BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50531647 CC(C)Oc1ccc(NC(=O)[C@@H]2C[C@@H]3CC[C@@H]2N(C3)S(=O)(=O)c2cccnc2)cc1 |r,TLB:9:11:18.17:14.15,THB:19:17:12.11:14.15| 50298967 (1R*,4S*,6R*)-(+/-)-N-[4-(Propan-2-yloxy)phenyl]-2-(pyridin-3-ylsulfonyl)-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL572610 Elongation of very long chain fatty acids protein 6 Homo sapiens 80 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298967 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298967&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45482579 104140496 CHEMBL572610 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531648 CC(C)Oc1ccc(NC(=O)[C@@H]2C[C@@H]3CC[C@@H]2N(C3)S(=O)(=O)c2cn(C)cn2)cc1 |r,TLB:9:11:18.17:14.15,THB:19:17:12.11:14.15| 50298968 (1R*,4S*,6R*)-(+/-)-2-[(1-Methyl-1H-imidazol-4-yl)sulfonyl]-N-[4-(propan-2-yloxy)phenyl]-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL578249 Elongation of very long chain fatty acids protein 6 Homo sapiens 230 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298968 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298968&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44184500 104140497 CHEMBL578249 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531649 CC(C)Oc1ccc(NC(=O)[C@@H]2C[C@@H]3CC[C@@H]2N(C3)S(=O)(=O)c2cn(C)cn2)cc1 |r,TLB:9:11:18.17:14.15,THB:19:17:12.11:14.15| 50298968 (1R*,4S*,6R*)-(+/-)-2-[(1-Methyl-1H-imidazol-4-yl)sulfonyl]-N-[4-(propan-2-yloxy)phenyl]-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL578249 Elongation of very long chain fatty acids protein 6 Homo sapiens 220 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298968 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298968&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44184500 104140497 CHEMBL578249 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531650 CC(C)Oc1ccc(NC(=O)[C@@H]2C[C@@H]3CC[C@@H]2N(C3)S(=O)(=O)c2cn(C)cn2)cc1 |r,TLB:9:11:18.17:14.15,THB:19:17:12.11:14.15| 50298968 (1R*,4S*,6R*)-(+/-)-2-[(1-Methyl-1H-imidazol-4-yl)sulfonyl]-N-[4-(propan-2-yloxy)phenyl]-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL578249 Elongation of very long chain fatty acids protein 6 Homo sapiens 220 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298968 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298968&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44184500 104140497 CHEMBL578249 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531651 CC(C)Oc1ccc(NC(=O)[C@@H]2C[C@@H]3CC[C@@H]2N(C3)S(=O)(=O)c2cn(C)cn2)cc1 |r,TLB:9:11:18.17:14.15,THB:19:17:12.11:14.15| 50298968 (1R*,4S*,6R*)-(+/-)-2-[(1-Methyl-1H-imidazol-4-yl)sulfonyl]-N-[4-(propan-2-yloxy)phenyl]-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL578249 Elongation of very long chain fatty acids protein 1 Homo sapiens >10000 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298968 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004146&target=Elongation+of+very+long+chain+fatty+acids+protein+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298968&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+1&column=ki&startPg=0&Increment=50&submit=Search 44184500 104140497 CHEMBL578249 1 MEAVVNLYQEVMKHADPRIQGYPLMGSPLLMTSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYNFSLVALSLYIVYEFLMSGWLSTYTWRCDPVDYSNSPEALRMVRVAWLFLFSKFIELMDTVIFILRKKDGQVTFLHVFHHSVLPWSWWWGVKIAPGGMGSFHAMINSSVHVIMYLYYGLSAFGPVAQPYLWWKKHMTAIQLIQFVLVSLHISQYYFMSSCNYQYPVIIHLIWMYGTIFFMLFSNFWYHSYTKGKRLPRALQQNGAPGIAKVKAN Very long chain fatty acid elongase 1 ELOV1_HUMAN Q9BW60 B4DP24 Q53HT2 Q5JUY3 Q8WXU3 Q9NVD9 Q9Y396 50531652 CC(C)Oc1ccc(NC(=O)[C@@H]2C[C@@H]3CC[C@@H]2N(C3)S(=O)(=O)c2cn(C)cn2)cc1 |r,TLB:9:11:18.17:14.15,THB:19:17:12.11:14.15| 50298968 (1R*,4S*,6R*)-(+/-)-2-[(1-Methyl-1H-imidazol-4-yl)sulfonyl]-N-[4-(propan-2-yloxy)phenyl]-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL578249 Elongation of very long chain fatty acids protein 2 Homo sapiens >10000 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298968 