BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 51019340 CC(C)(C(=O)Nc1ccc(N2CCC3(CCN(CC4CC4)C3)CC2)c(Cl)c1)c1nccc(n1)C(F)(F)F InChI=1S/C27H33ClF3N5O/c1-25(2,23-32-11-7-22(34-23)27(29,30)31)24(37)33-19-5-6-21(20(28)15-19)36-13-9-26(10-14-36)8-12-35(17-26)16-18-3-4-18/h5-7,11,15,18H,3-4,8-10,12-14,16-17H2,1-2H3,(H,33,37) PZAIVSQWZAHADG-UHFFFAOYSA-N 50417471 CHEMBL1287953 Neuropeptide Y receptor type 2 Homo sapiens 158.49 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417471 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417471&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 50925473 163366495 CHEMBL1287953 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 51019341 CC(C)(C)C(=O)Nc1ccc(N2CCN(Cc3ccccc3)CC2)c(Cl)c1 InChI=1S/C22H28ClN3O/c1-22(2,3)21(27)24-18-9-10-20(19(23)15-18)26-13-11-25(12-14-26)16-17-7-5-4-6-8-17/h4-10,15H,11-14,16H2,1-3H3,(H,24,27) XVYXRGWGLYPKEK-UHFFFAOYSA-N 50417472 CHEMBL1287954 Neuropeptide Y receptor type 2 Homo sapiens 251.19 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417472 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417472&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 52947327 163366496 CHEMBL1287954 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 51019342 CC(C)(C)C(=O)Nc1ccc(N2CCN(Cc3cccc(F)c3)CC2)c(Cl)c1 InChI=1S/C22H27ClFN3O/c1-22(2,3)21(28)25-18-7-8-20(19(23)14-18)27-11-9-26(10-12-27)15-16-5-4-6-17(24)13-16/h4-8,13-14H,9-12,15H2,1-3H3,(H,25,28) RIPVKVKXBRSNKK-UHFFFAOYSA-N 50417473 CHEMBL1287985 Neuropeptide Y receptor type 2 Homo sapiens 200 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417473 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417473&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 52949765 163366497 CHEMBL1287985 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 51019343 CC(C)(C)C(=O)Nc1ccc(N2CCN(Cc3ccc(F)cc3)CC2)c(Cl)c1 InChI=1S/C22H27ClFN3O/c1-22(2,3)21(28)25-18-8-9-20(19(23)14-18)27-12-10-26(11-13-27)15-16-4-6-17(24)7-5-16/h4-9,14H,10-13,15H2,1-3H3,(H,25,28) VEAZSBOEIZAMHH-UHFFFAOYSA-N 50417474 CHEMBL1288015 Neuropeptide Y receptor type 2 Homo sapiens 200 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417474 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417474&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 52949775 163366498 CHEMBL1288015 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 51019344 Clc1cc(NC(=O)C(c2ccccc2)c2ccccc2)ccc1N1CCC(CC1)N1CCCCC1 InChI=1S/C30H34ClN3O/c31-27-22-25(14-15-28(27)34-20-16-26(17-21-34)33-18-8-3-9-19-33)32-30(35)29(23-10-4-1-5-11-23)24-12-6-2-7-13-24/h1-2,4-7,10-15,22,26,29H,3,8-9,16-21H2,(H,32,35) QOGBCJRXYIXXHR-UHFFFAOYSA-N 50417475 CHEMBL1288016 Neuropeptide Y receptor type 2 Homo sapiens 50.12 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417475 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417475&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 52942479 163366499 CHEMBL1288016 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 51019345 CC(C)(C(=O)Nc1ccc(N2CCC(CC2)N2CCCCC2)c(Cl)c1)c1ccccc1 