BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50545976 CC(C)(C)OC(=O)N1[C@H](COc2ccc3n(Cc4ccc(Cl)cc4)c(CC(C)(C)C(O)=O)c(SC(C)(C)C)c3c2)Cc2ccccc12 |r| InChI=1S/C38H45ClN2O5S/c1-36(2,3)46-35(44)41-27(19-25-11-9-10-12-30(25)41)23-45-28-17-18-31-29(20-28)33(47-37(4,5)6)32(21-38(7,8)34(42)43)40(31)22-24-13-15-26(39)16-14-24/h9-18,20,27H,19,21-23H2,1-8H3,(H,42,43) JHFMJPGATWYJDY-UHFFFAOYSA-N 50304876 (S)-3-(5-((1-(tert-butoxycarbonyl)indolin-2-yl)methoxy)-3-(tert-butylthio)-1-(4-chlorobenzyl)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL595089 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 1100 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304876 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304876&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227664 104159237 CHEMBL595089 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50545977 CC(C)(C)Sc1c(CC(C)(C)C(O)=O)n(Cc2ccc(Cl)cc2)c2ccc(OC[C@@H]3CCC(=O)N3)cc12 |r| InChI=1S/C29H35ClN2O4S/c1-28(2,3)37-26-22-14-21(36-17-20-10-13-25(33)31-20)11-12-23(22)32(16-18-6-8-19(30)9-7-18)24(26)15-29(4,5)27(34)35/h6-9,11-12,14,20H,10,13,15-17H2,1-5H3,(H,31,33)(H,34,35) DYVQEUAKSHNAPV-UHFFFAOYSA-N 50304877 (S)-3-(3-(tert-butylthio)-1-(4-chlorobenzyl)-5-((5-oxopyrrolidin-2-yl)methoxy)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL594104 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 616 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304877 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304877&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227676 104159238 CHEMBL594104 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50545978 CC(C)(C)Sc1c(CC(C)(C)C(O)=O)n(Cc2ccc(Cl)cc2)c2ccc(OCC(N)=O)cc12 InChI=1S/C26H31ClN2O4S/c1-25(2,3)34-23-19-12-18(33-15-22(28)30)10-11-20(19)29(14-16-6-8-17(27)9-7-16)21(23)13-26(4,5)24(31)32/h6-12H,13-15H2,1-5H3,(H2,28,30)(H,31,32) LSAUJWASMPVJKC-UHFFFAOYSA-N 50304878 3-(5-(2-amino-2-oxoethoxy)-3-(tert-butylthio)-1-(4-chlorobenzyl)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL607035 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 38 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304878 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304878&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227674 104159239 CHEMBL607035 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50545979 CC(C)(C)Sc1c(CC(C)(C)C(O)=O)n(Cc2ccc(Cl)cc2)c2ccc(OCC(=O)c3ccc(F)cc3)cc12 InChI=1S/C32H33ClFNO4S/c1-31(2,3)40-29-25-16-24(39-19-28(36)21-8-12-23(34)13-9-21)14-15-26(25)35(18-20-6-10-22(33)11-7-20)27(29)17-32(4,5)30(37)38/h6-16H,17-19H2,1-5H3,(H,37,38) MQYFYSIYLNGLBK-UHFFFAOYSA-N 50304879 3-(3-(tert-butylthio)-1-(4-chlorobenzyl)-5-(2-(4-fluorophenyl)-2-oxoethoxy)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL595033 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 13 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304879 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304879&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227673 104159240 CHEMBL595033 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50545980 CC(C)(C)Sc1c(CC(C)(C)C(O)=O)n(Cc2ccc(Cl)cc2)c2ccc(OCC(O)c3ccc(F)cc3)cc12 InChI=1S/C32H35ClFNO4S/c1-31(2,3)40-29-25-16-24(39-19-28(36)21-8-12-23(34)13-9-21)14-15-26(25)35(18-20-6-10-22(33)11-7-20)27(29)17-32(4,5)30(37)38/h6-16,28,36H,17-19H2,1-5H3,(H,37,38) NDTBWCVEHWJXFC-UHFFFAOYSA-N 50304880 3-(3-(tert-butylthio)-1-(4-chlorobenzyl)-5-(2-(4-fluorophenyl)-2-hydroxyethoxy)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL593389 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 19 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304880 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304880&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227660 104159241 CHEMBL593389 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50545981 CC(=O)N[C@H](COc1ccc2n(Cc3ccc(Cl)cc3)c(CC(C)(C)C(O)=O)c(SC(C)(C)C)c2c1)c1ccccc1 |r| InChI=1S/C34H39ClN2O4S/c1-22(38)36-28(24-10-8-7-9-11-24)21-41-26-16-17-29-27(18-26)31(42-33(2,3)4)30(19-34(5,6)32(39)40)37(29)20-23-12-14-25(35)15-13-23/h7-18,28H,19-21H2,1-6H3,(H,36,38)(H,39,40) ZCMYCXPFIITCJF-UHFFFAOYSA-N 50304881 (S)-3-(5-(2-acetamido-2-phenylethoxy)-3-(tert-butylthio)-1-(4-chlorobenzyl)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL594303 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 581 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304881 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304881&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227661 104159242 CHEMBL594303 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50545982 CCC(=O)N1CCC[C@H]1COc1ccc2n(Cc3ccc(Cl)cc3)c(CC(C)(C)C(O)=O)c(SC(C)(C)C)c2c1 |r| InChI=1S/C32H41ClN2O4S/c1-7-28(36)34-16-8-9-23(34)20-39-24-14-15-26-25(17-24)29(40-31(2,3)4)27(18-32(5,6)30(37)38)35(26)19-21-10-12-22(33)13-11-21/h10-15,17,23H,7-9,16,18-20H2,1-6H3,(H,37,38) UCDURHZLCHHUOW-UHFFFAOYSA-N 50304882 (S)-3-(3-(tert-butylthio)-1-(4-chlorobenzyl)-5-((1-propionylpyrrolidin-2-yl)methoxy)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL605917 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 4 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304882 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304882&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227665 104159243 CHEMBL605917 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50545983 CC(C)(C)Sc1c(CC(C)(C)C(O)=O)n(Cc2ccc(Cl)cc2)c2ccc(OC[C@@H]3CCCN3C(=O)C3CC3)cc12 |r| InChI=1S/C33H41ClN2O4S/c1-32(2,3)41-29-26-17-25(40-20-24-7-6-16-35(24)30(37)22-10-11-22)14-15-27(26)36(19-21-8-12-23(34)13-9-21)28(29)18-33(4,5)31(38)39/h8-9,12-15,17,22,24H,6-7,10-11,16,18-20H2,1-5H3,(H,38,39) SHTHCLCPHKDIRH-UHFFFAOYSA-N 50304883 (S)-3-(3-(tert-butylthio)-1-(4-chlorobenzyl)-5-((1-(cyclopropanecarbonyl)pyrrolidin-2-yl)methoxy)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL610186 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 50 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304883 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304883&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227670 104159244 CHEMBL610186 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50545984 CC(C)C(=O)N1CCC[C@H]1COc1ccc2n(Cc3ccc(Cl)cc3)c(CC(C)(C)C(O)=O)c(SC(C)(C)C)c2c1 |r| InChI=1S/C33H43ClN2O4S/c1-21(2)30(37)35-16-8-9-24(35)20-40-25-14-15-27-26(17-25)29(41-32(3,4)5)28(18-33(6,7)31(38)39)36(27)19-22-10-12-23(34)13-11-22/h10-15,17,21,24H,8-9,16,18-20H2,1-7H3,(H,38,39) TYHITTOVFUIEAW-UHFFFAOYSA-N 50304884 (S)-3-(3-(tert-butylthio)-1-(4-chlorobenzyl)-5-((1-isobutyrylpyrrolidin-2-yl)methoxy)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL604477 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 186 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304884 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304884&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227671 104159245 CHEMBL604477 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50545985 CC(C)(C)Sc1c(CC(C)(C)C(O)=O)n(Cc2ccc(Cl)cc2)c2ccc(OC[C@@H]3CCCN3C(=O)c3ccccc3)cc12 |r| InChI=1S/C36H41ClN2O4S/c1-35(2,3)44-32-29-20-28(43-23-27-12-9-19-38(27)33(40)25-10-7-6-8-11-25)17-18-30(29)39(22-24-13-15-26(37)16-14-24)31(32)21-36(4,5)34(41)42/h6-8,10-11,13-18,20,27H,9,12,19,21-23H2,1-5H3,(H,41,42) CZMJSUUPFMVBBO-UHFFFAOYSA-N 50304885 (S)-3-(5-((1-benzoylpyrrolidin-2-yl)methoxy)-3-(tert-butylthio)-1-(4-chlorobenzyl)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL610187 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 1345 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304885 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304885&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227672 104159246 CHEMBL610187 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50545986 CC(C)(C)Sc1c(CC(C)(C)C(O)=O)n(Cc2ccc(Cl)cc2)c2ccc(OC[C@@H]3Cc4ccccc4N3)cc12 |r| InChI=1S/C33H37ClN2O3S/c1-32(2,3)40-30-26-17-25(39-20-24-16-22-8-6-7-9-27(22)35-24)14-15-28(26)36(19-21-10-12-23(34)13-11-21)29(30)18-33(4,5)31(37)38/h6-15,17,24,35H,16,18-20H2,1-5H3,(H,37,38) UYURHYBBVZLRBP-UHFFFAOYSA-N 