BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 59588 Cc1ccc(N2C(=S)S\C(=C/c3cc(cc(Br)c3O)[N+]([O-])=O)C2=O)c(C)c1 InChI=1S/C18H13BrN2O4S2/c1-9-3-4-14(10(2)5-9)20-17(23)15(27-18(20)26)7-11-6-12(21(24)25)8-13(19)16(11)22/h3-8,22H,1-2H3 RUHRGJMWINLPBH-UHFFFAOYSA-N 33298 rhodanine, 1 Sortase family protein Staphylococcus aureus 3700 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33298 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33298&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 2256157 85266917 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59589 Oc1c(Br)cc(cc1\C=C1/SC(=S)N(C1=O)c1cccc(Cl)c1)[N+]([O-])=O InChI=1S/C16H8BrClN2O4S2/c17-12-7-11(20(23)24)4-8(14(12)21)5-13-15(22)19(16(25)26-13)10-3-1-2-9(18)6-10/h1-7,21H VZGQVPZIMGNTHX-UHFFFAOYSA-N 33300 rhodanine, 1-1 Sortase family protein Staphylococcus aureus 17000 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33300 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33300&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 2252216 85266918 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59590 Cc1cccc(c1)N1C(=S)S\C(=C/c2cc(cc(Br)c2O)[N+]([O-])=O)C1=O InChI=1S/C17H11BrN2O4S2/c1-9-3-2-4-11(5-9)19-16(22)14(26-17(19)25)7-10-6-12(20(23)24)8-13(18)15(10)21/h2-8,21H,1H3 QVRWXCIPARSBJT-UHFFFAOYSA-N 33301 rhodanine, 1-2::US10849901, Compound 115 Sortase family protein Staphylococcus aureus 15000 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33301 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33301&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 2258834 85266919 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59591 Oc1c(Br)cc(cc1\C=C1/SC(=S)N(C1=O)c1ccc(cc1)[N+]([O-])=O)[N+]([O-])=O InChI=1S/C16H8BrN3O6S2/c17-12-7-11(20(25)26)5-8(14(12)21)6-13-15(22)18(16(27)28-13)9-1-3-10(4-2-9)19(23)24/h1-7,21H XPKXLEFIBHBPKU-UHFFFAOYSA-N 33302 rhodanine, 1-3 Sortase family protein Staphylococcus aureus 12000 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33302 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33302&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 5725131 85266920 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59592 Cc1ccc(N2C(=S)S\C(=C/c3cc(Br)c(O)c(c3)[N+]([O-])=O)C2=O)c(C)c1 InChI=1S/C18H13BrN2O4S2/c1-9-3-4-13(10(2)5-9)20-17(23)15(27-18(20)26)8-11-6-12(19)16(22)14(7-11)21(24)25/h3-8,22H,1-2H3 PLASDSQJWBHIEZ-UHFFFAOYSA-N 33303 rhodanine, 1-4 Sortase family protein Staphylococcus aureus 35000 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33303 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33303&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 2294062 85266921 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59593 Cc1ccc(\C=C2/SC(=S)N(C2=O)c2cccc(Cl)c2)cc1[N+]([O-])=O InChI=1S/C17H11ClN2O3S2/c1-10-5-6-11(7-14(10)20(22)23)8-15-16(21)19(17(24)25-15)13-4-2-3-12(18)9-13/h2-9H,1H3 RJMGQXYYDCHYLE-UHFFFAOYSA-N 33304 rhodanine, 1-5 Sortase family protein Staphylococcus aureus >1000000 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33304 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33304&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 2286914 85266922 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59594 Cc1ccc(N2C(=S)S\C(=C/c3cccc(c3)[N+]([O-])=O)C2=O)c(C)c1 InChI=1S/C18H14N2O3S2/c1-11-6-7-15(12(2)8-11)19-17(21)16(25-18(19)24)10-13-4-3-5-14(9-13)20(22)23/h3-10H,1-2H3 PTAQQPKIKQCTMI-UHFFFAOYSA-N 33305 rhodanine, 1-6 Sortase family protein Staphylococcus aureus 119000 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33305 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33305&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 1575254 85266923 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59595 CN1C(=S)S\C(=C/c2cc(cc(Br)c2O)[N+]([O-])=O)C1=O InChI=1S/C11H7BrN2O4S2/c1-13-10(16)8(20-11(13)19)3-5-2-6(14(17)18)4-7(12)9(5)15/h2-4,15H,1H3 YXJVOHQUZXZRGK-UHFFFAOYSA-N 33306 rhodanine, 1-7 Sortase family protein Staphylococcus aureus 14000 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33306 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33306&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 2252351 85266924 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59596 CN1C(=S)S\C(=C/c2ccc(o2)-c2ccccc2)C1=O InChI=1S/C15H11NO2S2/c1-16-14(17)13(20-15(16)19)9-11-7-8-12(18-11)10-5-3-2-4-6-10/h2-9H,1H3 IBEHYIFSXLGAMD-UHFFFAOYSA-N 33307 rhodanine, 1-8 Sortase family protein Staphylococcus aureus 405000 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33307 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33307&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 2140738 85266925 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59597 CCCN1C(=S)S\C(=C/c2ccc(o2)-c2ccccc2)C1=O InChI=1S/C17H15NO2S2/c1-2-10-18-16(19)15(22-17(18)21)11-13-8-9-14(20-13)12-6-4-3-5-7-12/h3-9,11H,2,10H2,1H3 JOLSMVHQAFFNTB-UHFFFAOYSA-N 33308 rhodanine, 1-9 Sortase family protein Staphylococcus aureus 186000 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33308 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33308&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246277 85266926 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59598 O=C1N(Cc2ccccc2)C(=S)S\C1=C/c1ccc(o1)-c1ccccc1 InChI=1S/C21H15NO2S2/c23-20-19(26-21(25)22(20)14-15-7-3-1-4-8-15)13-17-11-12-18(24-17)16-9-5-2-6-10-16/h1-13H,14H2 APTDPNQUBMQRRL-UHFFFAOYSA-N 33309 rhodanine, 1-10 Sortase family protein Staphylococcus aureus 492000 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33309 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33309&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 6510353 85266927 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59599 CCN1C(=S)S\C(=C/c2ccc(o2)-c2cccc(Cl)c2)C1=O InChI=1S/C16H12ClNO2S2/c1-2-18-15(19)14(22-16(18)21)9-12-6-7-13(20-12)10-4-3-5-11(17)8-10/h3-9H,2H2,1H3 SBDOAUWESPXGGY-UHFFFAOYSA-N 33310 rhodanine, 1-11 Sortase family protein Staphylococcus aureus 109000 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33310 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33310&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 2256659 85266928 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59600 CCN1C(=S)S\C(=C/c2ccc(o2)-c2ccccc2[N+]([O-])=O)C1=O InChI=1S/C16H12N2O4S2/c1-2-17-15(19)14(24-16(17)23)9-10-7-8-13(22-10)11-5-3-4-6-12(11)18(20)21/h3-9H,2H2,1H3 BWAWMJRGHPMBSJ-UHFFFAOYSA-N 33311 rhodanine, 1-12 Sortase family protein Staphylococcus aureus 104000 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33311 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33311&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 2145944 85266929 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59601 C=CCN1C(=S)S\C(=C/c2ccc(o2)-c2ccccc2)C1=O InChI=1S/C17H13NO2S2/c1-2-10-18-16(19)15(22-17(18)21)11-13-8-9-14(20-13)12-6-4-3-5-7-12/h2-9,11H,1,10H2 YAIFLEPRFXXIFQ-UHFFFAOYSA-N 33312 rhodanine, 1-13 Sortase family protein Staphylococcus aureus 199000 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33312 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33312&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 2272467 85266930 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59602 COc1c(S)cnn(-c2cccc(Cl)c2)c1=O