InChI=1S/C26H34ClN3O/c1-26(2,20-9-5-3-6-10-20)25(31)28-21-11-12-24(23(27)19-21)30-17-13-22(14-18-30)29-15-7-4-8-16-29/h3,5-6,9-12,19,22H,4,7-8,13-18H2,1-2H3,(H,28,31) WJCNUUYTAXRACE-UHFFFAOYSA-N 50417476 CHEMBL1288048 Neuropeptide Y receptor type 2 Homo sapiens 316.23 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417476 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417476&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 52945324 163366500 CHEMBL1288048 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 51019346 Clc1cc(NC(=O)C2(CCC2)c2ccccc2)ccc1N1CCC(CC1)N1CCCCC1 InChI=1S/C27H34ClN3O/c28-24-20-22(29-26(32)27(14-7-15-27)21-8-3-1-4-9-21)10-11-25(24)31-18-12-23(13-19-31)30-16-5-2-6-17-30/h1,3-4,8-11,20,23H,2,5-7,12-19H2,(H,29,32) OVDWLFCXCHIGBW-UHFFFAOYSA-N 50417477 CHEMBL1288049 Neuropeptide Y receptor type 2 Homo sapiens 79.43 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417477 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417477&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 52949776 163366501 CHEMBL1288049 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 51019347 Cc1cccc(c1)C(C)(C)C(=O)Nc1ccc(N2CCC(CC2)N2CCCCC2)c(Cl)c1 InChI=1S/C27H36ClN3O/c1-20-8-7-9-21(18-20)27(2,3)26(32)29-22-10-11-25(24(28)19-22)31-16-12-23(13-17-31)30-14-5-4-6-15-30/h7-11,18-19,23H,4-6,12-17H2,1-3H3,(H,29,32) MYFUPUVJZDTVAD-UHFFFAOYSA-N 50417478 CHEMBL1288077 Neuropeptide Y receptor type 2 Homo sapiens 63.1 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417478 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417478&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 52948566 163366502 CHEMBL1288077 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 51019348 CC(C)(C(=O)Nc1ccc(N2CCC(CC2)N2CCCCC2)c(Cl)c1)c1cccc(c1)C(F)(F)F InChI=1S/C27H33ClF3N3O/c1-26(2,19-7-6-8-20(17-19)27(29,30)31)25(35)32-21-9-10-24(23(28)18-21)34-15-11-22(12-16-34)33-13-4-3-5-14-33/h6-10,17-18,22H,3-5,11-16H2,1-2H3,(H,32,35) BPGOSRQFTCQNCB-UHFFFAOYSA-N 50417479 CHEMBL1288078 Neuropeptide Y receptor type 2 Homo sapiens 15.85 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417479 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417479&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 52948948 163366503 CHEMBL1288078 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 51019349 Clc1cc(NC(=O)C(c2ccccc2)c2ccccn2)ccc1N1CCC(CC1)N1CCCCC1 InChI=1S/C29H33ClN4O/c30-25-21-23(12-13-27(25)34-19-14-24(15-20-34)33-17-7-2-8-18-33)32-29(35)28(22-9-3-1-4-10-22)26-11-5-6-16-31-26/h1,3-6,9-13,16,21,24,28H,2,7-8,14-15,17-20H2,(H,32,35) ZXZKBILOKRHPGH-UHFFFAOYSA-N 50417480 CHEMBL1287814 Neuropeptide Y receptor type 2 Homo sapiens 316.23 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417480 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417480&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 52947300 163366504 CHEMBL1287814 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 51019350 CCNC1CCN(CC1)c1ccc(NC(=O)C(C)(C)c2ccccc2)cc1Cl InChI=1S/C23H30ClN3O/c1-4-25-18-12-14-27(15-13-18)21-11-10-19(16-20(21)24)26-22(28)23(2,3)17-8-6-5-7-9-17/h5-11,16,18,25H,4,12-15H2,1-3H3,(H,26,28) VPQLBQCWPABRAT-UHFFFAOYSA-N 