50304886 (S)-3-(3-(tert-butylthio)-1-(4-chlorobenzyl)-5-(indolin-2-ylmethoxy)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL594794 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 85 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304886 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304886&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227668 104159247 CHEMBL594794 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50545987 CC(=O)N1[C@H](COc2ccc3n(Cc4ccc(Cl)cc4)c(CC(C)(C)C(O)=O)c(SC(C)(C)C)c3c2)Cc2ccccc12 |r| InChI=1S/C35H39ClN2O4S/c1-22(39)38-26(17-24-9-7-8-10-29(24)38)21-42-27-15-16-30-28(18-27)32(43-34(2,3)4)31(19-35(5,6)33(40)41)37(30)20-23-11-13-25(36)14-12-23/h7-16,18,26H,17,19-21H2,1-6H3,(H,40,41) HDOVLJSWFVNUOQ-UHFFFAOYSA-N 50304887 (S)-3-(5-((1-acetylindolin-2-yl)methoxy)-3-(tert-butylthio)-1-(4-chlorobenzyl)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL610185 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 1.4 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304887 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304887&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227669 104159248 CHEMBL610185 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50545988 CC(C)(C)OC(=O)N1[C@@H](COc2ccc3n(Cc4ccc(Cl)cc4)c(CC(C)(C)C(O)=O)c(SC(C)(C)C)c3c2)Cc2ccccc12 |r| InChI=1S/C38H45ClN2O5S/c1-36(2,3)46-35(44)41-27(19-25-11-9-10-12-30(25)41)23-45-28-17-18-31-29(20-28)33(47-37(4,5)6)32(21-38(7,8)34(42)43)40(31)22-24-13-15-26(39)16-14-24/h9-18,20,27H,19,21-23H2,1-8H3,(H,42,43) JHFMJPGATWYJDY-UHFFFAOYSA-N 50304888 (R)-3-(5-((1-(tert-butoxycarbonyl)indolin-2-yl)methoxy)-3-(tert-butylthio)-1-(4-chlorobenzyl)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL609878 Arachidonate 5-lipoxygenase-activating protein Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304888 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304888&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227659 104159249 CHEMBL609878 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50545989 CC(=O)N1[C@H](COc2ccc3n(Cc4ccc(Cl)cc4)c(CC(C)(C)C(O)=O)cc3c2)Cc2ccccc12 |r| InChI=1S/C31H31ClN2O4/c1-20(35)34-26(14-22-6-4-5-7-29(22)34)19-38-27-12-13-28-23(16-27)15-25(17-31(2,3)30(36)37)33(28)18-21-8-10-24(32)11-9-21/h4-13,15-16,26H,14,17-19H2,1-3H3,(H,36,37) MWWOHSWKLHEGSU-UHFFFAOYSA-N 50304889 (S)-3-(5-((1-acetylindolin-2-yl)methoxy)-1-(4-chlorobenzyl)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL593390 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 218 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304889 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304889&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227662 104159250 CHEMBL593390 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50545990 CC(C)C(=O)c1c(CC(C)(C)C(O)=O)n(Cc2ccc(Cl)cc2)c2ccc(OC[C@@H]3Cc4ccccc4N3C(C)=O)cc12 |r| InChI=1S/C35H37ClN2O5/c1-21(2)33(40)32-28-17-27(43-20-26-16-24-8-6-7-9-29(24)38(26)22(3)39)14-15-30(28)37(19-23-10-12-25(36)13-11-23)31(32)18-35(4,5)34(41)42/h6-15,17,21,26H,16,18-20H2,1-5H3,(H,41,42) DJIUUFLBCJTONF-UHFFFAOYSA-N 50304890 (S)-3-(5-((1-acetylindolin-2-yl)methoxy)-1-(4-chlorobenzyl)-3-isobutyryl-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL610184 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 20.6 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304890 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304890&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227663 104159251 CHEMBL610184 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50545991 CC(=O)N1[C@H](COc2ccc3n(Cc4ccc(Cl)cc4)c(CC(C)(C)C(O)=O)c(C(=O)c4ccccc4)c3c2)Cc2ccccc12 |r| InChI=1S/C38H35ClN2O5/c1-24(42)41-29(19-27-11-7-8-12-32(27)41)23-46-30-17-18-33-31(20-30)35(36(43)26-9-5-4-6-10-26)34(21-38(2,3)37(44)45)40(33)22-25-13-15-28(39)16-14-25/h4-18,20,29H,19,21-23H2,1-3H3,(H,44,45) RXXTZBSQDZRMAN-UHFFFAOYSA-N 50304891 (S)-3-(5-((1-acetylindolin-2-yl)methoxy)-3-benzoyl-1-(4-chlorobenzyl)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL594551 