BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50534120 Fc1ccc(NC(=O)OCC2(OC(=O)Nc3ccc(Cl)cc23)C(F)(F)F)cc1 InChI=1S/C17H11ClF4N2O4/c18-9-1-6-13-12(7-9)16(17(20,21)22,28-15(26)24-13)8-27-14(25)23-11-4-2-10(19)3-5-11/h1-7H,8H2,(H,23,25)(H,24,26) STVRTRQYADRHPO-UHFFFAOYSA-N 50299940 [6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl-(4-fluorophenyl)carbamate::CHEMBL578605 Elongation of very long chain fatty acids protein 6 Homo sapiens 142 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299940 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299940&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44549928 104141469 CHEMBL578605 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534121 CC1(COC(=O)Nc2ccc(F)cc2)OC(=O)Nc2ccc(Cl)cc12 InChI=1S/C17H14ClFN2O4/c1-17(9-24-15(22)20-12-5-3-11(19)4-6-12)13-8-10(18)2-7-14(13)21-16(23)25-17/h2-8H,9H2,1H3,(H,20,22)(H,21,23) ARQXNSIYPYSEPY-UHFFFAOYSA-N 50299941 (6-chloro-4-methyl-2-oxo-1,4-dihydro-2H-3,1-benzoxazin-4-yl)methyl(4-fluorophenyl)carbamate::CHEMBL570350 Elongation of very long chain fatty acids protein 6 Homo sapiens 1364 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299941 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299941&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44549929 104141470 CHEMBL570350 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534122 CCC1(COC(=O)Nc2ccc(F)cc2)OC(=O)Nc2ccc(Cl)cc12 InChI=1S/C18H16ClFN2O4/c1-2-18(10-25-16(23)21-13-6-4-12(20)5-7-13)14-9-11(19)3-8-15(14)22-17(24)26-18/h3-9H,2,10H2,1H3,(H,21,23)(H,22,24) WNPJVICRCZZELS-UHFFFAOYSA-N 50299942 (6-chloro-4-ethyl-2-oxo-1,4-dihydro-2H-3,1-benzoxazin-4-yl)methyl(4-fluorophenyl)carbamate::CHEMBL570333 Elongation of very long chain fatty acids protein 6 Homo sapiens 2255 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299942 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299942&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44549930 104141471 CHEMBL570333 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534123 CC(C)C1(COC(=O)Nc2ccc(F)cc2)OC(=O)Nc2ccc(Cl)cc12 InChI=1S/C19H18ClFN2O4/c1-11(2)19(10-26-17(24)22-14-6-4-13(21)5-7-14)15-9-12(20)3-8-16(15)23-18(25)27-19/h3-9,11H,10H2,1-2H3,(H,22,24)(H,23,25) GUQFSODZHDWFSC-UHFFFAOYSA-N 50299943 (6-chloro-2-oxo-4-(propan-2-yl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl)methyl(4-fluorophenyl)carbamate::CHEMBL583665 Elongation of very long chain fatty acids protein 6 Homo sapiens 5031 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299943 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299943&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44549931 104141472 CHEMBL583665 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534124 Fc1ccc(NC(=O)OCC2(OC(=O)Nc3ccc(Cl)cc23)C2CC2)cc1 InChI=1S/C19H16ClFN2O4/c20-12-3-8-16-15(9-12)19(11-1-2-11,27-18(25)23-16)10-26-17(24)22-14-6-4-13(21)5-7-14/h3-9,11H,1-2,10H2,(H,22,24)(H,23,25) RRABGJAXSNNCQT-UHFFFAOYSA-N 50299944 (6-chloro-4-cyclopropyl-2-oxo-1,4-dihydro-2H-3,1-benzoxazin-4-yl)methyl(4-fluorophenyl)carbamate::CHEMBL568721 Elongation of very long chain fatty acids protein 6 Homo sapiens 1414 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299944 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299944&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44550044 104141473 CHEMBL568721 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534125 Fc1ccc(NC(=O)OCC2(OC(=O)Nc3ccc(Cl)cc23)c2ccccc2)cc1 InChI=1S/C22H16ClFN2O4/c23-15-6-11-19-18(12-15)22(30-21(28)26-19,14-4-2-1-3-5-14)13-29-20(27)25-17-9-7-16(24)8-10-17/h1-12H,13H2,(H,25,27)(H,26,28) JZSZQUFZQQVHGY-UHFFFAOYSA-N 50299945 (6-chloro-2-oxo-4-phenyl-1,4-dihydro-2H-3,1-benzoxazin-4-yl)methyl(4-fluorophenyl)carbamate::CHEMBL571725 Elongation of very long chain fatty acids protein 6 Homo sapiens >10000 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299945 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299945&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44550045 104141474 CHEMBL571725 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534126 Fc1ccc(NC(=O)NCC2(OC(=O)Nc3ccc(Cl)cc23)C(F)(F)F)cc1 InChI=1S/C17H12ClF4N3O3/c18-9-1-6-13-12(7-9)16(17(20,21)22,28-15(27)25-13)8-23-14(26)24-11-4-2-10(19)3-5-11/h1-7H,8H2,(H,25,27)(H2,23,24,26) BJJLMCGAKMRHBT-UHFFFAOYSA-N 50299946 1-{[6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-3-(4-fluorophenyl)urea::1-{[(-)-6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-3-(4-fluorophenyl)urea::CHEMBL570576 Elongation of very long chain fatty acids protein 6 Homo sapiens 33 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299946 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299946&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 25254413 104141475 CHEMBL570576 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534127 Fc1ccc(CC(=O)NCC2(OC(=O)Nc3ccc(Cl)cc23)C(F)(F)F)cc1 InChI=1S/C18H13ClF4N2O3/c19-11-3-6-14-13(8-11)17(18(21,22)23,28-16(27)25-14)9-24-15(26)7-10-1-4-12(20)5-2-10/h1-6,8H,7,9H2,(H,24,26)(H,25,27) VAZXBYKWDYNSMG-UHFFFAOYSA-N 50299947 N-{[6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-2-(4-fluorophenyl)acetamide::CHEMBL583461 