50417481 CHEMBL1288108 Neuropeptide Y receptor type 2 Homo sapiens 1995.26 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417481 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417481&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 52946124 163366505 CHEMBL1288108 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 51019351 CC(C)NC1CCN(CC1)c1ccc(NC(=O)C(C)(C)c2ccccc2)cc1Cl InChI=1S/C24H32ClN3O/c1-17(2)26-19-12-14-28(15-13-19)22-11-10-20(16-21(22)25)27-23(29)24(3,4)18-8-6-5-7-9-18/h5-11,16-17,19,26H,12-15H2,1-4H3,(H,27,29) AKLVTHKWZDHWGM-UHFFFAOYSA-N 50417482 CHEMBL1288138 Neuropeptide Y receptor type 2 Homo sapiens 1000 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417482 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417482&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 52947370 163366506 CHEMBL1288138 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 51019352 CCCNC1CCN(CC1)c1ccc(NC(=O)C(C)(C)c2ccccc2)cc1Cl InChI=1S/C24H32ClN3O/c1-4-14-26-19-12-15-28(16-13-19)22-11-10-20(17-21(22)25)27-23(29)24(2,3)18-8-6-5-7-9-18/h5-11,17,19,26H,4,12-16H2,1-3H3,(H,27,29) MTLNHBWTMPTTGW-UHFFFAOYSA-N 50417483 CHEMBL1288139 Neuropeptide Y receptor type 2 Homo sapiens 251.19 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417483 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417483&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 52942508 163366507 CHEMBL1288139 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 51019353 CC(C)CNC1CCN(CC1)c1ccc(NC(=O)C(C)(C)c2ccccc2)cc1Cl InChI=1S/C25H34ClN3O/c1-18(2)17-27-20-12-14-29(15-13-20)23-11-10-21(16-22(23)26)28-24(30)25(3,4)19-8-6-5-7-9-19/h5-11,16,18,20,27H,12-15,17H2,1-4H3,(H,28,30) TYZKGTMEWCRMDR-UHFFFAOYSA-N 50417484 CHEMBL1288169 Neuropeptide Y receptor type 2 Homo sapiens 79.43 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417484 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417484&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 52947375 163366508 CHEMBL1288169 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 51019354 COc1cccnc1C(=O)N1CCN(CC1)c1ccc(NC(=O)C(C)(C)c2ccccc2)cc1Cl InChI=1S/C27H29ClN4O3/c1-27(2,19-8-5-4-6-9-19)26(34)30-20-11-12-22(21(28)18-20)31-14-16-32(17-15-31)25(33)24-23(35-3)10-7-13-29-24/h4-13,18H,14-17H2,1-3H3,(H,30,34) WIHRUDKZTYLJLT-UHFFFAOYSA-N 50414468 CHEMBL1196581::CHEMBL557502 Neuropeptide Y receptor type 2 Homo sapiens 25.12 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50414468 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50414468&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 44249749 163363492 CHEMBL557502CHEMBL1196581 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 51019355 COc1cccnc1C(=O)N1CCN(CC1)c1ccc(NC(=O)C(C)(C)c2ccccc2)cc1Cl InChI=1S/C27H29ClN4O3/c1-27(2,19-8-5-4-6-9-19)26(34)30-20-11-12-22(21(28)18-20)31-14-16-32(17-15-31)25(33)24-23(35-3)10-7-13-29-24/h4-13,18H,14-17H2,1-3H3,(H,30,34) WIHRUDKZTYLJLT-UHFFFAOYSA-N 50414468 CHEMBL1196581::CHEMBL557502 Neuropeptide Y-Y2 receptor Rattus norvegicus 50.12 