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004345&target=Elongation+of+very+long+chain+fatty+acids+protein+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298968&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+2&column=ki&startPg=0&Increment=50&submit=Search 44184500 104140497 CHEMBL578249 1 MEHLKAFDDEINAFLDNMFGPRDSRVRGWFMLDSYLPTFFLTVMYLLSIWLGNKYMKNRPALSLRGILTLYNLGITLLSAYMLAELILSTWEGGYNLQCQDLTSAGEADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTSQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVFPSMHKYLWWKKYLTQAQLVQFVLTITHTMSAVVKPCGFPFGCLIFQSSYMLTLVILFLNFYVQTYRKKPMKKDMQEPPAGKEVKNGFSKAYFTAANGVMNKKAQ Very long chain fatty acid elongase 2 ELOV2_HUMAN Q9NXB9 Q6P9E1 Q86W94 50531653 CC(C)Oc1ccc(NC(=O)[C@@H]2C[C@@H]3CC[C@@H]2N(C3)S(=O)(=O)c2cn(C)cn2)cc1 |r,TLB:9:11:18.17:14.15,THB:19:17:12.11:14.15| 50298968 (1R*,4S*,6R*)-(+/-)-2-[(1-Methyl-1H-imidazol-4-yl)sulfonyl]-N-[4-(propan-2-yloxy)phenyl]-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL578249 Elongation of very long chain fatty acids protein 3 Homo sapiens 1510 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298968 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004294&target=Elongation+of+very+long+chain+fatty+acids+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298968&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+3&column=ki&startPg=0&Increment=50&submit=Search 44184500 104140497 CHEMBL578249 1 MVTAMNVSHEVNQLFQPYNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVFLLSKVIELGDTAFIILRKRPLIFIHWYHHSTVLVYTSFGYKNKVPAGGWFVTMNFGVHAIMYTYYTLKAANVKPPKMLPMLITSLQILQMFVGAIVSILTYIWRQDQGCHTTMEHLFWSFILYMTYFILFAHFFCQTYIRPKVKAKTKSQ Very long chain fatty acid elongase 3 ELOV3_HUMAN Q9HB03 Q5VZL3 Q8N180 50531654 CC(C)Oc1ccc(NC(=O)[C@@H]2C[C@@H]3CC[C@@H]2N(C3)S(=O)(=O)c2cn(C)cn2)cc1 |r,TLB:9:11:18.17:14.15,THB:19:17:12.11:14.15| 50298968 (1R*,4S*,6R*)-(+/-)-2-[(1-Methyl-1H-imidazol-4-yl)sulfonyl]-N-[4-(propan-2-yloxy)phenyl]-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL578249 Elongation of very long chain fatty acids protein 5 Homo sapiens >10000 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298968 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004348&target=Elongation+of+very+long+chain+fatty+acids+protein+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298968&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+5&column=ki&startPg=0&Increment=50&submit=Search 44184500 104140497 CHEMBL578249 1 MEHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPKYMRNKQPFSCRGILVVYNLGLTLLSLYMFCELVTGVWEGKYNFFCQGTRTAGESDMKIIRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYHHASMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSSVPSMRPYLWWKKYITQGQLLQFVLTIIQTSCGVIWPCTFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD Very long chain fatty acid elongase 5 ELOV5_HUMAN Q9NYP7 B4DZJ2 F6SH78 Q59EL3 Q5TGH5 Q6NXE7 Q7L2S5 Q8NCG4 Q9UI22 50531655 CC(C)Oc1ccc(NC(=O)[C@@H]2C[C@@H]3CC[C@@H]2N(C3)S(=O)(=O)c2cn(C)cn2)cc1 |r,TLB:9:11:18.17:14.15,THB:19:17:12.11:14.15| 50298968 (1R*,4S*,6R*)-(+/-)-2-[(1-Methyl-1H-imidazol-4-yl)sulfonyl]-N-[4-(propan-2-yloxy)phenyl]-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL578249 Elongation of very long chain fatty acids protein 6 Mus musculus 73 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298968 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004047&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298968&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44184500 104140497 CHEMBL578249 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKVKKATKAE Very long chain fatty acid elongase 6 ELOV6_MOUSE Q920L5 Q8CE45 50531656 CC(C)Oc1ccc(NC(=O)[C@@H]2C[C@@H]3CC[C@@H]2N(C3)S(=O)(=O)c2cn(C)cn2)cc1 |r,TLB:9:11:18.17:14.15,THB:19:17:12.11:14.15| 50298968 (1R*,4S*,6R*)-(+/-)-2-[(1-Methyl-1H-imidazol-4-yl)sulfonyl]-N-[4-(propan-2-yloxy)phenyl]-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL578249 Elongation of very long chain fatty acids protein 3 Mus musculus 717 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298968 