.76,-1.12,;.78,-1.28,;1.4,-2.69,;2.88,-3.17,)| InChI=1S/C24H29N5/c1-6-28(12-11-25)23-21-19-9-7-8-10-20(19)29(24(21)27-18(5)26-23)22-16(3)13-15(2)14-17(22)4/h7-10,13-14H,6,11-12,25H2,1-5H3 SGLVOPQINJXTEY-UHFFFAOYSA-N 50342734 N-(2-Aminoethyl)-N-ethyl-9-mesityl-2-methyl-9H-pyrimido[4, 5-b]indol-4-amine::CHEMBL1771267 Corticotropin-releasing factor receptor 1 Homo sapiens 4474 ChEMBL 10.1016/j.bmcl.2010.12.116 10.7270/Q2BP0336 21295475 Griffith, DA; Hargrove, DM; Maurer, TS; Blum, CA; De Lombaert, S; Inthavongsay, JK; Klade, LE; Mack, CM; Rose, CR; Sanders, MJ; Carpino, PA 4/25/2011 12/3/2011 Pfizer http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50342734 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5588&target=Corticotropin-releasing+factor+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50342734&enzyme=Corticotropin-releasing+factor+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 54586411 131345670 CHEMBL1771267 1 MGGHPQLRLVKALLLLGLNPVSASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTMSPEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIRARVARAMSIPTSPTRVSFHSIKQSTAV 6PB0,3EHT,3EHS,3EHU,2L27 Corticotropin-releasing factor receptor 1 CRFR1_HUMAN P34998 B4DIE9 Q13008 Q4QRJ1 Q9UK64