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50414468 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006277&target=Neuropeptide+Y-Y2+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50414468&enzyme=Neuropeptide+Y-Y2+receptor&column=ki&startPg=0&Increment=50&submit=Search 44249749 163363492 CHEMBL557502CHEMBL1196581 1 EYSLIEIIPDFEIVACTEKWPGEEKSVYGTVYSLSTLLILYVLPLGIISFSYTRIWSKLKNHVSPGAASDHYHQRR Neuropeptide Y-Y2 receptor O70424_RAT O70424 51019356 CC(C)(C(=O)Nc1ccc(N2CCC(CC2)NCC2CC2)c(Cl)c1)c1ccccc1 InChI=1S/C25H32ClN3O/c1-25(2,19-6-4-3-5-7-19)24(30)28-21-10-11-23(22(26)16-21)29-14-12-20(13-15-29)27-17-18-8-9-18/h3-7,10-11,16,18,20,27H,8-9,12-15,17H2,1-2H3,(H,28,30) ISJDSDZIGNFKNR-UHFFFAOYSA-N 50417486 CHEMBL1288170 Neuropeptide Y receptor type 2 Homo sapiens 125.89 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417486 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417486&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 50925474 163366510 CHEMBL1288170 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 51019357 Cc1cccc(c1)C(C)(C)C(=O)Nc1ccc(N2CCC(CC2)NCC2CC2)c(Cl)c1 InChI=1S/C26H34ClN3O/c1-18-5-4-6-20(15-18)26(2,3)25(31)29-22-9-10-24(23(27)16-22)30-13-11-21(12-14-30)28-17-19-7-8-19/h4-6,9-10,15-16,19,21,28H,7-8,11-14,17H2,1-3H3,(H,29,31) KJQFZAPPDIUPSB-UHFFFAOYSA-N 50417487 CHEMBL1288199 Neuropeptide Y receptor type 2 Homo sapiens 25.12 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417487 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417487&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 50925475 163366511 CHEMBL1288199 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 51019358 CC(C)(C(=O)Nc1ccc(N2CCC(CC2)NCC2CC2)c(Cl)c1)c1cccc(c1)C(F)(F)F InChI=1S/C26H31ClF3N3O/c1-25(2,18-4-3-5-19(14-18)26(28,29)30)24(34)32-21-8-9-23(22(27)15-21)33-12-10-20(11-13-33)31-16-17-6-7-17/h3-5,8-9,14-15,17,20,31H,6-7,10-13,16H2,1-2H3,(H,32,34) IXIYFAWMJZJKNH-UHFFFAOYSA-N 50417488 CHEMBL1288200 Neuropeptide Y receptor type 2 Homo sapiens 19.95 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417488 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417488&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 50925491 163366512 CHEMBL1288200 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 51019359 CC(C)(C(=O)Nc1ccc(N2CCC(CC2)NCC2CC2)c(Cl)c1)c1ccccn1 InChI=1S/C24H31ClN4O/c1-24(2,22-5-3-4-12-26-22)23(30)28-19-8-9-21(20(25)15-19)29-13-10-18(11-14-29)27-16-17-6-7-17/h3-5,8-9,12,15,17-18,27H,6-7,10-11,13-14,16H2,1-2H3,(H,28,30) GBOXXGBLGPRTSS-UHFFFAOYSA-N 50417489 CHEMBL1288226 Neuropeptide Y receptor type 2 Homo sapiens 1258.93 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417489 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417489&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 52946147 163366513 CHEMBL1288226 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 51019360 CC(C)(C(=O)Nc1ccc(N2CCC(CC2)NCC2CC2)c(Cl)c1)c1nccc(n1)C(F)(F)F InChI=1S/C24H29ClF3N5O/c1-23(2,21-29-10-7-20(32-21)24(26,27)28)22(34)31-17-5-6-19(18(25)13-17)33-11-8-16(9-12-33)30-14-15-3-4-15/h5-7,10,13,15-16,30H,3-4,8-9,11-12,14H2,1-2H3,(H,31,34) BXQUPBXNBPJMNC-UHFFFAOYSA-N 