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004063&target=Elongation+of+very+long+chain+fatty+acids+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298968&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+3&column=ki&startPg=0&Increment=50&submit=Search 44184500 104140497 CHEMBL578249 1 MDTSMNFSRGLKMDLMQPYDFETFQDLRPFLEEYWVSSFLIVVVYLLLIVVGQTYMRTRKSFSLQRPLILWSFFLAIFSILGTLRMWKFMATVMFTVGLKQTVCFAIYTDDAVVRFWSFLFLLSKVVELGDTAFIILRKRPLIFVHWYHHSTVLLFTSFGYKNKVPSGGWFMTMNFGVHSVMYTYYTMKAAKLKHPNLLPMVITSLQILQMVLGTIFGILNYIWRQEKGCHTTTEHFFWSFMLYGTYFILFAHFFHRAYLRPKGKVASKSQ Very long chain fatty acid elongase 3 ELOV3_MOUSE O35949 50531657 CC(C)Oc1ccc(NC(=O)[C@@H]2C[C@@H]3CC[C@@H]2N(C3)S(=O)(=O)c2ccccn2)cc1 |r,TLB:9:11:18.17:14.15,THB:19:17:12.11:14.15| 50298969 (1R*,4S*,6R*)-(+/-)-N-[4-(Propan-2-yloxy)phenyl]-2-(pyridin-2-ylsulfonyl)-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL579051 Elongation of very long chain fatty acids protein 6 Homo sapiens 120 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298969 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298969&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45482567 104140498 CHEMBL579051 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531658 CCCCS(=O)(=O)N1C[C@H]2CC[C@H]1[C@@H](C2)C(=O)Nc1ccc(OC)cc1 |r,TLB:4:7:14.13:10.11,THB:15:13:8.7:10.11| 50298970 (1R*,4S*,6R*)-(+/-)-2-(Butylsulfonyl)-N-(4-methoxyphenyl)-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL572604 Elongation of very long chain fatty acids protein 6 Homo sapiens 1710 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298970 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298970&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45482501 104140499 CHEMBL572604 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531659 CCCCS(=O)(=O)N1C[C@H]2CC[C@H]1[C@@H](C2)C(=O)Nc1ccc(OC(C)C)cc1 |r,TLB:4:7:14.13:10.11,THB:15:13:8.7:10.11| 50298971 (1R*,4S*,6R*)-(+/-)-2-(Butylsulfonyl)-N-[4-(propan-2-yloxy)phenyl]-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL572605 Elongation of very long chain fatty acids protein 6 Homo sapiens 120 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298971 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298971&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45482502 104140500 CHEMBL572605 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531660 CCCCS(=O)(=O)N1C[C@H]2CC[C@H]1[C@@H](C2)C(=O)Nc1ccc(OC(F)(F)F)cc1 |r,TLB:4:7:14.13:10.11,THB:15:13:8.7:10.11| 50298972 (1R*,4S*,6R*)-(+/-)-2-(Butylsulfonyl)-N-[4-(trifluoromethoxy)phenyl]-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL574936 Elongation of very long chain fatty acids protein 6 Homo sapiens 510 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298972 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298972&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45482515 104140501 CHEMBL574936 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531661 CCCCS(=O)(=O)N1C[C@H]2CC[C@H]1[C@@H](C2)C(=O)Nc1ccc(Oc2ccccc2)cc1 |r,TLB:4:7:14.13:10.11,THB:15:13:8.7:10.11| 50298973 (1R*,4S*,6R*)-(+/-)-2-(Butylsulfonyl)-N-(4-phenoxyphenyl)-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL574937 Elongation of very long chain fatty acids protein 6 Homo sapiens 710 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298973 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298973&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45482516 104140502 CHEMBL574937 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531662 CCCCS(=O)(=O)N1C[C@H]2CC[C@H]1[C@@H](C2)C(=O)Nc1ccc(OCc2ccccc2)cc1 |r,TLB:4:7:14.13:10.11,THB:15:13:8.7:10.11| 50298974 (1R*,4S*,6R*)-(+/-)-N-[4-(Benzyloxy)phenyl]-2-(butylsulfonyl)-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL575375 Elongation of very long chain fatty acids protein 6 Homo sapiens 2900 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298974 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298974&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45482520 