InChI=1S/C11H9ClN2O2S/c1-16-10-9(17)6-13-14(11(10)15)8-4-2-3-7(12)5-8/h2-6,17H,1H3 PYAGIKMJHGXHLC-UHFFFAOYSA-N 33313 pyridazinone, 2 Sortase family protein Staphylococcus aureus 4500 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33313 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33313&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 24016224 85266931 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59603 CCOc1c(S)cnn(-c2ccccc2)c1=O InChI=1S/C12H12N2O2S/c1-2-16-11-10(17)8-13-14(12(11)15)9-6-4-3-5-7-9/h3-8,17H,2H2,1H3 FTEDVERZAAIDFU-UHFFFAOYSA-N 33314 pyridazinone, 2-10::pyridazinone, 2-1 Sortase family protein Staphylococcus aureus 200 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33314 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33314&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 757809 85266932 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59604 CSc1cnn(-c2ccccc2)c(=O)c1O InChI=1S/C11H10N2O2S/c1-16-9-7-12-13(11(15)10(9)14)8-5-3-2-4-6-8/h2-7,14H,1H3 GMWBNXYDFREPMZ-UHFFFAOYSA-N 33315 pyridazinone, 2-2 Sortase family protein Staphylococcus aureus >50000 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33315 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33315&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 6456205 85266933 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59605 CCn1ncc(SC)c(O)c1=O InChI=1S/C7H10N2O2S/c1-3-9-7(11)6(10)5(12-2)4-8-9/h4,10H,3H2,1-2H3 YKHJWNZADIBUBY-UHFFFAOYSA-N 33316 pyridazinone, 2-3 Sortase family protein Staphylococcus aureus >50000 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33316 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33316&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246278 85266934 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59606 CSc1cnn(-c2ccccc2)c(=O)c1Cl InChI=1S/C11H9ClN2OS/c1-16-9-7-13-14(11(15)10(9)12)8-5-3-2-4-6-8/h2-7H,1H3 CZLNRHWNIFQJHA-UHFFFAOYSA-N 33317 pyridazinone, 2-4 Sortase family protein Staphylococcus aureus >50000 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33317 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33317&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 779700 85266935 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59607 COc1cnn(-c2ccccc2)c(=O)c1S InChI=1S/C11H10N2O2S/c1-15-9-7-12-13(11(14)10(9)16)8-5-3-2-4-6-8/h2-7,16H,1H3 PPSSTFZEXVCENG-UHFFFAOYSA-N 33318 pyridazinone, 2-5 Sortase family protein Staphylococcus aureus 9300 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33318 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33318&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 755081 85266936 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59608 Oc1cnn(-c2ccccc2)c(=O)c1OCc1ccccc1 InChI=1S/C17H14N2O3/c20-15-11-18-19(14-9-5-2-6-10-14)17(21)16(15)22-12-13-7-3-1-4-8-13/h1-11,20H,12H2 ASKDGWBKKRFJAK-UHFFFAOYSA-N 33319 pyridazinone, 2-6 Sortase family protein Staphylococcus aureus >50000 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33319 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33319&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 54694030 85266937 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59609 Oc1c(Br)cc(cc1\C=C1/SC(=S)N(C1=O)c1ccc(cc1)[N+]([O-])=O)[N+]([O-])=O InChI=1S/C16H8BrN3O6S2/c17-12-7-11(20(25)26)5-8(14(12)21)6-13-15(22)18(16(27)28-13)9-1-3-10(4-2-9)19(23)24/h1-7,21H XPKXLEFIBHBPKU-UHFFFAOYSA-N 33302 rhodanine, 1-3 Sortase A Bacillus anthracis str. H9401 20000 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33302 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4085&target=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33302&enzyme=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search 5725131 85266920 1 MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK Sortase A SRTA_BACAN P0DPQ5 59610 CN1C(=S)S\C(=C/c2cc(cc(Br)c2O)[N+]([O-])=O)C1=O InChI=1S/C11H7BrN2O4S2/c1-13-10(16)8(20-11(13)19)3-5-2-6(14(17)18)4-7(12)9(5)15/h2-4,15H,1H3 YXJVOHQUZXZRGK-UHFFFAOYSA-N 33306 rhodanine, 1-7 Sortase A Bacillus anthracis str. H9401 13000 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33306 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4085&target=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33306&enzyme=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search 2252351 85266924 1 MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK Sortase A SRTA_BACAN P0DPQ5 59611 CCCN1C(=S)S\C(=C/c2ccc(o2)-c2ccccc2)C1=O InChI=1S/C17H15NO2S2/c1-2-10-18-16(19)15(22-17(18)21)11-13-8-9-14(20-13)12-6-4-3-5-7-12/h3-9,11H,2,10H2,1H3 JOLSMVHQAFFNTB-UHFFFAOYSA-N 33308 rhodanine, 1-9 Sortase A Bacillus anthracis str. H9401 53000 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33308 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4085&target=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33308&enzyme=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search 44246277 85266926 1 MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK Sortase A SRTA_BACAN P0DPQ5 59612 CCN1C(=S)S\C(=C/c2ccc(o2)-c2ccccc2[N+]([O-])=O)C1=O InChI=1S/C16H12N2O4S2/c1-2-17-15(19)14(24-16(17)23)9-10-7-8-13(22-10)11-5-3-4-6-12(11)18(20)21/h3-9H,2H2,1H3 BWAWMJRGHPMBSJ-UHFFFAOYSA-N 33311 rhodanine, 1-12 Sortase A Bacillus anthracis str. H9401 74000 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33311 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4085&target=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33311&enzyme=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search 2145944 85266929 1 MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK Sortase A SRTA_BACAN P0DPQ5 59613 C=CCN1C(=S)S\C(=C/c2ccc(o2)-c2ccccc2)C1=O InChI=1S/C17H13NO2S2/c1-2-10-18-16(19)15(22-17(18)21)11-13-8-9-14(20-13)12-6-4-3-5-7-12/h2-9,11H,1,10H2 YAIFLEPRFXXIFQ-UHFFFAOYSA-N 33312 rhodanine, 1-13 Sortase A Bacillus anthracis str. H9401 27000 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33312 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4085&target=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33312&enzyme=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search 2272467 85266930 1 MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK Sortase A SRTA_BACAN P0DPQ5 59614 CCOc1c(S)cnn(-c2ccccc2)c1=O InChI=1S/C12H12N2O2S/c1-2-16-11-10(17)8-13-14(12(11)15)9-6-4-3-5-7-9/h3-8,17H,2H2,1H3 FTEDVERZAAIDFU-UHFFFAOYSA-N 33314 pyridazinone, 2-10::pyridazinone, 2-1 Sortase A Bacillus anthracis str. H9401 1400 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33314 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4085&target=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33314&enzyme=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search 757809 85266932 1 MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK Sortase A SRTA_BACAN P0DPQ5 59615 COc1cnn(-c2ccccc2)c(=O)c1S InChI=1S/C11H10N2O2S/c1-15-9-7-12-13(11(14)10(9)16)8-5-3-2-4-6-8/h2-7,16H,1H3 PPSSTFZEXVCENG-UHFFFAOYSA-N 33318 pyridazinone, 2-5 Sortase A Bacillus anthracis str. H9401 1800 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33318 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4085&target=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33318&enzyme=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search 755081 85266936 1 MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK Sortase A SRTA_BACAN P0DPQ5 59616 Oc1cnn(-c2ccccc2)c(=O)c1OCc1ccccc1 InChI=1S/C17H14N2O3/c20-15-11-18-19(14-9-5-2-6-10-14)17(21)16(15)22-12-13-7-3-1-4-8-13/h1-11,20H,12H2 ASKDGWBKKRFJAK-UHFFFAOYSA-N 33319 pyridazinone, 2-6 Sortase A Bacillus anthracis str. H9401 >50000 7.5000 25.00 C Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33319 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4085&target=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33319&enzyme=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search 54694030 85266937 1 MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK Sortase A SRTA_BACAN P0DPQ5 59617 COc1c(O)cnn(-c2ccccc2)c1=O InChI=1S/C11H10N2O3/c1-16-10-9(14)7-12-13(11(10)15)8-5-3-2-4-6-8/h2-7,14H,1H3 IHRUCOODPMSJSZ-UHFFFAOYSA-N 33320 pyridazinone, 2-7 Sortase family protein Staphylococcus aureus >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33320 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33320&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 54686949 85266938 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59618 CCSc1c(O)cnn(-c2ccccc2)c1=O InChI=1S/C12H12N2O2S/c1-2-17-11-10(15)8-13-14(12(11)16)9-6-4-3-5-7-9/h3-8,15H,2H2,1H3 UYIGDOOZRPUBSA-UHFFFAOYSA-N 33321 pyridazinone, 2-8 Sortase family protein Staphylococcus aureus >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33321 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33321&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 54690615 85266939 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59619 CCSc1c(S)cnn(-c2ccccc2)c1=O InChI=1S/C12H12N2OS2/c1-2-17-11-10(16)8-13-14(12(11)15)9-6-4-3-5-7-9/h3-8,16H,2H2,1H3 YZPQICXIDREQHD-UHFFFAOYSA-N 33322 pyridazinone, 2-9 Sortase family protein Staphylococcus aureus 1400 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33322 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33322&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 757009 85266940 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59620 CCOc1c(S)cnn(-c2ccccc2)c1=O InChI=1S/C12H12N2O2S/c1-2-16-11-10(17)8-13-14(12(11)15)9-6-4-3-5-7-9/h3-8,17H,2H2,1H3 FTEDVERZAAIDFU-UHFFFAOYSA-N 33314 pyridazinone, 2-10::pyridazinone, 2-1 Sortase family protein Staphylococcus aureus 13000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33314 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33314&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 757809 85266932 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59621 CCOc1c(S)cnn(-c2ccc(cc2)[N+]([O-])=O)c1=O InChI=1S/C12H11N3O4S/c1-2-19-11-10(20)7-13-14(12(11)16)8-3-5-9(6-4-8)15(17)18/h3-7,20H,2H2,1H3 MNYYEKUOPXFSBC-UHFFFAOYSA-N 33324 pyridazinone, 2-11 Sortase family protein Staphylococcus aureus 30000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33324 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33324&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246279 85266942 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59622 CCOc1c(S)cnn(-c2cccc(Br)c2)c1=O InChI=1S/C12H11BrN2O2S/c1-2-17-11-10(18)7-14-15(12(11)16)9-5-3-4-8(13)6-9/h3-7,18H,2H2,1H3 AJLYHWAVQAUUMX-UHFFFAOYSA-N 33325 pyridazinone, 2-12 Sortase family protein Staphylococcus aureus >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33325 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33325&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246280 85266943 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59623 CCOc1c(S)cnn(-c2cccc(F)c2)c1=O InChI=1S/C12H11FN2O2S/c1-2-17-11-10(18)7-14-15(12(11)16)9-5-3-4-8(13)6-9/h3-7,18H,2H2,1H3 ZXUCEYXKEQFMPA-UHFFFAOYSA-N 33326 pyridazinone, 2-13 Sortase family protein Staphylococcus aureus 5500 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33326 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33326&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246281 85266944 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59624 CCOc1c(S)cnn(-c2cccc(C)c2)c1=O InChI=1S/C13H14N2O2S/c1-3-17-12-11(18)8-14-15(13(12)16)10-6-4-5-9(2)7-10/h4-8,18H,3H2,1-2H3 HPLPCHWUGKYEFX-UHFFFAOYSA-N 33327 pyridazinone, 2-14 Sortase family protein Staphylococcus aureus 3300 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33327 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33327&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246282 85266945 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59625 CCOc1c(S)cnn(-c2cc(Cl)cc(Cl)c2)c1=O InChI=1S/C12H10Cl2N2O2S/c1-2-18-11-10(19)6-15-16(12(11)17)9-4-7(13)3-8(14)5-9/h3-6,19H,2H2,1H3 KJCURGSLCJXDEB-UHFFFAOYSA-N 33328 pyridazinone, 2-15 Sortase family protein Staphylococcus aureus 301000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33328 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33328&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246283 85266946 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59626 CCOc1c(S)cnn(C2CCCCC2)c1=O InChI=1S/C12H18N2O2S/c1-2-16-11-10(17)8-13-14(12(11)15)9-6-4-3-5-7-9/h8-9,17H,2-7H2,1H3 NBSGUEKTWNOSHZ-UHFFFAOYSA-N 33329 pyridazinone, 2-16 Sortase family protein Staphylococcus aureus 17900 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33329 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33329&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246284 85266947 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59627 CCOc1c(SSc2cnn(-c3ccccc3)c(=O)c2OCC)cnn(-c2ccccc2)c1=O InChI=1S/C24H22N4O4S2/c1-3-31-21-19(15-25-27(23(21)29)17-11-7-5-8-12-17)33-34-20-16-26-28(18-13-9-6-10-14-18)24(30)22(20)32-4-2/h5-16H,3-4H2,1-2H3 JOHYWLFVXUHDOJ-UHFFFAOYSA-N 33330 pyridazinone, 2-17 Sortase family protein Staphylococcus aureus 1500 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33330 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33330&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246285 85266948 C15496 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59628 CCOc1cnn(-c2ccccc2)c(=O)c1S InChI=1S/C12H12N2O2S/c1-2-16-10-8-13-14(12(15)11(10)17)9-6-4-3-5-7-9/h3-8,17H,2H2,1H3 CZXNVPXOQGDNNF-UHFFFAOYSA-N 33331 pyridazinone, 2-18 Sortase family protein Staphylococcus aureus 4400 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33331 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33331&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246286 85266949 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59629 CCOc1cnn(-c2cccc(F)c2)c(=O)c1S InChI=1S/C12H11FN2O2S/c1-2-17-10-7-14-15(12(16)11(10)18)9-5-3-4-8(13)6-9/h3-7,18H,2H2,1H3 VEXFKCFXDLLRLJ-UHFFFAOYSA-N 33332 pyridazinone, 2-19 Sortase family protein Staphylococcus aureus 5700 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33332 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33332&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246287 85266950 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59630 CCOc1cnn(-c2cccc(C)c2)c(=O)c1S InChI=1S/C13H14N2O2S/c1-3-17-11-8-14-15(13(16)12(11)18)10-6-4-5-9(2)7-10/h4-8,18H,3H2,1-2H3 ONAPECSAAZRUTA-UHFFFAOYSA-N 33333 pyridazinone, 2-20 Sortase family protein Staphylococcus aureus 3100 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33333 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33333&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246288 85266951 