50417490 CHEMBL1288227 Neuropeptide Y receptor type 2 Homo sapiens 398.11 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417490 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417490&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 52947384 163366514 CHEMBL1288227 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 51019361 Cc1ccnc(n1)C(C)(C)C(=O)Nc1ccc(N2CCC(CC2)NCC2CC2)c(Cl)c1 InChI=1S/C24H32ClN5O/c1-16-8-11-26-22(28-16)24(2,3)23(31)29-19-6-7-21(20(25)14-19)30-12-9-18(10-13-30)27-15-17-4-5-17/h6-8,11,14,17-18,27H,4-5,9-10,12-13,15H2,1-3H3,(H,29,31) RXLIQBIKVPZJRV-UHFFFAOYSA-N 50417491 CHEMBL1288256 Neuropeptide Y receptor type 2 Homo sapiens 794.33 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417491 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417491&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 52943733 163366515 CHEMBL1288256 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 51019362 CCC(C(=O)Nc1ccc(N2CCC(CC2)NCC2CC2)c(Cl)c1)c1ncccn1 InChI=1S/C23H30ClN5O/c1-2-19(22-25-10-3-11-26-22)23(30)28-18-6-7-21(20(24)14-18)29-12-8-17(9-13-29)27-15-16-4-5-16/h3,6-7,10-11,14,16-17,19,27H,2,4-5,8-9,12-13,15H2,1H3,(H,28,30) XOYLQZAIBBYCBZ-UHFFFAOYSA-N 50417492 CHEMBL1288257 Neuropeptide Y receptor type 2 Homo sapiens 630.96 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417492 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417492&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 52949834 163366516 CHEMBL1288257 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 51019363 CC(C)(C(=O)Nc1ccc(N2CCC3(CCNC3)CC2)c(Cl)c1)c1cccc(c1)C(F)(F)F InChI=1S/C25H29ClF3N3O/c1-23(2,17-4-3-5-18(14-17)25(27,28)29)22(33)31-19-6-7-21(20(26)15-19)32-12-9-24(10-13-32)8-11-30-16-24/h3-7,14-15,30H,8-13,16H2,1-2H3,(H,31,33) DFVGQYLEUTYQBV-UHFFFAOYSA-N 50417493 CHEMBL1288284 Neuropeptide Y receptor type 2 Homo sapiens 15.85 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417493 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417493&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 52948640 163366517 CHEMBL1288284 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 51019364 CC(C)(C(=O)Nc1ccc(N2CCC3(CCN(CC4CC4)C3)CC2)c(Cl)c1)c1cccc(c1)C(F)(F)F InChI=1S/C29H35ClF3N3O/c1-27(2,21-4-3-5-22(16-21)29(31,32)33)26(37)34-23-8-9-25(24(30)17-23)36-14-11-28(12-15-36)10-13-35(19-28)18-20-6-7-20/h3-5,8-9,16-17,20H,6-7,10-15,18-19H2,1-2H3,(H,34,37) ACGCDAQKSJBTTB-UHFFFAOYSA-N 50417494 CHEMBL1288285 Neuropeptide Y receptor type 2 Homo sapiens 2 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417494 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417494&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 50925492 163366518 CHEMBL1288285 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 51019365 CC(C)(C(=O)Nc1ccc(N2CCC3(CCN(CC4CC4)C3)CC2)c(Cl)c1)c1nccc(n1)C(F)(F)F InChI=1S/C27H33ClF3N5O/c1-25(2,23-32-11-7-22(34-23)27(29,30)31)24(37)33-19-5-6-21(20(28)15-19)36-13-9-26(10-14-36)8-12-35(17-26)16-18-3-4-18/h5-7,11,15,18H,3-4,8-10,12-14,16-17H2,1-2H3,(H,33,37) PZAIVSQWZAHADG-UHFFFAOYSA-N 