Elongation of very long chain fatty acids protein 6 Homo sapiens 648 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299947 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299947&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44550046 104141476 CHEMBL583461 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534128 Fc1ccc(cc1)C(=O)NCC1(OC(=O)Nc2ccc(Cl)cc12)C(F)(F)F InChI=1S/C17H11ClF4N2O3/c18-10-3-6-13-12(7-10)16(17(20,21)22,27-15(26)24-13)8-23-14(25)9-1-4-11(19)5-2-9/h1-7H,8H2,(H,23,25)(H,24,26) UYWRUEVDNQJADG-UHFFFAOYSA-N 50299948 N-{[6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-4-fluorobenzamide::N-{[(-)-6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-4-fluorobenzamide::N-{[(+)-6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-4-fluorobenzamide::CHEMBL572158 Elongation of very long chain fatty acids protein 6 Homo sapiens 26 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299948 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299948&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 25254567 104141477 CHEMBL572158 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534129 Fc1cccc(c1)C(=O)NCC1(OC(=O)Nc2ccc(Cl)cc12)C(F)(F)F InChI=1S/C17H11ClF4N2O3/c18-10-4-5-13-12(7-10)16(17(20,21)22,27-15(26)24-13)8-23-14(25)9-2-1-3-11(19)6-9/h1-7H,8H2,(H,23,25)(H,24,26) KIEMSKALVBHZRU-UHFFFAOYSA-N 50299949 N-{[6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-3-fluorobenzamide::CHEMBL574146 Elongation of very long chain fatty acids protein 6 Homo sapiens 261 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299949 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299949&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44550047 104141478 CHEMBL574146 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534130 Fc1ccccc1C(=O)NCC1(OC(=O)Nc2ccc(Cl)cc12)C(F)(F)F InChI=1S/C17H11ClF4N2O3/c18-9-5-6-13-11(7-9)16(17(20,21)22,27-15(26)24-13)8-23-14(25)10-3-1-2-4-12(10)19/h1-7H,8H2,(H,23,25)(H,24,26) VVCOFLHFXDJSKZ-UHFFFAOYSA-N 50299950 N-{[6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-2-fluorobenzamide::CHEMBL572159 Elongation of very long chain fatty acids protein 6 Homo sapiens 539 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299950 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299950&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44550048 104141479 CHEMBL572159 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534131 Cc1ccc(cc1)C(=O)NCC1(OC(=O)Nc2ccc(Cl)cc12)C(F)(F)F InChI=1S/C18H14ClF3N2O3/c1-10-2-4-11(5-3-10)15(25)23-9-17(18(20,21)22)13-8-12(19)6-7-14(13)24-16(26)27-17/h2-8H,9H2,1H3,(H,23,25)(H,24,26) MFSRBEVIEUEEMZ-UHFFFAOYSA-N 50299951 N-{[6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-4-methylbenzamide::CHEMBL582825 Elongation of very long chain fatty acids protein 6 Homo sapiens 38 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299951 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299951&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 25254564 104141480 CHEMBL582825 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534132 Cc1cccc(c1)C(=O)NCC1(OC(=O)Nc2ccc(Cl)cc12)C(F)(F)F InChI=1S/C18H14ClF3N2O3/c1-10-3-2-4-11(7-10)15(25)23-9-17(18(20,21)22)13-8-12(19)5-6-14(13)24-16(26)27-17/h2-8H,9H2,1H3,(H,23,25)(H,24,26) LHUFNHXNZDUMLT-UHFFFAOYSA-N 50299952 N-{[6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-3-methylbenzamide::CHEMBL569176 Elongation of very long chain fatty acids protein 6 Homo sapiens 437 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299952 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299952&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44550049 104141481 CHEMBL569176 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534133 Cc1ccccc1C(=O)NCC1(OC(=O)Nc2ccc(Cl)cc12)C(F)(F)F InChI=1S/C18H14ClF3N2O3/c1-10-4-2-3-5-12(10)15(25)23-9-17(18(20,21)22)13-8-11(19)6-7-14(13)24-16(26)27-17/h2-8H,9H2,1H3,(H,23,25)(H,24,26) GVGXXRDDTTYRKY-UHFFFAOYSA-N 50299953 N-{[6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-2-methylbenzamide::CHEMBL569177 Elongation of very long chain fatty acids protein 6 Homo sapiens 971 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299953 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299953&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44550050 104141482 CHEMBL569177 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534134 COc1ccc(cc1)C(=O)NCC1(OC(=O)Nc2ccc(Cl)cc12)C(F)(F)F InChI=1S/C18H14ClF3N2O4/c1-27-12-5-2-10(3-6-12)15(25)23-9-17(18(20,21)22)13-8-11(19)4-7-14(13)24-16(26)28-17/h2-8H,9H2,1H3,(H,23,25)(H,24,26) UTQUTYRCYJNMQO-UHFFFAOYSA-N 50299954 N-{[6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-4-methoxybenzamide::CHEMBL583523 Elongation of very long chain fatty acids protein 6 Homo sapiens 558 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299954 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299954&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44550158 104141483 CHEMBL583523 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534135 FC(F)(F)c1ccc(cc1)C(=O)NCC1(OC(=O)Nc2ccc(Cl)cc12)C(F)(F)F