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59631 CCOc1cnn(-c2cc(Cl)cc(Cl)c2)c(=O)c1S InChI=1S/C12H10Cl2N2O2S/c1-2-18-10-6-15-16(12(17)11(10)19)9-4-7(13)3-8(14)5-9/h3-6,19H,2H2,1H3 QMAMARVHUMTKMP-UHFFFAOYSA-N 33334 pyridazinone, 2-21 Sortase family protein Staphylococcus aureus 166000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33334 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33334&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246289 85266952 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59632 COc1c(O)cnn(-c2ccccc2)c1=O InChI=1S/C11H10N2O3/c1-16-10-9(14)7-12-13(11(10)15)8-5-3-2-4-6-8/h2-7,14H,1H3 IHRUCOODPMSJSZ-UHFFFAOYSA-N 33320 pyridazinone, 2-7 Sortase A Bacillus anthracis str. H9401 >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33320 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4085&target=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33320&enzyme=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search 54686949 85266938 1 MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK Sortase A SRTA_BACAN P0DPQ5 59633 CCSc1c(O)cnn(-c2ccccc2)c1=O InChI=1S/C12H12N2O2S/c1-2-17-11-10(15)8-13-14(12(11)16)9-6-4-3-5-7-9/h3-8,15H,2H2,1H3 UYIGDOOZRPUBSA-UHFFFAOYSA-N 33321 pyridazinone, 2-8 Sortase A Bacillus anthracis str. H9401 >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33321 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4085&target=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33321&enzyme=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search 54690615 85266939 1 MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK Sortase A SRTA_BACAN P0DPQ5 59634 CCSc1c(S)cnn(-c2ccccc2)c1=O InChI=1S/C12H12N2OS2/c1-2-17-11-10(16)8-13-14(12(11)15)9-6-4-3-5-7-9/h3-8,16H,2H2,1H3 YZPQICXIDREQHD-UHFFFAOYSA-N 33322 pyridazinone, 2-9 Sortase A Bacillus anthracis str. H9401 300 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33322 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4085&target=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33322&enzyme=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search 757009 85266940 1 MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK Sortase A SRTA_BACAN P0DPQ5 59635 CCOc1c(S)cnn(-c2ccccc2)c1=O InChI=1S/C12H12N2O2S/c1-2-16-11-10(17)8-13-14(12(11)15)9-6-4-3-5-7-9/h3-8,17H,2H2,1H3 FTEDVERZAAIDFU-UHFFFAOYSA-N 33314 pyridazinone, 2-10::pyridazinone, 2-1 Sortase A Bacillus anthracis str. H9401 3200 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33314 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4085&target=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33314&enzyme=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search 757809 85266932 1 MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK Sortase A SRTA_BACAN P0DPQ5 59636 CCOc1c(S)cnn(-c2ccc(cc2)[N+]([O-])=O)c1=O InChI=1S/C12H11N3O4S/c1-2-19-11-10(20)7-13-14(12(11)16)8-3-5-9(6-4-8)15(17)18/h3-7,20H,2H2,1H3 MNYYEKUOPXFSBC-UHFFFAOYSA-N 33324 pyridazinone, 2-11 Sortase A Bacillus anthracis str. H9401 6700 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33324 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4085&target=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33324&enzyme=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search 44246279 85266942 1 MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK Sortase A SRTA_BACAN P0DPQ5 59637 CCOc1c(S)cnn(-c2cccc(F)c2)c1=O InChI=1S/C12H11FN2O2S/c1-2-17-11-10(18)7-14-15(12(11)16)9-5-3-4-8(13)6-9/h3-7,18H,2H2,1H3 ZXUCEYXKEQFMPA-UHFFFAOYSA-N 33326 pyridazinone, 2-13 Sortase A Bacillus anthracis str. H9401 1800 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33326 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4085&target=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33326&enzyme=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search 44246281 85266944 1 MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK Sortase A SRTA_BACAN P0DPQ5 59638 CCOc1c(S)cnn(-c2cccc(C)c2)c1=O InChI=1S/C13H14N2O2S/c1-3-17-12-11(18)8-14-15(13(12)16)10-6-4-5-9(2)7-10/h4-8,18H,3H2,1-2H3 HPLPCHWUGKYEFX-UHFFFAOYSA-N 33327 pyridazinone, 2-14 Sortase A Bacillus anthracis str. H9401 1700 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33327 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4085&target=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33327&enzyme=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search 44246282 85266945 1 MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK Sortase A SRTA_BACAN P0DPQ5 59639 CCOc1c(S)cnn(-c2cc(Cl)cc(Cl)c2)c1=O InChI=1S/C12H10Cl2N2O2S/c1-2-18-11-10(19)6-15-16(12(11)17)9-4-7(13)3-8(14)5-9/h3-6,19H,2H2,1H3 KJCURGSLCJXDEB-UHFFFAOYSA-N 33328 pyridazinone, 2-15 Sortase A Bacillus anthracis str. H9401 14000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33328 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4085&target=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33328&enzyme=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search 44246283 85266946 1 MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK Sortase A SRTA_BACAN P0DPQ5 59640 CCOc1c(S)cnn(C2CCCCC2)c1=O InChI=1S/C12H18N2O2S/c1-2-16-11-10(17)8-13-14(12(11)15)9-6-4-3-5-7-9/h8-9,17H,2-7H2,1H3 NBSGUEKTWNOSHZ-UHFFFAOYSA-N 33329 pyridazinone, 2-16 Sortase A Bacillus anthracis str. H9401 1400 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33329 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4085&target=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33329&enzyme=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search 44246284 85266947 1 MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK Sortase A SRTA_BACAN P0DPQ5 59641 CCOc1c(SSc2cnn(-c3ccccc3)c(=O)c2OCC)cnn(-c2ccccc2)c1=O InChI=1S/C24H22N4O4S2/c1-3-31-21-19(15-25-27(23(21)29)17-11-7-5-8-12-17)33-34-20-16-26-28(18-13-9-6-10-14-18)24(30)22(20)32-4-2/h5-16H,3-4H2,1-2H3 JOHYWLFVXUHDOJ-UHFFFAOYSA-N 33330 pyridazinone, 2-17 Sortase A Bacillus anthracis str. H9401 1200 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33330 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4085&target=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33330&enzyme=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search 44246285 85266948 C15496 1 MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK Sortase A SRTA_BACAN P0DPQ5 59642 CCOc1cnn(-c2ccccc2)c(=O)c1S InChI=1S/C12H12N2O2S/c1-2-16-10-8-13-14(12(15)11(10)17)9-6-4-3-5-7-9/h3-8,17H,2H2,1H3 CZXNVPXOQGDNNF-UHFFFAOYSA-N 33331 pyridazinone, 2-18 Sortase A Bacillus anthracis str. H9401 1200 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33331 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4085&target=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33331&enzyme=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search 44246286 85266949 1 MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK Sortase A SRTA_BACAN P0DPQ5 59643 CCOc1cnn(-c2cccc(F)c2)c(=O)c1S InChI=1S/C12H11FN2O2S/c1-2-17-10-7-14-15(12(16)11(10)18)9-5-3-4-8(13)6-9/h3-7,18H,2H2,1H3 VEXFKCFXDLLRLJ-UHFFFAOYSA-N 33332 pyridazinone, 2-19 Sortase A Bacillus anthracis str. H9401 900 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33332 