50417471 CHEMBL1287953 Neuropeptide Y-Y2 receptor Rattus norvegicus 63.1 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417471 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006277&target=Neuropeptide+Y-Y2+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417471&enzyme=Neuropeptide+Y-Y2+receptor&column=ki&startPg=0&Increment=50&submit=Search 50925473 163366495 CHEMBL1287953 1 EYSLIEIIPDFEIVACTEKWPGEEKSVYGTVYSLSTLLILYVLPLGIISFSYTRIWSKLKNHVSPGAASDHYHQRR Neuropeptide Y-Y2 receptor O70424_RAT O70424 51019366 CC(C)(C(=O)Nc1ccc(N2CCC3(CCN(CC4CC4)C3)CC2)c(Cl)c1)c1nccc(n1)C(F)(F)F InChI=1S/C27H33ClF3N5O/c1-25(2,23-32-11-7-22(34-23)27(29,30)31)24(37)33-19-5-6-21(20(28)15-19)36-13-9-26(10-14-36)8-12-35(17-26)16-18-3-4-18/h5-7,11,15,18H,3-4,8-10,12-14,16-17H2,1-2H3,(H,33,37) PZAIVSQWZAHADG-UHFFFAOYSA-N 50417471 CHEMBL1287953 Neuropeptide Y receptor type 1 Homo sapiens >6309.57 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417471 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000835&target=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417471&enzyme=Neuropeptide+Y+receptor+type+1&column=ki&startPg=0&Increment=50&submit=Search 50925473 163366495 CHEMBL1287953 1 MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 7VGX,8K6M,8K6O,5ZBH Neuropeptide Y receptor type 1 NPY1R_HUMAN P25929 B2R6H5 51019367 CC(C)(C(=O)Nc1ccc(N2CCC3(CCN(CC4CC4)C3)CC2)c(Cl)c1)c1nccc(n1)C(F)(F)F InChI=1S/C27H33ClF3N5O/c1-25(2,23-32-11-7-22(34-23)27(29,30)31)24(37)33-19-5-6-21(20(28)15-19)36-13-9-26(10-14-36)8-12-35(17-26)16-18-3-4-18/h5-7,11,15,18H,3-4,8-10,12-14,16-17H2,1-2H3,(H,33,37) PZAIVSQWZAHADG-UHFFFAOYSA-N 50417471 CHEMBL1287953 Neuropeptide Y receptor type 5 Homo sapiens >3981.07 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417471 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6701&target=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417471&enzyme=Neuropeptide+Y+receptor+type+5&column=ki&startPg=0&Increment=50&submit=Search 50925473 163366495 CHEMBL1287953 1 MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Neuropeptide Y receptor type 5 NPY5R_HUMAN Q15761 Q6GTR7 Q92916 51019368 Clc1cc(NC(=O)C(c2ccccc2)c2ccccc2)ccc1N1CCC(CC1)N1CCCCC1 InChI=1S/C30H34ClN3O/c31-27-22-25(14-15-28(27)34-20-16-26(17-21-34)33-18-8-3-9-19-33)32-30(35)29(23-10-4-1-5-11-23)24-12-6-2-7-13-24/h1-2,4-7,10-15,22,26,29H,3,8-9,16-21H2,(H,32,35) QOGBCJRXYIXXHR-UHFFFAOYSA-N 50417475 CHEMBL1288016 Neuropeptide Y-Y2 receptor Rattus norvegicus 79.43 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417475 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006277&target=Neuropeptide+Y-Y2+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417475&enzyme=Neuropeptide+Y-Y2+receptor&column=ki&startPg=0&Increment=50&submit=Search 52942479 163366499 CHEMBL1288016 1 EYSLIEIIPDFEIVACTEKWPGEEKSVYGTVYSLSTLLILYVLPLGIISFSYTRIWSKLKNHVSPGAASDHYHQRR Neuropeptide Y-Y2 receptor O70424_RAT O70424 51019369 CC(C)(C)C(=O)Nc1ccc(N2CCN(CC2)C(=O)c2ccccc2)c(Cl)c1 