InChI=1S/C18H11ClF6N2O3/c19-11-5-6-13-12(7-11)16(18(23,24)25,30-15(29)27-13)8-26-14(28)9-1-3-10(4-2-9)17(20,21)22/h1-7H,8H2,(H,26,28)(H,27,29) OZDOALOAQBDLFY-UHFFFAOYSA-N 50299955 N-{[6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-4-(trifluoromethyl)benzamide::CHEMBL566965 Elongation of very long chain fatty acids protein 6 Homo sapiens 813 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299955 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299955&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44550159 104141484 CHEMBL566965 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534136 CC(C)c1ccc(cc1)C(=O)NCC1(OC(=O)Nc2ccc(Cl)cc12)C(F)(F)F InChI=1S/C20H18ClF3N2O3/c1-11(2)12-3-5-13(6-4-12)17(27)25-10-19(20(22,23)24)15-9-14(21)7-8-16(15)26-18(28)29-19/h3-9,11H,10H2,1-2H3,(H,25,27)(H,26,28) UDAIVTJWMNDIHV-UHFFFAOYSA-N 50299956 N-{[6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-4-(propan-2-yl)benzamide::CHEMBL569397 Elongation of very long chain fatty acids protein 6 Homo sapiens 1869 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299956 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299956&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44550160 104141485 CHEMBL569397 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534137 FC(F)(F)C1(CNC(=O)c2ccc(cc2)-c2ccccc2)OC(=O)Nc2ccc(Cl)cc12 InChI=1S/C23H16ClF3N2O3/c24-17-10-11-19-18(12-17)22(23(25,26)27,32-21(31)29-19)13-28-20(30)16-8-6-15(7-9-16)14-4-2-1-3-5-14/h1-12H,13H2,(H,28,30)(H,29,31) BOLJPJHAQUWCBM-UHFFFAOYSA-N 50299957 N-{[6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}biphenyl-4-carboxamide::CHEMBL569398 Elongation of very long chain fatty acids protein 6 Homo sapiens >10000 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299957 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299957&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44550161 104141486 CHEMBL569398 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534138 CS(=O)(=O)c1ccc(cc1)C(=O)NCC1(OC(=O)Nc2ccc(Cl)cc12)C(F)(F)F InChI=1S/C18H14ClF3N2O5S/c1-30(27,28)12-5-2-10(3-6-12)15(25)23-9-17(18(20,21)22)13-8-11(19)4-7-14(13)24-16(26)29-17/h2-8H,9H2,1H3,(H,23,25)(H,24,26) IVQZACOKIZTUKX-UHFFFAOYSA-N 50299958 N-{[6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-4-(methylsulfonyl)benzamide::CHEMBL571935 Elongation of very long chain fatty acids protein 6 Homo sapiens >10000 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299958 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299958&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44550162 104141487 CHEMBL571935 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534139 Fc1ccc(cc1)C(=O)NCC1(OC(=O)Nc2ccccc12)C(F)(F)F InChI=1S/C17H12F4N2O3/c18-11-7-5-10(6-8-11)14(24)22-9-16(17(19,20)21)12-3-1-2-4-13(12)23-15(25)26-16/h1-8H,9H2,(H,22,24)(H,23,25) FLWGBLAHZZXWDD-UHFFFAOYSA-N 50299959 4-Fluoro-N-{[2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::CHEMBL566967 Elongation of very long chain fatty acids protein 6 Homo sapiens 95 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299959 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299959&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44550163 104141488 CHEMBL566967 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534140 Fc1ccc(cc1)C(=O)NCC1(OC(=O)Nc2ccc(cc12)-c1ccccc1)C(F)(F)F InChI=1S/C23H16F4N2O3/c24-17-9-6-15(7-10-17)20(30)28-13-22(23(25,26)27)18-12-16(14-4-2-1-3-5-14)8-11-19(18)29-21(31)32-22/h1-12H,13H2,(H,28,30)(H,29,31) DMQCTPMXNCRRFN-UHFFFAOYSA-N 50299960 4-Fluoro-N-{[2-oxo-6-phenyl-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::CHEMBL567182 Elongation of very long chain fatty acids protein 6 Homo sapiens 1479 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299960 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299960&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44550270 104141489 CHEMBL567182 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534141 Fc1ccc(cc1)C(=O)NCC1(OC(=O)Nc2ccc(cc12)-n1ccccc1=O)C(F)(F)F InChI=1S/C22H15F4N3O4/c23-14-6-4-13(5-7-14)19(31)27-12-21(22(24,25)26)16-11-15(29-10-2-1-3-18(29)30)8-9-17(16)28-20(32)33-21/h1-11H,12H2,(H,27,31)(H,28,32) KBHVWGCMKZINBN-UHFFFAOYSA-N 50299961 4-Fluoro-N-{[2-oxo-6-(2-oxopyridin-1(2H)-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::CHEMBL570564 Elongation of very long chain fatty acids protein 6 Homo sapiens 106 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299961 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299961&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44550271 104141490 CHEMBL570564 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534142 Fc1ccc(cc1)C(=O)NCC1(OC(=O)Nc2ccc(cc12)-c1ccon1)C(F)(F)F InChI=1S/C20H13F4N3O4/c21-13-4-1-11(2-5-13)17(28)25-10-19(20(22,23)24)14-9-12(15-7-8-30-27-15)3-6-16(14)26-18(29)31-19/h1-9H,10H2,(H,25,28)(H,26,29) HLGPJMSDOSCOGG-UHFFFAOYSA-N 50299962 4-Fluoro-N-{[6-(isoxazol-4-yl)-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::CHEMBL584964 Elongation of very long chain fatty acids protein 6 Homo sapiens 121 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299962 