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4085&target=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33332&enzyme=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search 44246287 85266950 1 MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK Sortase A SRTA_BACAN P0DPQ5 59644 CCOc1cnn(-c2cccc(C)c2)c(=O)c1S InChI=1S/C13H14N2O2S/c1-3-17-11-8-14-15(13(16)12(11)18)10-6-4-5-9(2)7-10/h4-8,18H,3H2,1-2H3 ONAPECSAAZRUTA-UHFFFAOYSA-N 33333 pyridazinone, 2-20 Sortase A Bacillus anthracis str. H9401 400 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33333 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4085&target=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33333&enzyme=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search 44246288 85266951 1 MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK Sortase A SRTA_BACAN P0DPQ5 59645 CCOc1cnn(-c2cc(Cl)cc(Cl)c2)c(=O)c1S InChI=1S/C12H10Cl2N2O2S/c1-2-18-10-6-15-16(12(17)11(10)19)9-4-7(13)3-8(14)5-9/h3-6,19H,2H2,1H3 QMAMARVHUMTKMP-UHFFFAOYSA-N 33334 pyridazinone, 2-21 Sortase A Bacillus anthracis str. H9401 5200 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33334 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4085&target=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33334&enzyme=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search 44246289 85266952 1 MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK Sortase A SRTA_BACAN P0DPQ5 59646 COc1c(Cl)cnn(-c2ccccc2)c1=O InChI=1S/C11H9ClN2O2/c1-16-10-9(12)7-13-14(11(10)15)8-5-3-2-4-6-8/h2-7H,1H3 GRENYEBQTKKRGC-UHFFFAOYSA-N 33335 pyridazinone, 2-22 Sortase family protein Staphylococcus aureus >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33335 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33335&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 555185 85266953 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59647 COc1c(Cl)cnn(-c2cccc(Br)c2)c1=O InChI=1S/C11H8BrClN2O2/c1-17-10-9(13)6-14-15(11(10)16)8-4-2-3-7(12)5-8/h2-6H,1H3 AFFCHAJTDYUUQL-UHFFFAOYSA-N 33336 pyridazinone, 2-23 Sortase family protein Staphylococcus aureus >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33336 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33336&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246290 85266954 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59648 COc1c(Cl)cnn(-c2cccc(F)c2)c1=O InChI=1S/C11H8ClFN2O2/c1-17-10-9(12)6-14-15(11(10)16)8-4-2-3-7(13)5-8/h2-6H,1H3 GXDVMMFSAJYVQS-UHFFFAOYSA-N 33337 pyridazinone, 2-24 Sortase family protein Staphylococcus aureus >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33337 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33337&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246291 85266955 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59649 COc1c(Cl)cnn(-c2cccc(C)c2)c1=O InChI=1S/C12H11ClN2O2/c1-8-4-3-5-9(6-8)15-12(16)11(17-2)10(13)7-14-15/h3-7H,1-2H3 OQZFIOMJLVIHSV-UHFFFAOYSA-N 33338 pyridazinone, 2-25 Sortase family protein Staphylococcus aureus >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33338 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33338&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 768228 85266956 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59650 COc1c(Cl)cnn(-c2cc(Cl)cc(Cl)c2)c1=O InChI=1S/C11H7Cl3N2O2/c1-18-10-9(14)5-15-16(11(10)17)8-3-6(12)2-7(13)4-8/h2-5H,1H3 DVLJXVZOXUSCEV-UHFFFAOYSA-N 33339 pyridazinone, 2-26 Sortase family protein Staphylococcus aureus >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33339 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33339&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246292 85266957 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59651 COc1c(Cl)cnn(C2CCCCC2)c1=O InChI=1S/C11H15ClN2O2/c1-16-10-9(12)7-13-14(11(10)15)8-5-3-2-4-6-8/h7-8H,2-6H2,1H3 VIKLUJNXSYUQBT-UHFFFAOYSA-N 33340 pyridazinone, 2-27 Sortase family protein Staphylococcus aureus >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33340 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33340&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 13526210 85266958 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59652 CCOc1c(Cl)cnn(-c2ccccc2)c1=O InChI=1S/C12H11ClN2O2/c1-2-17-11-10(13)8-14-15(12(11)16)9-6-4-3-5-7-9/h3-8H,2H2,1H3 NYUIZJNUHDKUHE-UHFFFAOYSA-N 33341 pyridazinone, 2-28 Sortase family protein Staphylococcus aureus >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33341 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33341&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 779742 85266959 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59653 CCOc1c(Cl)cnn(-c2ccc(cc2)[N+]([O-])=O)c1=O InChI=1S/C12H10ClN3O4/c1-2-20-11-10(13)7-14-15(12(11)17)8-3-5-9(6-4-8)16(18)19/h3-7H,2H2,1H3 POFQHISBMLNCKS-UHFFFAOYSA-N 33342 pyridazinone, 2-29 Sortase family protein Staphylococcus aureus >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33342 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33342&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246293 85266960 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59654 CCOc1c(Cl)cnn(-c2cccc(Br)c2)c1=O InChI=1S/C12H10BrClN2O2/c1-2-18-11-10(14)7-15-16(12(11)17)9-5-3-4-8(13)6-9/h3-7H,2H2,1H3 ZDQIWVIOOFLQIM-UHFFFAOYSA-N 33343 pyridazinone, 2-30 Sortase family protein Staphylococcus aureus >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33343 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33343&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246294 85266961 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59655 CCOc1c(Cl)cnn(-c2cccc(F)c2)c1=O InChI=1S/C12H10ClFN2O2/c1-2-18-11-10(13)7-15-16(12(11)17)9-5-3-4-8(14)6-9/h3-7H,2H2,1H3 NHCVOXJQJDNOAQ-UHFFFAOYSA-N 33344 pyridazinone, 2-31 Sortase family protein Staphylococcus aureus >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33344 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33344&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246295 85266962 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59656 CCOc1c(Cl)cnn(-c2cccc(C)c2)c1=O InChI=1S/C13H13ClN2O2/c1-3-18-12-11(14)8-15-16(13(12)17)10-6-4-5-9(2)7-10/h4-8H,3H2,1-2H3 NNFFCJXYDZLCHF-UHFFFAOYSA-N 33345 pyridazinone, 2-32 Sortase family protein Staphylococcus aureus >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33345 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33345&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246296 85266963 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59657 CCOc1c(Cl)cnn(-c2cc(Cl)cc(Cl)c2)c1=O InChI=1S/C12H9Cl3N2O2/c1-2-19-11-10(15)6-16-17(12(11)18)9-4-7(13)3-8(14)5-9/h3-6H,2H2,1H3 JZBJQUDXSVVOSL-UHFFFAOYSA-N 33346 pyridazinone, 2-33 Sortase family protein Staphylococcus aureus >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33346 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33346&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246297 85266964 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59658 CCOc1c(Cl)cnn(C2CCCCC2)c1=O InChI=1S/C12H17ClN2O2/c1-2-17-11-10(13)8-14-15(12(11)16)9-6-4-3-5-7-9/h8-9H,2-7H2,1H3 DXMNYWPZPLHZNE-UHFFFAOYSA-N 33347 pyridazinone, 2-34 Sortase family protein Staphylococcus aureus >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33347 