Arachidonate 5-lipoxygenase-activating protein Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304891 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304891&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227656 104159252 CHEMBL594551 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50545992 CC(=O)N1[C@H](COc2ccc3n(Cc4ccc(Cl)cc4)c(CC(C)(C)C(O)=O)c(C(=O)C(C)(C)C)c3c2)Cc2ccccc12 |r| InChI=1S/C36H39ClN2O5/c1-22(40)39-26(17-24-9-7-8-10-29(24)39)21-44-27-15-16-30-28(18-27)32(33(41)35(2,3)4)31(19-36(5,6)34(42)43)38(30)20-23-11-13-25(37)14-12-23/h7-16,18,26H,17,19-21H2,1-6H3,(H,42,43) DGQYEDIUARKQLY-UHFFFAOYSA-N 50304892 (S)-3-(5-((1-acetylindolin-2-yl)methoxy)-1-(4-chlorobenzyl)-3-pivaloyl-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL595009 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 19 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304892 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304892&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227657 104159253 CHEMBL595009 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50545993 CC(C)Cc1c(CC(C)(C)C(O)=O)n(Cc2ccc(Cl)cc2)c2ccc(OC[C@@H]3Cc4ccccc4N3C(C)=O)cc12 |r| InChI=1S/C35H39ClN2O4/c1-22(2)16-29-30-18-28(42-21-27-17-25-8-6-7-9-31(25)38(27)23(3)39)14-15-32(30)37(20-24-10-12-26(36)13-11-24)33(29)19-35(4,5)34(40)41/h6-15,18,22,27H,16-17,19-21H2,1-5H3,(H,40,41) RQYQTTBFZQRGEJ-UHFFFAOYSA-N 50304893 (S)-3-(5-((1-acetylindolin-2-yl)methoxy)-1-(4-chlorobenzyl)-3-isobutyl-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL609877 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 35 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304893 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304893&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227658 104159254 CHEMBL609877 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50545994 CC(=O)N1[C@H](COc2ccc3n(Cc4ccc(Cl)cc4)c(CC(C)(C)C(O)=O)c(Cc4ccccc4)c3c2)Cc2ccccc12 |r| InChI=1S/C38H37ClN2O4/c1-25(42)41-30(20-28-11-7-8-12-34(28)41)24-45-31-17-18-35-33(21-31)32(19-26-9-5-4-6-10-26)36(22-38(2,3)37(43)44)40(35)23-27-13-15-29(39)16-14-27/h4-18,21,30H,19-20,22-24H2,1-3H3,(H,43,44) XDJAJMMEYDGRSD-UHFFFAOYSA-N 50304894 (S)-3-(5-((1-acetylindolin-2-yl)methoxy)-3-benzyl-1-(4-chlorobenzyl)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL610190 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 15.2 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304894 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304894&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227685 104159255 CHEMBL610190 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50545995 CC(=O)N1[C@H](COc2ccc3n(Cc4ccc(Cl)cc4)c(CC(C)(C)C(O)=O)c(CCC(C)(C)C)c3c2)Cc2ccccc12 |r| InChI=1S/C37H43ClN2O4/c1-24(41)40-28(19-26-9-7-8-10-32(26)40)23-44-29-15-16-33-31(20-29)30(17-18-36(2,3)4)34(21-37(5,6)35(42)43)39(33)22-25-11-13-27(38)14-12-25/h7-16,20,28H,17-19,21-23H2,1-6H3,(H,42,43) NGKMJQHMKWIGRW-UHFFFAOYSA-N 50304895 (S)-3-(5-((1-acetylindolin-2-yl)methoxy)-1-(4-chlorobenzyl)-3-(3,3-dimethylbutyl)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL610469 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 4.7 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304895 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304895&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227686 104159256 CHEMBL610469 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50545996 CC(=O)N1[C@H](COc2ccc3n(Cc4ccc(Cl)cc4)c(CC(C)(C)C(O)=O)c(S(=O)C(C)(C)C)c3c2)Cc2ccccc12 |r| InChI=1S/C35H39ClN2O5S/c1-22(39)38-26(17-24-9-7-8-10-29(24)38)21-43-27-15-16-30-28(18-27)32(44(42)34(2,3)4)31(19-35(5,6)33(40)41)37(30)20-23-11-13-25(36)14-12-23/h7-16,18,26H,17,19-21H2,1-6H3,(H,40,41) RSVONCQLRLKDFH-UHFFFAOYSA-N 50304896 3-(5-(((S)-1-acetylindolin-2-yl)methoxy)-3-(tert-butylsulfinyl)-1-(4-chlorobenzyl)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL610470 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 74 