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299962&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45484108 104141491 CHEMBL584964 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534143 Fc1ccc(cc1)C(=O)NCC1(OC(=O)Nc2ccc(cc12)-c1cn[nH]c1)C(F)(F)F InChI=1S/C20H14F4N4O3/c21-14-4-1-11(2-5-14)17(29)25-10-19(20(22,23)24)15-7-12(13-8-26-27-9-13)3-6-16(15)28-18(30)31-19/h1-9H,10H2,(H,25,29)(H,26,27)(H,28,30) WTGVCLMUVPTMSM-UHFFFAOYSA-N 50299963 4-Fluoro-N-{[2-oxo-6-(1H-pyrazol-4-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::4-Fluoro-N-{[(+)-2-oxo-6-(1H-pyrazol-4-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::CHEMBL571698 Elongation of very long chain fatty acids protein 6 Homo sapiens 22 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299963 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299963&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44550273 104141492 CHEMBL571698 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534144 Fc1ccc(cc1)C(=O)NCC1(OC(=O)Nc2ccc(cc12)-c1cc[nH]n1)C(F)(F)F InChI=1S/C20H14F4N4O3/c21-13-4-1-11(2-5-13)17(29)25-10-19(20(22,23)24)14-9-12(15-7-8-26-28-15)3-6-16(14)27-18(30)31-19/h1-9H,10H2,(H,25,29)(H,26,28)(H,27,30) SMOJVTPALLWLKJ-UHFFFAOYSA-N 50299964 4-Fluoro-N-{[2-oxo-6-(1H-pyrazol-5-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::CHEMBL571707 Elongation of very long chain fatty acids protein 6 Homo sapiens 4 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299964 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299964&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 25254723 104141493 CHEMBL571707 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534145 Fc1ccc(cc1)C(=O)NCC1(OC(=O)Nc2ccc(cc12)-n1cccn1)C(F)(F)F InChI=1S/C20H14F4N4O3/c21-13-4-2-12(3-5-13)17(29)25-11-19(20(22,23)24)15-10-14(28-9-1-8-26-28)6-7-16(15)27-18(30)31-19/h1-10H,11H2,(H,25,29)(H,27,30) ICHVHNPEPHNIGJ-UHFFFAOYSA-N 50299965 4-Fluoro-N-{[(+)-2-oxo-6-(1H-pyrazol-1-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::4-Fluoro-N-{[2-oxo-6-(1H-pyrazol-1-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::CHEMBL585922 Elongation of very long chain fatty acids protein 6 Homo sapiens 26 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299965 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299965&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44550274 104141494 CHEMBL585922 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534146 Fc1ccc(cc1)C(=O)NCC1(OC(=O)Nc2ccc(cc12)-c1nnc[nH]1)C(F)(F)F InChI=1S/C19H13F4N5O3/c20-12-4-1-10(2-5-12)16(29)24-8-18(19(21,22)23)13-7-11(15-25-9-26-28-15)3-6-14(13)27-17(30)31-18/h1-7,9H,8H2,(H,24,29)(H,27,30)(H,25,26,28) BCROMGAPCJALQM-UHFFFAOYSA-N 50299966 4-Fluoro-N-{[2-oxo-6-(1H-1,2,4-triazol-5-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::CHEMBL583468 Elongation of very long chain fatty acids protein 6 Homo sapiens 97 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299966 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299966&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44550275 104141495 CHEMBL583468 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534147 Fc1ccc(cc1)C(=O)NCC1(OC(=O)Nc2ccc(cc12)-n1cncn1)C(F)(F)F InChI=1S/C19H13F4N5O3/c20-12-3-1-11(2-4-12)16(29)25-8-18(19(21,22)23)14-7-13(28-10-24-9-26-28)5-6-15(14)27-17(30)31-18/h1-7,9-10H,8H2,(H,25,29)(H,27,30) WOAVNQWAOKKNOV-UHFFFAOYSA-N 50299967 4-Fluoro-N-{[2-oxo-6-(1H-1,2,4-triazol-1-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::CHEMBL568728 Elongation of very long chain fatty acids protein 6 Homo sapiens 572 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299967 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299967&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44550375 104141496 CHEMBL568728 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534148 Fc1ccc(cc1)C(=O)NCC1(OC(=O)Nc2ccc(cc12)-c1ncc[nH]1)C(F)(F)F InChI=1S/C20H14F4N4O3/c21-13-4-1-11(2-5-13)17(29)27-10-19(20(22,23)24)14-9-12(16-25-7-8-26-16)3-6-15(14)28-18(30)31-19/h1-9H,10H2,(H,25,26)(H,27,29)(H,28,30) DWZVMPOKZGECQV-UHFFFAOYSA-N 50299968 4-Fluoro-N-{[6-(1H-imidazol-2-yl)-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::CHEMBL566966 Elongation of very long chain fatty acids protein 6 Homo sapiens 537 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299968 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299968&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44550376 104141497 CHEMBL566966 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534149 Fc1ccc(cc1)C(=O)NCC1(OC(=O)Nc2ccc(cc12)N1CCCC1=O)C(F)(F)F InChI=1S/C21H17F4N3O4/c22-13-5-3-12(4-6-13)18(30)26-11-20(21(23,24)25)15-10-14(28-9-1-2-17(28)29)7-8-16(15)27-19(31)32-20/h3-8,10H,1-2,9,11H2,(H,26,30)(H,27,31) YVGGYHZIJCVOIE-UHFFFAOYSA-N 50299969 4-Fluoro-N-{[2-oxo-6-(2-oxopyrrolidin-1-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::CHEMBL576264 Elongation of very long chain fatty acids protein 6 Homo sapiens 39 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299969 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299969&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 25254724 