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33347&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246298 85266965 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59659 CCOc1cnn(-c2ccccc2)c(=O)c1Cl InChI=1S/C12H11ClN2O2/c1-2-17-10-8-14-15(12(16)11(10)13)9-6-4-3-5-7-9/h3-8H,2H2,1H3 WVTBPXHUBFHCQN-UHFFFAOYSA-N 33348 pyridazinone, 2-35 Sortase family protein Staphylococcus aureus 1000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33348 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33348&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 248680 85266966 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59660 CCOc1cnn(-c2ccc(cc2)[N+]([O-])=O)c(=O)c1Cl InChI=1S/C12H10ClN3O4/c1-2-20-10-7-14-15(12(17)11(10)13)8-3-5-9(6-4-8)16(18)19/h3-7H,2H2,1H3 NUBHDCGUYCARNG-UHFFFAOYSA-N 33349 pyridazinone, 2-36 Sortase family protein Staphylococcus aureus 219000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33349 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33349&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246299 85266967 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59661 CCOc1cnn(-c2cccc(Br)c2)c(=O)c1Cl InChI=1S/C12H10BrClN2O2/c1-2-18-10-7-15-16(12(17)11(10)14)9-5-3-4-8(13)6-9/h3-7H,2H2,1H3 RAZZDBJGCOOORN-UHFFFAOYSA-N 33350 pyridazinone, 2-37 Sortase family protein Staphylococcus aureus >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33350 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33350&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246300 85266968 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59662 CCOc1cnn(-c2cccc(F)c2)c(=O)c1Cl InChI=1S/C12H10ClFN2O2/c1-2-18-10-7-15-16(12(17)11(10)13)9-5-3-4-8(14)6-9/h3-7H,2H2,1H3 DLLBPHKZEJYBLE-UHFFFAOYSA-N 33351 pyridazinone, 2-38 Sortase family protein Staphylococcus aureus >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33351 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33351&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246301 85266969 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59663 CCOc1cnn(-c2cccc(C)c2)c(=O)c1Cl InChI=1S/C13H13ClN2O2/c1-3-18-11-8-15-16(13(17)12(11)14)10-6-4-5-9(2)7-10/h4-8H,3H2,1-2H3 YMHQPVCIINSBRM-UHFFFAOYSA-N 33352 pyridazinone, 2-39 Sortase family protein Staphylococcus aureus >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33352 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33352&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 24997708 85266970 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59664 CCOc1cnn(-c2cc(Cl)cc(Cl)c2)c(=O)c1Cl InChI=1S/C12H9Cl3N2O2/c1-2-19-10-6-16-17(12(18)11(10)15)9-4-7(13)3-8(14)5-9/h3-6H,2H2,1H3 BLHMLFVCZDBBJD-UHFFFAOYSA-N 33353 pyridazinone, 2-40 Sortase family protein Staphylococcus aureus >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33353 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33353&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246302 85266971 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59665 CCOc1cnn(C2CCCCC2)c(=O)c1Cl InChI=1S/C12H17ClN2O2/c1-2-17-10-8-14-15(12(16)11(10)13)9-6-4-3-5-7-9/h8-9H,2-7H2,1H3 RCNOYMMSESFDNI-UHFFFAOYSA-N 33354 pyridazinone, 2-41 Sortase family protein Staphylococcus aureus >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33354 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33354&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246303 85266972 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59666 Clc1cnn(-c2ccccc2)c(=O)c1Cl InChI=1S/C10H6Cl2N2O/c11-8-6-13-14(10(15)9(8)12)7-4-2-1-3-5-7/h1-6H VKWCOHVAHQOJGU-UHFFFAOYSA-N 33355 cid_72813::pyridazinone, 2-42 Sortase family protein Staphylococcus aureus >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33355 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33355&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 72813 85266973 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59667 [O-][N+](=O)c1ccc(cc1)-n1ncc(Cl)c(Cl)c1=O InChI=1S/C10H5Cl2N3O3/c11-8-5-13-14(10(16)9(8)12)6-1-3-7(4-2-6)15(17)18/h1-5H QARILIFILZKMIE-UHFFFAOYSA-N 33356 pyridazinone, 2-43 Sortase family protein Staphylococcus aureus >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33356 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33356&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 329050 85266974 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59668 Clc1cnn(-c2cccc(Br)c2)c(=O)c1Cl InChI=1S/C10H5BrCl2N2O/c11-6-2-1-3-7(4-6)15-10(16)9(13)8(12)5-14-15/h1-5H UUXKNOBHNPKNBS-UHFFFAOYSA-N 33357 pyridazinone, 2-44 Sortase family protein Staphylococcus aureus >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33357 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33357&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 43542711 85266975 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59669 Fc1cccc(c1)-n1ncc(Cl)c(Cl)c1=O InChI=1S/C10H5Cl2FN2O/c11-8-5-14-15(10(16)9(8)12)7-3-1-2-6(13)4-7/h1-5H ZFWLCVJZAXDZJF-UHFFFAOYSA-N 33358 pyridazinone, 2-45 Sortase family protein Staphylococcus aureus >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33358 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33358&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246304 85266976 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59670 Cc1cccc(c1)-n1ncc(Cl)c(Cl)c1=O InChI=1S/C11H8Cl2N2O/c1-7-3-2-4-8(5-7)15-11(16)10(13)9(12)6-14-15/h2-6H,1H3 SYUPLLHVMCLXEM-UHFFFAOYSA-N 33359 cid_779573::pyridazinone, 2-46 Sortase family protein Staphylococcus aureus >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33359 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33359&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 779573 85266977 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59671 Clc1cc(Cl)cc(c1)-n1ncc(Cl)c(Cl)c1=O InChI=1S/C10H4Cl4N2O/c11-5-1-6(12)3-7(2-5)16-10(17)9(14)8(13)4-15-16/h1-4H UBKUOBNFCOTJAD-UHFFFAOYSA-N 33360 pyridazinone, 2-47 Sortase family protein Staphylococcus aureus 61000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33360 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33360&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 2774756 85266978 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59672 Clc1cnn(C2CCCCC2)c(=O)c1Cl InChI=1S/C10H12Cl2N2O/c11-8-6-13-14(10(15)9(8)12)7-4-2-1-3-5-7/h6-7H,1-5H2 HXBWVNURVLXBKY-UHFFFAOYSA-N 33361 pyridazinone, 2-48 Sortase family protein Staphylococcus aureus >50000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33361 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33361&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 12351836 85266979 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59673 CCOc1cnn(-c2ccccc2)c(=O)c1Cl InChI=1S/C12H11ClN2O2/c1-2-17-10-8-14-15(12(16)11(10)13)9-6-4-3-5-7-9/h3-8H,2H2,1H3 WVTBPXHUBFHCQN-UHFFFAOYSA-N 33348 pyridazinone, 2-35 Sortase A Bacillus anthracis str. H9401 300 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33348 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4085&target=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33348&enzyme=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search 248680 85266966 1 MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK Sortase A SRTA_BACAN P0DPQ5 59674 CCOc1cnn(-c2ccc(cc2)[N+]([O-])=O)c(=O)c1Cl InChI=1S/C12H10ClN3O4/c1-2-20-10-7-14-15(12(17)11(10)13)8-3-5-9(6-4-8)16(18)19/h3-7H,2H2,1H3 