InChI=1S/C22H26ClN3O2/c1-22(2,3)21(28)24-17-9-10-19(18(23)15-17)25-11-13-26(14-12-25)20(27)16-7-5-4-6-8-16/h4-10,15H,11-14H2,1-3H3,(H,24,28) IKZIGILJXHWDKK-UHFFFAOYSA-N 50414446 CHEMBL539730 Neuropeptide Y receptor type 2 Homo sapiens 501.19 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50414446 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50414446&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 1294837 163363470 CHEMBL539730 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 51019370 CC(C)(C)C(=O)Nc1ccc(N2CCN(CC2)C(=O)c2ccccc2F)c(Cl)c1 InChI=1S/C22H25ClFN3O2/c1-22(2,3)21(29)25-15-8-9-19(17(23)14-15)26-10-12-27(13-11-26)20(28)16-6-4-5-7-18(16)24/h4-9,14H,10-13H2,1-3H3,(H,25,29) DUZGZLCGDSTNRQ-UHFFFAOYSA-N 50417495 CHEMBL1287870 Neuropeptide Y receptor type 2 Homo sapiens 125.89 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417495 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417495&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 52948513 163366519 CHEMBL1287870 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 51019371 CC(C)(C)C(=O)Nc1ccc(N2CCN(CC2)C(=O)c2cccc(F)c2)c(Cl)c1 InChI=1S/C22H25ClFN3O2/c1-22(2,3)21(29)25-17-7-8-19(18(23)14-17)26-9-11-27(12-10-26)20(28)15-5-4-6-16(24)13-15/h4-8,13-14H,9-12H2,1-3H3,(H,25,29) FWKSHHMZTDAQKB-UHFFFAOYSA-N 50417496 CHEMBL1287898 Neuropeptide Y receptor type 2 Homo sapiens 251.19 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417496 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417496&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 52943629 163366520 CHEMBL1287898 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 51019372 CC(C)(C)C(=O)Nc1ccc(N2CCN(CC2)C(=O)c2ccc(F)cc2)c(Cl)c1 InChI=1S/C22H25ClFN3O2/c1-22(2,3)21(29)25-17-8-9-19(18(23)14-17)26-10-12-27(13-11-26)20(28)15-4-6-16(24)7-5-15/h4-9,14H,10-13H2,1-3H3,(H,25,29) BAKBLSHZEWKOBG-UHFFFAOYSA-N 50417497 CHEMBL1287899 Neuropeptide Y receptor type 2 Homo sapiens 501.19 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417497 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417497&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 52950120 163366521 CHEMBL1287899 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67 51019373 CC(C)(C)C(=O)Nc1ccc(N2CCN(Cc3ccccc3F)CC2)c(Cl)c1 InChI=1S/C22H27ClFN3O/c1-22(2,3)21(28)25-17-8-9-20(18(23)14-17)27-12-10-26(11-13-27)15-16-6-4-5-7-19(16)24/h4-9,14H,10-13,15H2,1-3H3,(H,25,28) XYOMQFXTPCLTQJ-UHFFFAOYSA-N 50417498 CHEMBL1287984 Neuropeptide Y receptor type 2 Homo sapiens 398.11 ChEMBL 10.1016/j.bmcl.2010.10.065 10.7270/Q2BV7HWV 21074426 Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J 11/24/2010 5/22/2013 Glaxosmithkline http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50417498 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000840&target=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50417498&enzyme=Neuropeptide+Y+receptor+type+2&column=ki&startPg=0&Increment=50&submit=Search 52941248 163366522 CHEMBL1287984 1 MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV 7X9B,8K6N Neuropeptide Y receptor type 2 NPY2R_HUMAN P49146 Q13281 Q13457 Q4W5G7 Q6AZZ6 Q9UE67