104141498 CHEMBL576264 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534150 Fc1ccc(cc1)C(=O)NCC1(OC(=O)Nc2ccc(cc12)N1CCOC1=O)C(F)(F)F InChI=1S/C20H15F4N3O5/c21-12-3-1-11(2-4-12)16(28)25-10-19(20(22,23)24)14-9-13(27-7-8-31-18(27)30)5-6-15(14)26-17(29)32-19/h1-6,9H,7-8,10H2,(H,25,28)(H,26,29) HTQWMIDJYLWWKA-UHFFFAOYSA-N 50299970 4-Fluoro-N-{[2-oxo-6-(2-oxo-1,3-oxazolidin-3-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::CHEMBL569399 Elongation of very long chain fatty acids protein 6 Homo sapiens 67 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299970 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299970&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45484084 104141499 CHEMBL569399 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534151 Fc1ccc(NC(=O)NCC2(OC(=O)Nc3ccc(Cl)cc23)C(F)(F)F)cc1 InChI=1S/C17H12ClF4N3O3/c18-9-1-6-13-12(7-9)16(17(20,21)22,28-15(27)25-13)8-23-14(26)24-11-4-2-10(19)3-5-11/h1-7H,8H2,(H,25,27)(H2,23,24,26) BJJLMCGAKMRHBT-UHFFFAOYSA-N 50299946 1-{[6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-3-(4-fluorophenyl)urea::1-{[(-)-6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-3-(4-fluorophenyl)urea::CHEMBL570576 Elongation of very long chain fatty acids protein 6 Homo sapiens 33.0 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299946 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299946&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 25254413 104141475 CHEMBL570576 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534152 Fc1ccc(cc1)C(=O)NCC1(OC(=O)Nc2ccc(Cl)cc12)C(F)(F)F InChI=1S/C17H11ClF4N2O3/c18-10-3-6-13-12(7-10)16(17(20,21)22,27-15(26)24-13)8-23-14(25)9-1-4-11(19)5-2-9/h1-7H,8H2,(H,23,25)(H,24,26) UYWRUEVDNQJADG-UHFFFAOYSA-N 50299948 N-{[6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-4-fluorobenzamide::N-{[(-)-6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-4-fluorobenzamide::N-{[(+)-6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-4-fluorobenzamide::CHEMBL572158 Elongation of very long chain fatty acids protein 6 Homo sapiens 26.0 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299948 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299948&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 25254567 104141477 CHEMBL572158 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534153 Fc1ccc(cc1)C(=O)NCC1(OC(=O)Nc2ccc(Cl)cc12)C(F)(F)F InChI=1S/C17H11ClF4N2O3/c18-10-3-6-13-12(7-10)16(17(20,21)22,27-15(26)24-13)8-23-14(25)9-1-4-11(19)5-2-9/h1-7H,8H2,(H,23,25)(H,24,26) UYWRUEVDNQJADG-UHFFFAOYSA-N 50299948 N-{[6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-4-fluorobenzamide::N-{[(-)-6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-4-fluorobenzamide::N-{[(+)-6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-4-fluorobenzamide::CHEMBL572158 Elongation of very long chain fatty acids protein 6 Homo sapiens >10000 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299948 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299948&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 25254567 104141477 CHEMBL572158 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534154 Fc1ccc(cc1)C(=O)NCC1(OC(=O)Nc2ccc(cc12)-c1cn[nH]c1)C(F)(F)F InChI=1S/C20H14F4N4O3/c21-14-4-1-11(2-5-14)17(29)25-10-19(20(22,23)24)15-7-12(13-8-26-27-9-13)3-6-16(15)28-18(30)31-19/h1-9H,10H2,(H,25,29)(H,26,27)(H,28,30) WTGVCLMUVPTMSM-UHFFFAOYSA-N 50299963 4-Fluoro-N-{[2-oxo-6-(1H-pyrazol-4-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::4-Fluoro-N-{[(+)-2-oxo-6-(1H-pyrazol-4-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::CHEMBL571698 Elongation of very long chain fatty acids protein 6 Homo sapiens 22.0 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299963 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299963&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44550273 104141492 CHEMBL571698 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534155 Fc1ccc(cc1)C(=O)NC[C@]1(OC(=O)Nc2ccc(cc12)-c1cc[nH]n1)C(F)(F)F |r| InChI=1S/C20H14F4N4O3/c21-13-4-1-11(2-5-13)17(29)25-10-19(20(22,23)24)14-9-12(15-7-8-26-28-15)3-6-16(14)27-18(30)31-19/h1-9H,10H2,(H,25,29)(H,26,28)(H,27,30) SMOJVTPALLWLKJ-UHFFFAOYSA-N 50299971 4-Fluoro-N-{[(+)-(4S)-2-oxo-6-(1H-pyrazol-5-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::CHEMBL570571 Elongation of very long chain fatty acids protein 6 Homo sapiens 2.6 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299971 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299971&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 25227481 104141500 CHEMBL570571 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534156 Fc1ccc(cc1)C(=O)NCC1(OC(=O)Nc2ccc(cc12)-n1cccn1)C(F)(F)F InChI=1S/C20H14F4N4O3/c21-13-4-2-12(3-5-13)17(29)25-11-19(20(22,23)24)15-10-14(28-9-1-8-26-28)6-7-16(15)27-18(30)31-19/h1-10H,11H2,(H,25,29)(H,27,30) ICHVHNPEPHNIGJ-UHFFFAOYSA-N 50299965 4-Fluoro-N-{[(+)-2-oxo-6-(1H-pyrazol-1-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::4-Fluoro-N-{[2-oxo-6-(1H-pyrazol-1-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::CHEMBL585922 Elongation of very long chain fatty acids protein 