NUBHDCGUYCARNG-UHFFFAOYSA-N 33349 pyridazinone, 2-36 Sortase A Bacillus anthracis str. H9401 247000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33349 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4085&target=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33349&enzyme=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search 44246299 85266967 1 MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK Sortase A SRTA_BACAN P0DPQ5 59675 Clc1cc(Cl)cc(c1)-n1ncc(Cl)c(Cl)c1=O InChI=1S/C10H4Cl4N2O/c11-5-1-6(12)3-7(2-5)16-10(17)9(14)8(13)4-15-16/h1-4H UBKUOBNFCOTJAD-UHFFFAOYSA-N 33360 pyridazinone, 2-47 Sortase A Bacillus anthracis str. H9401 14000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33360 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4085&target=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33360&enzyme=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search 2774756 85266978 1 MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK Sortase A SRTA_BACAN P0DPQ5 59676 Cc1[nH]n(-c2ccccc2)c(=S)c1C=Nc1ccc(cc1)[N+]([O-])=O |w:13.14| InChI=1S/C17H14N4O2S/c1-12-16(11-18-13-7-9-15(10-8-13)21(22)23)17(24)20(19-12)14-5-3-2-4-6-14/h2-11,19H,1H3 XFZZBPFHMAYBJI-UHFFFAOYSA-N 33362 cid_5331956::pyrazolethione, 3 Sortase family protein Staphylococcus aureus 5200 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33362 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33362&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 5331956 85266980 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59677 Cc1[nH]n(-c2ccccc2)c(=S)c1C=Nc1ccc(Br)cc1 |w:13.14| InChI=1S/C17H14BrN3S/c1-12-16(11-19-14-9-7-13(18)8-10-14)17(22)21(20-12)15-5-3-2-4-6-15/h2-11,20H,1H3 QFZXLUJHFAWXJG-UHFFFAOYSA-N 33363 pyrazolethione, 3-1 Sortase family protein Staphylococcus aureus 39000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33363 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33363&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 5338441 85266981 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59678 Cc1[nH]n(-c2ccccc2)c(=S)c1C=Nc1ccc(cc1[N+]([O-])=O)[N+]([O-])=O |w:13.14| InChI=1S/C17H13N5O4S/c1-11-14(17(27)20(19-11)12-5-3-2-4-6-12)10-18-15-8-7-13(21(23)24)9-16(15)22(25)26/h2-10,19H,1H3 RGIXEARARBMORM-UHFFFAOYSA-N 33364 pyrazolethione, 3-2 Sortase family protein Staphylococcus aureus 6800 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33364 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33364&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 5332153 85266982 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59679 Cc1[nH]n(-c2ccccc2)c(=S)c1C=Nc1ccc(cc1Br)[N+]([O-])=O |w:13.14| InChI=1S/C17H13BrN4O2S/c1-11-14(17(25)21(20-11)12-5-3-2-4-6-12)10-19-16-8-7-13(22(23)24)9-15(16)18/h2-10,20H,1H3 XXQBTCWBBYEQFF-UHFFFAOYSA-N 33365 pyrazolethione, 3-3 Sortase family protein Staphylococcus aureus 8900 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33365 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33365&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 5331993 85266983 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59680 Cc1[nH]n(-c2ccccc2)c(=S)c1C=Nc1ccc(cc1O)[N+]([O-])=O |w:13.14| InChI=1S/C17H14N4O3S/c1-11-14(17(25)20(19-11)12-5-3-2-4-6-12)10-18-15-8-7-13(21(23)24)9-16(15)22/h2-10,19,22H,1H3 UVQHXRFHBCCMSJ-UHFFFAOYSA-N 33366 pyrazolethione, 3-4 Sortase family protein Staphylococcus aureus 9600 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33366 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33366&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246305 85266984 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59681 Cc1[nH]n(-c2ccccc2)c(=S)c1C=Nc1cc(ccc1O)[N+]([O-])=O |w:13.14| InChI=1S/C17H14N4O3S/c1-11-14(17(25)20(19-11)12-5-3-2-4-6-12)10-18-15-9-13(21(23)24)7-8-16(15)22/h2-10,19,22H,1H3 MFBPRVGGFDNRGI-UHFFFAOYSA-N 33367 pyrazolethione, 3-5 Sortase family protein Staphylococcus aureus 14000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33367 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33367&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 6969214 85266985 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59682 Cc1[nH]n(-c2ccccc2)c(=S)c1C=Nc1ccc(C)cc1C |w:13.14| InChI=1S/C19H19N3S/c1-13-9-10-18(14(2)11-13)20-12-17-15(3)21-22(19(17)23)16-7-5-4-6-8-16/h4-12,21H,1-3H3 YZTIETNRJTZRQG-UHFFFAOYSA-N 33368 pyrazolethione, 3-6 Sortase family protein Staphylococcus aureus 68000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33368 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33368&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 5399226 85266986 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59683 Cc1[nH]n(-c2ccccc2)c(=S)c1C=Nc1ccc(C)c(C)c1 |w:13.14| InChI=1S/C19H19N3S/c1-13-9-10-16(11-14(13)2)20-12-18-15(3)21-22(19(18)23)17-7-5-4-6-8-17/h4-12,21H,1-3H3 NLJAIQVUYLVUDF-UHFFFAOYSA-N 33369 pyrazolethione, 3-7 Sortase family protein Staphylococcus aureus 52000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33369 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33369&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 5408215 85266987 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59684 Cc1[nH]n(-c2ccccc2)c(=S)c1C=Nc1ccc(I)cc1 |w:13.14| InChI=1S/C17H14IN3S/c1-12-16(11-19-14-9-7-13(18)8-10-14)17(22)21(20-12)15-5-3-2-4-6-15/h2-11,20H,1H3 BRANNDAKKLBYGV-UHFFFAOYSA-N 33370 pyrazolethione, 3-8 Sortase family protein Staphylococcus aureus 42000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33370 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33370&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 5332084 85266988 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59685 Cc1[nH]n(-c2ccccc2)c(=S)c1C=Nc1ccc(cc1)N=Nc1ccccc1 |w:13.14,21.23| InChI=1S/C23H19N5S/c1-17-22(23(29)28(27-17)21-10-6-3-7-11-21)16-24-18-12-14-20(15-13-18)26-25-19-8-4-2-5-9-19/h2-16,27H,1H3 BFQNGOFGQJAOFH-UHFFFAOYSA-N 33371 pyrazolethione, 3-9 Sortase family protein Staphylococcus aureus 9000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33371 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33371&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246306 85266989 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59686 Cc1[nH]n(-c2ccccc2)c(=S)c1C=Nc1ccccc1Cl |w:13.14| InChI=1S/C17H14ClN3S/c1-12-14(11-19-16-10-6-5-9-15(16)18)17(22)21(20-12)13-7-3-2-4-8-13/h2-11,20H,1H3 HMNUORVYFSBZKC-UHFFFAOYSA-N 33372 pyrazolethione, 3-10 Sortase family protein Staphylococcus aureus 54000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33372 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33372&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 22330240 85266990 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59687 Cc1[nH]n(-c2ccccc2)c(=S)c1C=Nc1ccccc1O |w:13.14| InChI=1S/C17H15N3OS/c1-12-14(11-18-15-9-5-6-10-16(15)21)17(22)20(19-12)13-7-3-2-4-8-13/h2-11,19,21H,1H3 DXFBIZPKHUGTQN-UHFFFAOYSA-N 33373 pyrazolethione, 3-11 Sortase family protein Staphylococcus aureus 22000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33373 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33373&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 5338466 85266991 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59688 