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304896 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304896&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227687 104159257 CHEMBL610470 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50545997 CC(=O)N1[C@H](COc2ccc3n(Cc4ccc(Cl)cc4)c(CC(C)(C)C(O)=O)c(c3c2)S(=O)(=O)C(C)(C)C)Cc2ccccc12 |r| InChI=1S/C35H39ClN2O6S/c1-22(39)38-26(17-24-9-7-8-10-29(24)38)21-44-27-15-16-30-28(18-27)32(45(42,43)34(2,3)4)31(19-35(5,6)33(40)41)37(30)20-23-11-13-25(36)14-12-23/h7-16,18,26H,17,19-21H2,1-6H3,(H,40,41) WHLUEMFKZGNWOK-UHFFFAOYSA-N 50304897 (S)-3-(5-((1-acetylindolin-2-yl)methoxy)-3-(tert-butylsulfonyl)-1-(4-chlorobenzyl)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL610471 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 4.5 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304897 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304897&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227689 104159258 CHEMBL610471 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50545998 CC(=O)N1[C@H](COc2ccc3n(Cc4ccc(cc4)-c4ccc(F)cn4)c(CC(C)(C)C(O)=O)c(SC(C)(C)C)c3c2)Cc2ccccc12 |r| InChI=1S/C40H42FN3O4S/c1-25(45)44-30(19-28-9-7-8-10-34(28)44)24-48-31-16-18-35-32(20-31)37(49-39(2,3)4)36(21-40(5,6)38(46)47)43(35)23-26-11-13-27(14-12-26)33-17-15-29(41)22-42-33/h7-18,20,22,30H,19,21,23-24H2,1-6H3,(H,46,47) FOEZFFOVGFHBGT-UHFFFAOYSA-N 50304898 (S)-3-(5-((1-acetylindolin-2-yl)methoxy)-3-(tert-butylthio)-1-(4-(5-fluoropyridin-2-yl)benzyl)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL595872 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 1.7 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304898 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304898&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227690 104159259 CHEMBL595872 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50545999 COc1nc(cs1)-c1ccc(Cn2c(CC(C)(C)C(O)=O)c(SC(C)(C)C)c3cc(OC[C@@H]4Cc5ccccc5N4C(C)=O)ccc23)cc1 |r| InChI=1S/C39H43N3O5S2/c1-24(43)42-28(18-27-10-8-9-11-32(27)42)22-47-29-16-17-33-30(19-29)35(49-38(2,3)4)34(20-39(5,6)36(44)45)41(33)21-25-12-14-26(15-13-25)31-23-48-37(40-31)46-7/h8-17,19,23,28H,18,20-22H2,1-7H3,(H,44,45) DKNZCCXWLGRSDV-UHFFFAOYSA-N 50304899 (S)-3-(5-((1-acetylindolin-2-yl)methoxy)-3-(tert-butylthio)-1-(4-(2-methoxythiazol-4-yl)benzyl)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL610472 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 2.5 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304899 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304899&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227691 104159260 CHEMBL610472 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50546000 COc1ccc(cn1)-c1ccc(Cn2c(CC(C)(C)C(O)=O)c(SC(C)(C)C)c3cc(OC[C@@H]4Cc5ccccc5N4C(C)=O)ccc23)cc1 |r| InChI=1S/C41H45N3O5S/c1-26(45)44-31(20-29-10-8-9-11-34(29)44)25-49-32-17-18-35-33(21-32)38(50-40(2,3)4)36(22-41(5,6)39(46)47)43(35)24-27-12-14-28(15-13-27)30-16-19-37(48-7)42-23-30/h8-19,21,23,31H,20,22,24-25H2,1-7H3,(H,46,47) PBAGJSTZLCRKDP-UHFFFAOYSA-N 50304900 (S)-3-(5-((1-acetylindolin-2-yl)methoxy)-3-(tert-butylthio)-1-(4-(6-methoxypyridin-3-yl)benzyl)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL610473 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 9.3 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304900 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304900&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227692 104159261 CHEMBL610473 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50546001 COc1ccc(nc1)-c1ccc(Cn2c(CC(C)(C)C(O)=O)c(SC(C)(C)C)c3cc(OC[C@@H]4Cc5ccccc5N4C(C)=O)ccc23)cc1 |r| InChI=1S/C41H45N3O5S/c1-26(45)44-30(20-29-10-8-9-11-35(29)44)25-49-31-17-19-36-33(21-31)38(50-40(2,3)4)37(22-41(5,6)39(46)47)43(36)24-27-12-14-28(15-13-27)34-18-16-32(48-7)23-42-34/h8-19,21,23,30H,20,22,24-25H2,1-7H3,(H,46,47) PNRYTEARGINAOS-UHFFFAOYSA-N 50304901 (S)-3-(5-((1-acetylindolin-2-yl)methoxy)-3-(tert-butylthio)-1-(4-(5-methoxypyridin-2-yl)benzyl)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL610474 