6 Homo sapiens 26.0 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299965 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299965&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44550274 104141494 CHEMBL585922 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50534157 Fc1ccc(cc1)C(=O)NCC1(OC(=O)Nc2ccc(Cl)cc12)C(F)(F)F InChI=1S/C17H11ClF4N2O3/c18-10-3-6-13-12(7-10)16(17(20,21)22,27-15(26)24-13)8-23-14(25)9-1-4-11(19)5-2-9/h1-7H,8H2,(H,23,25)(H,24,26) UYWRUEVDNQJADG-UHFFFAOYSA-N 50299948 N-{[6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-4-fluorobenzamide::N-{[(-)-6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-4-fluorobenzamide::N-{[(+)-6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-4-fluorobenzamide::CHEMBL572158 Elongation of very long chain fatty acids protein 6 Mus musculus 26 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299948 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004047&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299948&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 25254567 104141477 CHEMBL572158 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKVKKATKAE Very long chain fatty acid elongase 6 ELOV6_MOUSE Q920L5 Q8CE45 50534158 Fc1ccc(cc1)C(=O)NCC1(OC(=O)Nc2ccc(cc12)-c1cn[nH]c1)C(F)(F)F InChI=1S/C20H14F4N4O3/c21-14-4-1-11(2-5-14)17(29)25-10-19(20(22,23)24)15-7-12(13-8-26-27-9-13)3-6-16(15)28-18(30)31-19/h1-9H,10H2,(H,25,29)(H,26,27)(H,28,30) WTGVCLMUVPTMSM-UHFFFAOYSA-N 50299963 4-Fluoro-N-{[2-oxo-6-(1H-pyrazol-4-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::4-Fluoro-N-{[(+)-2-oxo-6-(1H-pyrazol-4-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::CHEMBL571698 Elongation of very long chain fatty acids protein 6 Mus musculus 20 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299963 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004047&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299963&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44550273 104141492 CHEMBL571698 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKVKKATKAE Very long chain fatty acid elongase 6 ELOV6_MOUSE Q920L5 Q8CE45 50534159 Fc1ccc(cc1)C(=O)NCC1(OC(=O)Nc2ccc(cc12)-n1cccn1)C(F)(F)F InChI=1S/C20H14F4N4O3/c21-13-4-2-12(3-5-13)17(29)25-11-19(20(22,23)24)15-10-14(28-9-1-8-26-28)6-7-16(15)27-18(30)31-19/h1-10H,11H2,(H,25,29)(H,27,30) ICHVHNPEPHNIGJ-UHFFFAOYSA-N 50299965 4-Fluoro-N-{[(+)-2-oxo-6-(1H-pyrazol-1-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::4-Fluoro-N-{[2-oxo-6-(1H-pyrazol-1-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::CHEMBL585922 Elongation of very long chain fatty acids protein 6 Mus musculus 29 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299965 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004047&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299965&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44550274 104141494 CHEMBL585922 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKVKKATKAE Very long chain fatty acid elongase 6 ELOV6_MOUSE Q920L5 Q8CE45 50534160 Fc1ccc(cc1)C(=O)NCC1(OC(=O)Nc2ccc(Cl)cc12)C(F)(F)F InChI=1S/C17H11ClF4N2O3/c18-10-3-6-13-12(7-10)16(17(20,21)22,27-15(26)24-13)8-23-14(25)9-1-4-11(19)5-2-9/h1-7H,8H2,(H,23,25)(H,24,26) UYWRUEVDNQJADG-UHFFFAOYSA-N 50299948 N-{[6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-4-fluorobenzamide::N-{[(-)-6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-4-fluorobenzamide::N-{[(+)-6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-4-fluorobenzamide::CHEMBL572158 Elongation of very long chain fatty acids protein 6 Mus musculus 131 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299948 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004047&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299948&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 25254567 104141477 CHEMBL572158 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKVKKATKAE Very long chain fatty acid elongase 6 ELOV6_MOUSE Q920L5 Q8CE45 50534161 Fc1ccc(cc1)C(=O)NCC1(OC(=O)Nc2ccc(cc12)-c1cn[nH]c1)C(F)(F)F InChI=1S/C20H14F4N4O3/c21-14-4-1-11(2-5-14)17(29)25-10-19(20(22,23)24)15-7-12(13-8-26-27-9-13)3-6-16(15)28-18(30)31-19/h1-9H,10H2,(H,25,29)(H,26,27)(H,28,30) WTGVCLMUVPTMSM-UHFFFAOYSA-N 50299963 4-Fluoro-N-{[2-oxo-6-(1H-pyrazol-4-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::4-Fluoro-N-{[(+)-2-oxo-6-(1H-pyrazol-4-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::CHEMBL571698 Elongation of very long chain fatty acids protein 6 Mus musculus 50 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299963 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004047&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299963&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44550273 104141492 CHEMBL571698 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKVKKATKAE Very long chain fatty acid elongase 6 ELOV6_MOUSE Q920L5 Q8CE45 50534162 Fc1ccc(cc1)C(=O)NC[C@]1(OC(=O)Nc2ccc(cc12)-c1cc[nH]n1)C(F)(F)F |r| InChI=1S/C20H14F4N4O3/c21-13-4-1-11(2-5-13)17(29)25-10-19(20(22,23)24)14-9-12(15-7-8-26-28-15)3-6-16(14)27-18(30)31-19/h1-9H,10H2,(H,25,29)(H,26,28)(H,27,30) SMOJVTPALLWLKJ-UHFFFAOYSA-N 