Cc1[nH]n(-c2ccccc2)c(=S)c1C=Nc1c(Br)cc(Br)cc1Br |w:13.14| InChI=1S/C17H12Br3N3S/c1-10-13(9-21-16-14(19)7-11(18)8-15(16)20)17(24)23(22-10)12-5-3-2-4-6-12/h2-9,22H,1H3 PXVPGPRQAKOBQQ-UHFFFAOYSA-N 33374 pyrazolethione, 3-12 Sortase family protein Staphylococcus aureus 300 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33374 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33374&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 5338519 85266992 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59689 Cc1[nH]n(-c2ccccc2)c(=O)c1C=Nc1ccc(cc1)[N+]([O-])=O |w:13.14| InChI=1S/C17H14N4O3/c1-12-16(11-18-13-7-9-15(10-8-13)21(23)24)17(22)20(19-12)14-5-3-2-4-6-14/h2-11,19H,1H3 IVKWMUZROLZERW-UHFFFAOYSA-N 33375 pyrazolone, 3-13 Sortase family protein Staphylococcus aureus 56000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33375 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33375&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 5335444 85266993 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59690 Cc1[nH]n(-c2ccc(C)cc2)c(=O)c1C=Nc1ccc(cc1)[N+]([O-])=O |w:14.15| InChI=1S/C18H16N4O3/c1-12-3-7-15(8-4-12)21-18(23)17(13(2)20-21)11-19-14-5-9-16(10-6-14)22(24)25/h3-11,20H,1-2H3 YEDWJWCMVVPWBC-UHFFFAOYSA-N 33376 pyrazolone, 3-14 Sortase family protein Staphylococcus aureus 62000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33376 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33376&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246307 85266994 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59691 Cc1[nH]n(-c2ccc(Cl)cc2)c(=O)c1C=Nc1ccc(cc1)[N+]([O-])=O |w:14.15| InChI=1S/C17H13ClN4O3/c1-11-16(10-19-13-4-8-15(9-5-13)22(24)25)17(23)21(20-11)14-6-2-12(18)3-7-14/h2-10,20H,1H3 YABPYSNAZJWOFV-UHFFFAOYSA-N 33377 pyrazolone, 3-15 Sortase family protein Staphylococcus aureus 48000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33377 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33377&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246308 85266995 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59692 Cc1[nH]n(-c2ccc(Cl)cc2)c(=O)c1C=Nc1ccc(cc1C)[N+]([O-])=O |w:14.15| InChI=1S/C18H15ClN4O3/c1-11-9-15(23(25)26)7-8-17(11)20-10-16-12(2)21-22(18(16)24)14-5-3-13(19)4-6-14/h3-10,21H,1-2H3 YRHZCERDJPAPKP-UHFFFAOYSA-N 33378 pyrazolone, 3-16 Sortase family protein Staphylococcus aureus 45000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33378 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33378&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 5285364 85266996 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59693 Cc1[nH]n(-c2ccccc2)c(=S)c1C=Nc1ccccn1 |w:13.14| InChI=1S/C16H14N4S/c1-12-14(11-18-15-9-5-6-10-17-15)16(21)20(19-12)13-7-3-2-4-8-13/h2-11,19H,1H3 RYOLQBWREJGKDP-UHFFFAOYSA-N 33379 pyrazolethione, 3-17 Sortase family protein Staphylococcus aureus 760 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33379 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33379&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 5331902 85266997 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59694 Cc1[nH]n(-c2ccccc2)c(=S)c1C=NC1CCCCC1 |w:13.14| InChI=1S/C17H21N3S/c1-13-16(12-18-14-8-4-2-5-9-14)17(21)20(19-13)15-10-6-3-7-11-15/h3,6-7,10-12,14,19H,2,4-5,8-9H2,1H3 DOMZBSMOPZVXOP-UHFFFAOYSA-N 33380 pyrazolethione, 3-18 Sortase family protein Staphylococcus aureus 115000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33380 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33380&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 5331851 85266998 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59695 CC1=NOC(=O)C1=Nc1ccc(cc1)[N+]([O-])=O |w:7.8,t:1| InChI=1S/C10H7N3O4/c1-6-9(10(14)17-12-6)11-7-2-4-8(5-3-7)13(15)16/h2-5H,1H3 BTDUBAPJHWGTPC-UHFFFAOYSA-N 33381 isoxazolone, 3-19 Sortase family protein Staphylococcus aureus 17000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33381 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33381&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246309 85266999 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59696 CC(=O)c1ccc(cc1)N=C1C(=O)NN=C1C |w:9.9,c:15| InChI=1S/C12H11N3O2/c1-7-11(12(17)15-14-7)13-10-5-3-9(4-6-10)8(2)16/h3-6H,1-2H3,(H,13,15,17) CNSGKHPWCFVZPW-UHFFFAOYSA-N 33382 pyrazolone, 3-20 Sortase family protein Staphylococcus aureus 26000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33382 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33382&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 44246310 85267000 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59697 [O-][N+](=O)c1ccc(\C=C\C(=O)c2ccccc2)cc1 InChI=1S/C15H11NO3/c17-15(13-4-2-1-3-5-13)11-8-12-6-9-14(10-7-12)16(18)19/h1-11H WDZGGAFMGIOIQS-UHFFFAOYSA-N 33383 phenylpropenone, 3-21 Sortase family protein Staphylococcus aureus 51000 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33383 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4084&target=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33383&enzyme=Sortase+family+protein&column=ki&startPg=0&Increment=50&submit=Search 5377323 85267001 1 MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK 2KID,1IJA,1T2P Sortase Q9S446_STAAU Q9S446 A0A1E8WS01 59698 Cc1[nH]n(-c2ccccc2)c(=S)c1C=Nc1ccc(cc1)N=Nc1ccccc1 |w:13.14,21.23| InChI=1S/C23H19N5S/c1-17-22(23(29)28(27-17)21-10-6-3-7-11-21)16-24-18-12-14-20(15-13-18)26-25-19-8-4-2-5-9-19/h2-16,27H,1H3 BFQNGOFGQJAOFH-UHFFFAOYSA-N 33371 pyrazolethione, 3-9 Sortase A Bacillus anthracis str. H9401 1400 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33371 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4085&target=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33371&enzyme=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search 44246306 85266989 1 MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK Sortase A SRTA_BACAN P0DPQ5 59699 Cc1[nH]n(-c2ccccc2)c(=S)c1C=Nc1c(Br)cc(Br)cc1Br |w:13.14| InChI=1S/C17H12Br3N3S/c1-10-13(9-21-16-14(19)7-11(18)8-15(16)20)17(24)23(22-10)12-5-3-2-4-6-12/h2-9,22H,1H3 PXVPGPRQAKOBQQ-UHFFFAOYSA-N 33374 pyrazolethione, 3-12 Sortase A Bacillus anthracis str. H9401 1700 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33374 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4085&target=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33374&enzyme=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search 5338519 85266992 1 MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK Sortase A SRTA_BACAN P0DPQ5 59700 Cc1[nH]n(-c2ccccc2)c(=S)c1C=Nc1ccccn1 |w:13.14| InChI=1S/C16H14N4S/c1-12-14(11-18-15-9-5-6-10-17-15)16(21)20(19-12)13-7-3-2-4-8-13/h2-11,19H,1H3 RYOLQBWREJGKDP-UHFFFAOYSA-N 33379 pyrazolethione, 3-17 Sortase A Bacillus anthracis str. H9401 1400 Curated from the literature by BindingDB 10.1016/j.bmc.2009.08.067 10.7270/Q26W98F0 19781950 aid1799237 Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT 10/15/2009 10/27/2009 University of California Los Angeles http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=33379 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4085&target=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=33379&enzyme=Sortase+A&column=ki&startPg=0&Increment=50&submit=Search 5331902 85266997 1 MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK Sortase A SRTA_BACAN P0DPQ5