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 3.8 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304901 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304901&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227693 104159262 CHEMBL610474 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50546002 COC1=NN=C(CC1)c1ccc(Cn2c(CC(C)(C)C(O)=O)c(SC(C)(C)C)c3cc(OC[C@@H]4Cc5ccccc5N4C(C)=O)ccc23)cc1 |r,c:4,t:2| InChI=1S/C40H46N4O5S/c1-25(45)44-29(20-28-10-8-9-11-33(28)44)24-49-30-16-18-34-31(21-30)37(50-39(2,3)4)35(22-40(5,6)38(46)47)43(34)23-26-12-14-27(15-13-26)32-17-19-36(48-7)42-41-32/h8-16,18,21,29H,17,19-20,22-24H2,1-7H3,(H,46,47) YILGZAJZYAVDFY-UHFFFAOYSA-N 50304902 (S)-3-(5-((1-acetylindolin-2-yl)methoxy)-3-(tert-butylthio)-1-(4-(6-methoxy-1,2-dihydropyridazin-3-yl)benzyl)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL594773 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 3.2 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304902 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304902&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 91933993 104159263 CHEMBL594773 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50546003 COc1cnc(nc1)-c1ccc(Cn2c(CC(C)(C)C(O)=O)c(SC(C)(C)C)c3cc(OC[C@@H]4Cc5ccccc5N4C(C)=O)ccc23)cc1 |r| InChI=1S/C40H44N4O5S/c1-25(45)44-29(18-28-10-8-9-11-33(28)44)24-49-30-16-17-34-32(19-30)36(50-39(2,3)4)35(20-40(5,6)38(46)47)43(34)23-26-12-14-27(15-13-26)37-41-21-31(48-7)22-42-37/h8-17,19,21-22,29H,18,20,23-24H2,1-7H3,(H,46,47) VYXWHVDEWWHDLH-UHFFFAOYSA-N 50304903 (S)-3-(5-((1-acetylindolin-2-yl)methoxy)-3-(tert-butylthio)-1-(4-(5-methoxypyrimidin-2-yl)benzyl)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL595092 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 2.2 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304903 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304903&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 44627267 104159264 CHEMBL595092 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50546004 CC(C)(C)Sc1c2cc(ccc2n(c1CC(C)(C)C(=O)O)Cc3ccc(cc3)Cl)OCc4ccc5ccccc5n4 InChI=1S/C34H35ClN2O3S/c1-33(2,3)41-31-27-18-26(40-21-25-15-12-23-8-6-7-9-28(23)36-25)16-17-29(27)37(20-22-10-13-24(35)14-11-22)30(31)19-34(4,5)32(38)39/h6-18H,19-21H2,1-5H3,(H,38,39) NZOONKHCNQFYCI-UHFFFAOYSA-N 50029559 L-686708::MK-591::3-[3-tert-Butylsulfanyl-1-(4-chloro-benzyl)-5-(quinolin-2-ylmethoxy)-1H-indol-2-yl]-2,2-dimethyl-propionic acid::3-[3-(TERT-BUTYLTHIO)-1-(4-CHLOROBENZYL)-5-(QUINOLIN-2-YLMETHOXY)-1H-INDOL-2-YL]-2,2-DIMETHYLPROPANOIC ACID::3-(1-(4-chlorobenzyl)-3-(tert-butylthio)-5-(quinolin-2-ylmethoxy)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::2-[3-tert-Butylsulfanyl-1-(4-chloro-benzyl)-5-(quinolin-2-ylmethoxy)-1H-indol-2-yl]-2-methyl-propionic acid::3-(3-(tert-butylthio)-1-(4-chlorobenzyl)-5-(quinolin-2-ylmethoxy)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL16596 Cytochrome P450 3A4 Homo sapiens 5200 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50029559 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2127&target=Cytochrome+P450+3A4&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50029559&enzyme=Cytochrome+P450+3A4&column=ki&startPg=0&Increment=50&submit=Search 2CS 2Q7M 60923 103938620 CHEMBL16596 1 MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGTVSGA 7LXL,3NXU,2V0M,2J0D,1W0G,1W0F,1W0E,9GK1,4NY4 Cytochrome P450 3A4 CP3A4_HUMAN P08684 P05184 Q16757 Q9UK50 Cytochrome P450 3A Q6GRK0_HUMAN Q6GRK0 50546005 CC(C)(C)Sc1c2cc(ccc2n(c1CC(C)(C)C(=O)O)Cc3ccc(cc3)Cl)OCc4ccc5ccccc5n4 InChI=1S/C34H35ClN2O3S/c1-33(2,3)41-31-27-18-26(40-21-25-15-12-23-8-6-7-9-28(23)36-25)16-17-29(27)37(20-22-10-13-24(35)14-11-22)30(31)19-34(4,5)32(38)39/h6-18H,19-21H2,1-5H3,(H,38,39) NZOONKHCNQFYCI-UHFFFAOYSA-N 50029559 L-686708::MK-591::3-[3-tert-Butylsulfanyl-1-(4-chloro-benzyl)-5-(quinolin-2-ylmethoxy)-1H-indol-2-yl]-2,2-dimethyl-propionic acid::3-[3-(TERT-BUTYLTHIO)-1-(4-CHLOROBENZYL)-5-(QUINOLIN-2-YLMETHOXY)-1H-INDOL-2-YL]-2,2-DIMETHYLPROPANOIC