50299971 4-Fluoro-N-{[(+)-(4S)-2-oxo-6-(1H-pyrazol-5-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::CHEMBL570571 Elongation of very long chain fatty acids protein 6 Mus musculus 3.6 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299971 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004047&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299971&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 25227481 104141500 CHEMBL570571 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKVKKATKAE Very long chain fatty acid elongase 6 ELOV6_MOUSE Q920L5 Q8CE45 50534163 Fc1ccc(cc1)C(=O)NCC1(OC(=O)Nc2ccc(cc12)-n1cccn1)C(F)(F)F InChI=1S/C20H14F4N4O3/c21-13-4-2-12(3-5-13)17(29)25-11-19(20(22,23)24)15-10-14(28-9-1-8-26-28)6-7-16(15)27-18(30)31-19/h1-10H,11H2,(H,25,29)(H,27,30) ICHVHNPEPHNIGJ-UHFFFAOYSA-N 50299965 4-Fluoro-N-{[(+)-2-oxo-6-(1H-pyrazol-1-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::4-Fluoro-N-{[2-oxo-6-(1H-pyrazol-1-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::CHEMBL585922 Elongation of very long chain fatty acids protein 6 Mus musculus 58 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299965 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004047&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299965&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44550274 104141494 CHEMBL585922 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKVKKATKAE Very long chain fatty acid elongase 6 ELOV6_MOUSE Q920L5 Q8CE45 50534164 Fc1ccc(cc1)C(=O)NC[C@]1(OC(=O)Nc2ccc(cc12)-c1cc[nH]n1)C(F)(F)F |r| InChI=1S/C20H14F4N4O3/c21-13-4-1-11(2-5-13)17(29)25-10-19(20(22,23)24)14-9-12(15-7-8-26-28-15)3-6-16(14)27-18(30)31-19/h1-9H,10H2,(H,25,29)(H,26,28)(H,27,30) SMOJVTPALLWLKJ-UHFFFAOYSA-N 50299971 4-Fluoro-N-{[(+)-(4S)-2-oxo-6-(1H-pyrazol-5-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::CHEMBL570571 Elongation of very long chain fatty acids protein 1 Homo sapiens 7E3 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299971 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004146&target=Elongation+of+very+long+chain+fatty+acids+protein+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299971&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+1&column=ki&startPg=0&Increment=50&submit=Search 25227481 104141500 CHEMBL570571 1 MEAVVNLYQEVMKHADPRIQGYPLMGSPLLMTSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYNFSLVALSLYIVYEFLMSGWLSTYTWRCDPVDYSNSPEALRMVRVAWLFLFSKFIELMDTVIFILRKKDGQVTFLHVFHHSVLPWSWWWGVKIAPGGMGSFHAMINSSVHVIMYLYYGLSAFGPVAQPYLWWKKHMTAIQLIQFVLVSLHISQYYFMSSCNYQYPVIIHLIWMYGTIFFMLFSNFWYHSYTKGKRLPRALQQNGAPGIAKVKAN Very long chain fatty acid elongase 1 ELOV1_HUMAN Q9BW60 B4DP24 Q53HT2 Q5JUY3 Q8WXU3 Q9NVD9 Q9Y396 50534165 Fc1ccc(cc1)C(=O)NC[C@]1(OC(=O)Nc2ccc(cc12)-c1cc[nH]n1)C(F)(F)F |r| InChI=1S/C20H14F4N4O3/c21-13-4-1-11(2-5-13)17(29)25-10-19(20(22,23)24)14-9-12(15-7-8-26-28-15)3-6-16(14)27-18(30)31-19/h1-9H,10H2,(H,25,29)(H,26,28)(H,27,30) SMOJVTPALLWLKJ-UHFFFAOYSA-N 50299971 4-Fluoro-N-{[(+)-(4S)-2-oxo-6-(1H-pyrazol-5-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::CHEMBL570571 Elongation of very long chain fatty acids protein 2 Homo sapiens >1E4 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299971 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004345&target=Elongation+of+very+long+chain+fatty+acids+protein+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299971&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+2&column=ki&startPg=0&Increment=50&submit=Search 25227481 104141500 CHEMBL570571 1 MEHLKAFDDEINAFLDNMFGPRDSRVRGWFMLDSYLPTFFLTVMYLLSIWLGNKYMKNRPALSLRGILTLYNLGITLLSAYMLAELILSTWEGGYNLQCQDLTSAGEADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTSQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVFPSMHKYLWWKKYLTQAQLVQFVLTITHTMSAVVKPCGFPFGCLIFQSSYMLTLVILFLNFYVQTYRKKPMKKDMQEPPAGKEVKNGFSKAYFTAANGVMNKKAQ Very long chain fatty acid elongase 2 ELOV2_HUMAN Q9NXB9 Q6P9E1 Q86W94 50534166 Fc1ccc(cc1)C(=O)NC[C@]1(OC(=O)Nc2ccc(cc12)-c1cc[nH]n1)C(F)(F)F |r| InChI=1S/C20H14F4N4O3/c21-13-4-1-11(2-5-13)17(29)25-10-19(20(22,23)24)14-9-12(15-7-8-26-28-15)3-6-16(14)27-18(30)31-19/h1-9H,10H2,(H,25,29)(H,26,28)(H,27,30) SMOJVTPALLWLKJ-UHFFFAOYSA-N 50299971 4-Fluoro-N-{[(+)-(4S)-2-oxo-6-(1H-pyrazol-5-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::CHEMBL570571 Elongation of very long chain fatty acids protein 5 Homo sapiens >1E4 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299971 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004348&target=Elongation+of+very+long+chain+fatty+acids+protein+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299971&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+5&column=ki&startPg=0&Increment=50&submit=Search 25227481 104141500 CHEMBL570571 1 MEHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPKYMRNKQPFSCRGILVVYNLGLTLLSLYMFCELVTGVWEGKYNFFCQGTRTAGESDMKIIRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYHHASMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSSVPSMRPYLWWKKYITQGQLLQFVLTIIQTSCGVIWPCTFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD Very long chain fatty acid elongase 5 ELOV5_HUMAN Q9NYP7 B4DZJ2 F6SH78 Q59EL3 Q5TGH5 Q6NXE7 Q7L2S5 Q8NCG4 Q9UI22 50534167 Fc1ccc(cc1)C(=O)NC[C@]1(OC(=O)Nc2ccc(cc12)-c1cc[nH]n1)C(F)(F)F |r| InChI=1S/C20H14F4N4O3/c21-13-4-1-11(2-5-13)17(29)25-10-19(20(22,23)24)14-9-12(15-7-8-26-28-15)3-6-16(14)27-18(30)31-19/h1-9H,10H2,(H,25,29)(H,26,28)(H,27,30) SMOJVTPALLWLKJ-UHFFFAOYSA-N 50299971 4-Fluoro-N-{[(+)-(4S)-2-oxo-6-(1H-pyrazol-5-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::CHEMBL570571 Elongation of very long chain fatty acids protein 3 Homo sapiens 130 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299971 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004294&target=Elongation+of+very+long+chain+fatty+acids+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299971&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+3&column=ki&startPg=0&Increment=50&submit=Search 25227481 104141500 CHEMBL570571 1 MVTAMNVSHEVNQLFQPYNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVFLLSKVIELGDTAFIILRKRPLIFIHWYHHSTVLVYTSFGYKNKVPAGGWFVTMNFGVHAIMYTYYTLKAANVKPPKMLPMLITSLQILQMFVGAIVSILTYIWRQDQGCHTTMEHLFWSFILYMTYFILFAHFFCQTYIRPKVKAKTKSQ Very long chain fatty acid elongase 3 ELOV3_HUMAN Q9HB03 Q5VZL3 Q8N180 50534168 Fc1ccc(cc1)C(=O)NC[C@]1(OC(=O)Nc2ccc(cc12)-c1cc[nH]n1)C(F)(F)F |r| InChI=1S/C20H14F4N4O3/c21-13-4-1-11(2-5-13)17(29)25-10-19(20(22,23)24)14-9-12(15-7-8-26-28-15)3-6-16(14)27-18(30)31-19/h1-9H,10H2,(H,25,29)(H,26,28)(H,27,30) SMOJVTPALLWLKJ-UHFFFAOYSA-N 50299971 4-Fluoro-N-{[(+)-(4S)-2-oxo-6-(1H-pyrazol-5-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::CHEMBL570571 Elongation of very long chain fatty acids protein 3 Mus musculus 19 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299971 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004063&target=Elongation+of+very+long+chain+fatty+acids+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299971&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+3&column=ki&startPg=0&Increment=50&submit=Search 25227481 104141500 CHEMBL570571 1 MDTSMNFSRGLKMDLMQPYDFETFQDLRPFLEEYWVSSFLIVVVYLLLIVVGQTYMRTRKSFSLQRPLILWSFFLAIFSILGTLRMWKFMATVMFTVGLKQTVCFAIYTDDAVVRFWSFLFLLSKVVELGDTAFIILRKRPLIFVHWYHHSTVLLFTSFGYKNKVPSGGWFMTMNFGVHSVMYTYYTMKAAKLKHPNLLPMVITSLQILQMVLGTIFGILNYIWRQEKGCHTTTEHFFWSFMLYGTYFILFAHFFHRAYLRPKGKVASKSQ Very long chain fatty acid elongase 3 ELOV3_MOUSE O35949 50534169 Fc1ccc(cc1)C(=O)NC[C@]1(OC(=O)Nc2ccc(cc12)-c1cc[nH]n1)C(F)(F)F |r| InChI=1S/C20H14F4N4O3/c21-13-4-1-11(2-5-13)17(29)25-10-19(20(22,23)24)14-9-12(15-7-8-26-28-15)3-6-16(14)27-18(30)31-19/h1-9H,10H2,(H,25,29)(H,26,28)(H,27,30) SMOJVTPALLWLKJ-UHFFFAOYSA-N 50299971 4-Fluoro-N-{[(+)-(4S)-2-oxo-6-(1H-pyrazol-5-yl)-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}benzamide::CHEMBL570571 Elongation of very long chain fatty acids protein 6 Mus musculus 14 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299971 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004047&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299971&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 25227481 104141500 CHEMBL570571 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKVKKATKAE Very long chain fatty acid elongase 6 ELOV6_MOUSE Q920L5 Q8CE45 50534170 Fc1ccc(NC(=O)NCC2(OC(=O)Nc3ccc(Cl)cc23)C(F)(F)F)cc1 InChI=1S/C17H12ClF4N3O3/c18-9-1-6-13-12(7-9)16(17(20,21)22,28-15(27)25-13)8-23-14(26)24-11-4-2-10(19)3-5-11/h1-7H,8H2,(H,25,27)(H2,23,24,26) BJJLMCGAKMRHBT-UHFFFAOYSA-N 50299946 1-{[6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-3-(4-fluorophenyl)urea::1-{[(-)-6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-3-(4-fluorophenyl)urea::CHEMBL570576 Elongation of very long chain fatty acids protein 6 Mus musculus 31 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299946 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004047&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299946&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 25254413 104141475 CHEMBL570576 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKVKKATKAE Very long chain fatty acid elongase 6 ELOV6_MOUSE Q920L5 Q8CE45 50534171 Fc1ccc(NC(=O)NCC2(OC(=O)Nc3ccc(Cl)cc23)C(F)(F)F)cc1 InChI=1S/C17H12ClF4N3O3/c18-9-1-6-13-12(7-9)16(17(20,21)22,28-15(27)25-13)8-23-14(26)24-11-4-2-10(19)3-5-11/h1-7H,8H2,(H,25,27)(H2,23,24,26) BJJLMCGAKMRHBT-UHFFFAOYSA-N 50299946 1-{[6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-3-(4-fluorophenyl)urea::1-{[(-)-6-Chloro-2-oxo-4-(trifluoromethyl)-1,4-dihydro-2H-3,1-benzoxazin-4-yl]methyl}-3-(4-fluorophenyl)urea::CHEMBL570576 Elongation of very long chain fatty acids protein 6 Mus musculus 377 ChEMBL 10.1021/jm900915x 10.7270/Q2XK8FMB 19883081 Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 11/20/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50299946 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004047&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50299946&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 25254413 104141475 CHEMBL570576 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKVKKATKAE Very long chain fatty acid elongase 6 ELOV6_MOUSE Q920L5 Q8CE45