104140503 CHEMBL575375 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531663 CCCCS(=O)(=O)N1C[C@H]2CC[C@H]1[C@@H](C2)C(=O)Nc1ccc(F)cc1 |r,TLB:4:7:14.13:10.11,THB:15:13:8.7:10.11| 50298975 (1R*,4S*,6R*)-(+/-)-2-(Butylsulfonyl)-N-(4-fluorophenyl)-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL573313 Elongation of very long chain fatty acids protein 6 Homo sapiens >10000 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298975 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298975&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45482539 104140504 CHEMBL573313 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531664 CCCCS(=O)(=O)N1C[C@H]2CC[C@H]1[C@@H](C2)C(=O)Nc1ccc(C)cc1 |r,TLB:4:7:14.13:10.11,THB:15:13:8.7:10.11| 50298976 (1R*,4S*,6R*)-(+/-)-2-(Butylsulfonyl)-N-(4-methylphenyl)-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL574478 Elongation of very long chain fatty acids protein 6 Homo sapiens 2300 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298976 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298976&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45482558 104140505 CHEMBL574478 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531665 CCCCS(=O)(=O)N1C[C@H]2CC[C@H]1[C@@H](C2)C(=O)Nc1ccc(cc1)C(F)(F)F |r,TLB:4:7:14.13:10.11,THB:15:13:8.7:10.11| 50298977 (1R*,4S*,6R*)-(+/-)-2-(Butylsulfonyl)-N-[4-(trifluoromethyl)phenyl]-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL573312 Elongation of very long chain fatty acids protein 6 Homo sapiens 1300 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298977 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298977&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45482583 104140506 CHEMBL573312 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531666 CCCCS(=O)(=O)N1C[C@H]2CC[C@H]1[C@@H](C2)C(=O)Nc1ccc(Cc2ccccc2)cc1 |r,TLB:4:7:14.13:10.11,THB:15:13:8.7:10.11| 50298978 (1R*,4S*,6R*)-(+/-)-N-(4-Benzylphenyl)-2-(butylsulfonyl)-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL578446 Elongation of very long chain fatty acids protein 6 Homo sapiens 830 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298978 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298978&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45482593 104140507 CHEMBL578446 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531667 CCCCS(=O)(=O)N1CCCC(C1)C(=O)Nc1ccc(OC(C)C)cc1 InChI=1S/C19H30N2O4S/c1-4-5-13-26(23,24)21-12-6-7-16(14-21)19(22)20-17-8-10-18(11-9-17)25-15(2)3/h8-11,15-16H,4-7,12-14H2,1-3H3,(H,20,22) HKAAZBSIFKNCPN-UHFFFAOYSA-N 50298979 (+/-)-1-(Butylsulfonyl)-N-[4-(propan-2-yloxy)phenyl]piperidine-3-carboxamide::CHEMBL572606 Elongation of very long chain fatty acids protein 6 Homo sapiens 930 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298979 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298979&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45482503 104140508 CHEMBL572606 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531668 CCCCS(=O)(=O)N1[C@H]2CC[C@@H]1[C@@H](CC2)C(=O)Nc1ccc(OC(C)C)cc1 |r,TLB:4:7:12.13.14:10.9,THB:15:12:7:10.9| 50298980 (1R*,2R*,5R*)-(+/-)-8-(Butylsulfonyl)-N-[4-(propan-2-yloxy)phenyl]-8-azabicyclo[3.2.1]octane-2-carboxamide::CHEMBL573078 Elongation of very long chain fatty acids protein 6 Homo sapiens 5950 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298980 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298980&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45482504 104140509 CHEMBL573078 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531669 CC(C)Oc1ccc(NC(=O)[C@@H]2C[C@@H]3CC[C@@H]2N(C3)S(C)(=O)=O)cc1 |r,TLB:9:11:18.17:14.15,THB:19:17:12.11:14.15| 50298981 (1R*,4S*,6R*)-(+/-)-2-(Methylsulfonyl)-N-[4-(propan-2-yloxy)phenyl]-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL575596 Elongation of very long chain fatty acids protein 6 Homo sapiens >10000 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298981 