ACID::3-(1-(4-chlorobenzyl)-3-(tert-butylthio)-5-(quinolin-2-ylmethoxy)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::2-[3-tert-Butylsulfanyl-1-(4-chloro-benzyl)-5-(quinolin-2-ylmethoxy)-1H-indol-2-yl]-2-methyl-propionic acid::3-(3-(tert-butylthio)-1-(4-chlorobenzyl)-5-(quinolin-2-ylmethoxy)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL16596 Cytochrome P450 2C9 Homo sapiens 500 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50029559 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2128&target=Cytochrome+P450+2C9&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50029559&enzyme=Cytochrome+P450+2C9&column=ki&startPg=0&Increment=50&submit=Search 2CS 2Q7M 60923 103938620 CHEMBL16596 1 MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICSIIFHKRFDYKDQQFLNLMEKLNENIKILSSPWIQICNNFSPIIDYFPGTHNKLLKNVAFMKSYILEKVKEHQESMDMNNPQDFIDCFLMKMEKEKHNQPSEFTIESLENTAVDLFGAGTETTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSPCMQDRSHMPYTDAVVHEVQRYIDLLPTSLPHAVTCDIKFRNYLIPKGTTILISLTSVLHDNKEFPNPEMFDPHHFLDEGGNFKKSKYFMPFSAGKRICVGEALAGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVPPFYQLCFIPV Cytochrome P450 2C9 CP2C9_HUMAN P11712 P11713 Q16756 Q16872 Q5VX92 Q6IRV8 Q8WW80 50546006 COc1cnc(nc1)-c1ccc(Cn2c(CC(C)(C)C(O)=O)c(SC(C)(C)C)c3cc(OC[C@@H]4Cc5ccccc5N4C(C)=O)ccc23)cc1 |r| InChI=1S/C40H44N4O5S/c1-25(45)44-29(18-28-10-8-9-11-33(28)44)24-49-30-16-17-34-32(19-30)36(50-39(2,3)4)35(20-40(5,6)38(46)47)43(34)23-26-12-14-27(15-13-26)37-41-21-31(48-7)22-42-37/h8-17,19,21-22,29H,18,20,23-24H2,1-7H3,(H,46,47) VYXWHVDEWWHDLH-UHFFFAOYSA-N 50304903 (S)-3-(5-((1-acetylindolin-2-yl)methoxy)-3-(tert-butylthio)-1-(4-(5-methoxypyrimidin-2-yl)benzyl)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL595092 Cytochrome P450 3A4 Homo sapiens 16700 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304903 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2127&target=Cytochrome+P450+3A4&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304903&enzyme=Cytochrome+P450+3A4&column=ki&startPg=0&Increment=50&submit=Search 44627267 104159264 CHEMBL595092 1 MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGTVSGA 7LXL,3NXU,2V0M,2J0D,1W0G,1W0F,1W0E,9GK1,4NY4 Cytochrome P450 3A4 CP3A4_HUMAN P08684 P05184 Q16757 Q9UK50 Cytochrome P450 3A Q6GRK0_HUMAN Q6GRK0 50546007 COc1cnc(nc1)-c1ccc(Cn2c(CC(C)(C)C(O)=O)c(SC(C)(C)C)c3cc(OC[C@@H]4Cc5ccccc5N4C(C)=O)ccc23)cc1 |r| InChI=1S/C40H44N4O5S/c1-25(45)44-29(18-28-10-8-9-11-33(28)44)24-49-30-16-17-34-32(19-30)36(50-39(2,3)4)35(20-40(5,6)38(46)47)43(34)23-26-12-14-27(15-13-26)37-41-21-31(48-7)22-42-37/h8-17,19,21-22,29H,18,20,23-24H2,1-7H3,(H,46,47) VYXWHVDEWWHDLH-UHFFFAOYSA-N 50304903 (S)-3-(5-((1-acetylindolin-2-yl)methoxy)-3-(tert-butylthio)-1-(4-(5-methoxypyrimidin-2-yl)benzyl)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL595092 Cytochrome P450 2C9 Homo sapiens 3700 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304903 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2128&target=Cytochrome+P450+2C9&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304903&enzyme=Cytochrome+P450+2C9&column=ki&startPg=0&Increment=50&submit=Search 44627267 104159264 CHEMBL595092 1 MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICSIIFHKRFDYKDQQFLNLMEKLNENIKILSSPWIQICNNFSPIIDYFPGTHNKLLKNVAFMKSYILEKVKEHQESMDMNNPQDFIDCFLMKMEKEKHNQPSEFTIESLENTAVDLFGAGTETTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSPCMQDRSHMPYTDAVVHEVQRYIDLLPTSLPHAVTCDIKFRNYLIPKGTTILISLTSVLHDNKEFPNPEMFDPHHFLDEGGNFKKSKYFMPFSAGKRICVGEALAGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVPPFYQLCFIPV Cytochrome P450 2C9 CP2C9_HUMAN P11712 P11713 Q16756 Q16872 Q5VX92 Q6IRV8 Q8WW80 50546008 CC(C)(C)OC(=O)N1CCC[C@H]1COc1ccc2n(Cc3ccc(Cl)cc3)c(CC(C)(C)C(O)=O)c(SC(C)(C)C)c2c1 |r| InChI=1S/C34H45ClN2O5S/c1-32(2,3)42-31(40)36-17-9-10-24(36)21-41-25-15-16-27-26(18-25)29(43-33(4,5)6)28(19-34(7,8)30(38)39)37(27)20-22-11-13-23(35)14-12-22/h11-16,18,24H,9-10,17,19-21H2,1-8H3,(H,38,39) WWIOHGHMZYZZAI-UHFFFAOYSA-N 50304904 (S)-3-(5-((1-(tert-butoxycarbonyl)pyrrolidin-2-yl)methoxy)-3-(tert-butylthio)-1-(4-chlorobenzyl)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL610189 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 1114 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304904 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304904&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227684 104159265 CHEMBL610189 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50546009 CC(C)(C)OC(=O)N1CCC[C@@H]1COc1ccc2n(Cc3ccc(Cl)cc3)c(CC(C)(C)C(O)=O)c(SC(C)(C)C)c2c1 |r| InChI=1S/C34H45ClN2O5S/c1-32(2,3)42-31(40)36-17-9-10-24(36)21-41-25-15-16-27-26(18-25)29(43-33(4,5)6)28(19-34(7,8)30(38)39)37(27)20-22-11-13-23(35)14-12-22/h11-16,18,24H,9-10,17,19-21H2,1-8H3,(H,38,39) WWIOHGHMZYZZAI-UHFFFAOYSA-N 50304905 (R)-3-(5-((1-(tert-butoxycarbonyl)pyrrolidin-2-yl)methoxy)-3-(tert-butylthio)-1-(4-chlorobenzyl)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL610188 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 1805 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304905 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304905&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227675 104159266 CHEMBL610188 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50546010 CC(C)(C)Sc1c(CC(C)(C)C(O)=O)n(Cc2ccc(Cl)cc2)c2ccc(OC[C@@H]3CCCN3)cc12 |r| InChI=1S/C29H37ClN2O3S/c1-28(2,3)36-26-23-15-22(35-18-21-7-6-14-31-21)12-13-24(23)32(17-19-8-10-20(30)11-9-19)25(26)16-29(4,5)27(33)34/h8-13,15,21,31H,6-7,14,16-18H2,1-5H3,(H,33,34) KFWAJHHTMWQDSK-UHFFFAOYSA-N 50304906 (S)-3-(3-(tert-butylthio)-1-(4-chlorobenzyl)-5-(pyrrolidin-2-ylmethoxy)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL594105 Arachidonate 5-lipoxygenase-activating protein Homo sapiens >10000 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304906 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304906&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227677 104159267 CHEMBL594105 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50546011 CC(=O)N1CCC[C@H]1COc1ccc2n(Cc3ccc(Cl)cc3)c(CC(C)(C)C(O)=O)c(SC(C)(C)C)c2c1 |r| InChI=1S/C31H39ClN2O4S/c1-20(35)33-15-7-8-23(33)19-38-24-13-14-26-25(16-24)28(39-30(2,3)4)27(17-31(5,6)29(36)37)34(26)18-21-9-11-22(32)12-10-21/h9-14,16,23H,7-8,15,17-19H2,1-6H3,(H,36,37) ONMFPOSJGZYMQU-UHFFFAOYSA-N 50304907 (S)-3-(5-((1-acetylpyrrolidin-2-yl)methoxy)-3-(tert-butylthio)-1-(4-chlorobenzyl)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL604687 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 6 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304907 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304907&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227683 104159268 CHEMBL604687 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04 50546012 CC(C)(C)Sc1c(CC(C)(C)C(O)=O)n(Cc2ccc(Cl)cc2)c2ccc(OC[C@@H]3CCCN3S(C)(=O)=O)cc12 |r| InChI=1S/C30H39ClN2O5S2/c1-29(2,3)39-27-24-16-23(38-19-22-8-7-15-33(22)40(6,36)37)13-14-25(24)32(18-20-9-11-21(31)12-10-20)26(27)17-30(4,5)28(34)35/h9-14,16,22H,7-8,15,17-19H2,1-6H3,(H,34,35) JRLMGDHOCCVCQR-UHFFFAOYSA-N 50304908 (S)-3-(3-(tert-butylthio)-1-(4-chlorobenzyl)-5-((1-(methylsulfonyl)pyrrolidin-2-yl)methoxy)-1H-indol-2-yl)-2,2-dimethylpropanoic acid::CHEMBL596178 Arachidonate 5-lipoxygenase-activating protein Homo sapiens 441 ChEMBL 10.1016/j.bmcl.2009.10.131 10.7270/Q2MW2H78 19914828 Stock, N; Baccei, C; Bain, G; Broadhead, A; Chapman, C; Darlington, J; King, C; Lee, C; Li, Y; Lorrain, DS; Prodanovich, P; Rong, H; Santini, A; Zunic, J; Evans, JF; Hutchinson, JH; Prasit, P 2/3/2010 8/31/2010 Amira Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50304908 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5743&target=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50304908&enzyme=Arachidonate+5-lipoxygenase-activating+protein&column=ki&startPg=0&Increment=50&submit=Search 46227666 104159269 CHEMBL596178 1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Arachidonate 5-lipoxygenase-activating protein AL5AP_HUMAN P20292 Q5VV04