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298981&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45482521 104140510 CHEMBL575596 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531670 CCS(=O)(=O)N1C[C@H]2CC[C@H]1[C@@H](C2)C(=O)Nc1ccc(OC(C)C)cc1 |r,TLB:2:5:12.11:8.9,THB:13:11:6.5:8.9| 50298982 (1R*,4S*,6R*)-(+/-)-2-(Ethylsulfonyl)-N-[4-(propan-2-yloxy)phenyl]-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL573314 Elongation of very long chain fatty acids protein 6 Homo sapiens 2900 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298982 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298982&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45482540 104140511 CHEMBL573314 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531671 CCCS(=O)(=O)N1C[C@H]2CC[C@H]1[C@@H](C2)C(=O)Nc1ccc(OC(C)C)cc1 |r,TLB:3:6:13.12:9.10,THB:14:12:7.6:9.10| 50298983 (1R*,4S*,6R*)-(+/-)-N-[4-(Propan-2-yloxy)phenyl]-2-(propylsulfonyl)-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL575155 Elongation of very long chain fatty acids protein 6 Homo sapiens 210 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298983 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298983&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45482565 104140512 CHEMBL575155 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531672 CC(C)Oc1ccc(NC(=O)[C@@H]2C[C@@H]3CC[C@@H]2N(C3)S(=O)(=O)C(C)C)cc1 |r,TLB:9:11:18.17:14.15,THB:19:17:12.11:14.15| 50298984 (1R*,4S*,6R*)-(+/-)-N-[4-(Propan-2-yloxy)phenyl]-2-(propan-2-ylsulfonyl)-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL572608 Elongation of very long chain fatty acids protein 6 Homo sapiens 620 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298984 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298984&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45482578 104140513 CHEMBL572608 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531673 CC(C)Oc1ccc(NC(=O)[C@@H]2C[C@@H]3CC[C@@H]2N(C3)S(=O)(=O)c2ccccc2)cc1 |r,TLB:9:11:18.17:14.15,THB:19:17:12.11:14.15| 50298985 (1R*,4S*,6R*)-(+/-)-2-(Phenylsulfonyl)-N-[4-(propan-2-yloxy)phenyl]-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL573551 Elongation of very long chain fatty acids protein 6 Homo sapiens 70 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298985 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298985&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45482584 104140514 CHEMBL573551 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531674 COc1ccc(cc1)S(=O)(=O)N1C[C@H]2CC[C@H]1[C@@H](C2)C(=O)Nc1ccc(OC(C)C)cc1 |r,TLB:8:11:18.17:14.15,THB:19:17:12.11:14.15| 50298986 (1R*,4S*,6R*)-(+/-)-2-[(4-Methoxyphenyl)sulfonyl]-N-[4-(propan-2-yloxy)phenyl]-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL573079 Elongation of very long chain fatty acids protein 6 Homo sapiens 610 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298986 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298986&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45482505 104140515 CHEMBL573079 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531675 COc1cccc(c1)S(=O)(=O)N1C[C@H]2CC[C@H]1[C@@H](C2)C(=O)Nc1ccc(OC(C)C)cc1 |r,TLB:8:11:18.17:14.15,THB:19:17:12.11:14.15| 50298987 (1R*,4S*,6R*)-(+/-)-2-[(3-Methoxyphenyl)sulfonyl]-N-[4-(propan-2-yloxy)phenyl]-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL577360 Elongation of very long chain fatty acids protein 6 Homo sapiens 600 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298987 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298987&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45482506 104140516 CHEMBL577360 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531676 CC(C)Oc1ccc(NC(=O)[C@@H]2C[C@@H]3CC[C@@H]2N(C3)S(=O)(=O)c2ccc(cc2)C(F)(F)F)cc1 |r,TLB:9:11:18.17:14.15,THB:19:17:12.11:14.15| 50298988 (1R*,4S*,6R*)-(+/-)-N-[4-(Propan-2-yloxy)phenyl]-2-{[4-(trifluoromethyl)phenyl]sulfonyl}-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL573084 Elongation of very long chain fatty acids protein 6 Homo sapiens 3500 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298988 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298988&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45482582 104140517 CHEMBL573084 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531677 CC(C)Oc1ccc(NC(=O)[C@@H]2C[C@@H]3CC[C@@H]2N(C3)S(=O)(=O)c2ccc(cc2)C(C)(C)C)cc1 |r,TLB:9:11:18.17:14.15,THB:19:17:12.11:14.15| 50298989 (1R*,4S*,6R*)-(+/-)-2-[(4-tert-Butylphenyl)sulfonyl]-N-[4-(propan-2-yloxy)phenyl]-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL573547 Elongation of very long chain fatty acids protein 6 Homo sapiens >10000 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298989 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298989&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45482596 104140518 CHEMBL573547 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531678 CC(C)Oc1ccc(NC(=O)[C@@H]2C[C@@H]3CC[C@@H]2N(C3)S(=O)(=O)c2ccc(F)cc2)cc1 |r,TLB:9:11:18.17:14.15,THB:19:17:12.11:14.15| 50298990 (1R*,4S*,6R*)-(+/-)-2-[(4-Fluorophenyl)sulfonyl]-N-[4-(propan-2-yloxy)phenyl]-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL574029 Elongation of very long chain fatty acids protein 6 Homo sapiens 190 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298990 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298990&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45482511 104140519 CHEMBL574029 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531679 CC(C)Oc1ccc(NC(=O)[C@@H]2C[C@@H]3CC[C@@H]2N(C3)S(=O)(=O)c2cccc(F)c2)cc1 |r,TLB:9:11:18.17:14.15,THB:19:17:12.11:14.15| 50298991 (1R*,4S*,6R*)-(+/-)-2-[(3-Fluorophenyl)sulfonyl]-N-[4-(propan-2-yloxy)phenyl]-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL577160 Elongation of very long chain fatty acids protein 6 Homo sapiens 110 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298991 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298991&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45482512 104140520 CHEMBL577160 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531680 CC(C)Oc1ccc(NC(=O)[C@@H]2C[C@@H]3CC[C@@H]2N(C3)S(=O)(=O)c2ccccc2F)cc1 |r,TLB:9:11:18.17:14.15,THB:19:17:12.11:14.15| 50298992 (1R*,4S*,6R*)-(+/-)-2-[(2-Fluorophenyl)sulfonyl]-N-[4-(propan-2-yloxy)phenyl]-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL578037 Elongation of very long chain fatty acids protein 6 Homo sapiens 130 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298992 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298992&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45482543 104140521 CHEMBL578037 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531681 CC(C)Oc1ccc(NC(=O)[C@@H]2C[C@@H]3CC[C@@H]2N(C3)S(=O)(=O)c2cccs2)cc1 |r,TLB:9:11:18.17:14.15,THB:19:17:12.11:14.15| 50298993 (1R*,4S*,6R*)-(+/-)-N-[4-(Propan-2-yloxy)phenyl]-2-(thiophen-2-ylsulfonyl)-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL574479 Elongation of very long chain fatty acids protein 6 Homo sapiens 320 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298993 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298993&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45482559 104140522 CHEMBL574479 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50531682 CC(C)Oc1ccc(NC(=O)[C@@H]2C[C@@H]3CC[C@@H]2N(C3)S(=O)(=O)c2ccsc2)cc1 |r,TLB:9:11:18.17:14.15,THB:19:17:12.11:14.15| 50298994 (1R*,4S*,6R*)-(+/-)-N-[4-(Propan-2-yloxy)phenyl]-2-(thiophen-3-ylsulfonyl)-2-azabicyclo[2.2.2]octane-6-carboxamide::CHEMBL575156 Elongation of very long chain fatty acids protein 6 Homo sapiens 67 ChEMBL 10.1016/j.bmc.2009.06.042 10.7270/Q2WW7HQX 19596583 Sasaki, T; Nagase, T; Takahashi, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/21/2009 8/29/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50298994 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50298994&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45482566 104140523 CHEMBL575156 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1