BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50883411 FC(F)(F)c1ccc(NC(=O)N2[C@@H]3CC[C@@H]2CC(C3)S(=O)(=O)c2ccccn2)cc1 |r,THB:19:17:11:13.14| 50293789 3-endo-(Pyridin-2-ylsulfonyl)-N-[4-(trifluoromethyl)phenyl]-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL549545 Elongation of very long chain fatty acids protein 6 Mus musculus 30 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293789 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004047&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293789&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45272173 104135340 CHEMBL549545 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKVKKATKAE Very long chain fatty acid elongase 6 ELOV6_MOUSE Q920L5 Q8CE45 50883412 CC(C)c1ccc(NC(=O)N2[C@@H]3CC[C@@H]2CC(C3)S(=O)(=O)c2ccccc2)cc1 |r,THB:18:16:10:12.13| 50293790 N-(4-Isopropylphenyl)-3-endo-(phenylsulfonyl)-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL550828 Elongation of very long chain fatty acids protein 6 Homo sapiens 32 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293790 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293790&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45270446 104135341 CHEMBL550828 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50883413 CC(=Nc1ccc(cc1)C(C)(C)C)N1C2CCC1CC(C2)S(=O)(=O)c1ccccc1 |w:2.2,TLB:1:13:18.19.20:15.16,THB:21:19:13:15.16| 50378036 CHEMBL1163008 Elongation of very long chain fatty acids protein 6 Homo sapiens 78 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50378036 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50378036&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 91929946 160857119 CHEMBL1163008 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50883414 FC(F)(F)c1ccc(NC(=O)N2[C@@H]3CC[C@@H]2CC(C3)S(=O)(=O)c2ccccn2)cc1 |r,THB:19:17:11:13.14| 50293789 3-endo-(Pyridin-2-ylsulfonyl)-N-[4-(trifluoromethyl)phenyl]-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL549545 Elongation of very long chain fatty acids protein 6 Homo sapiens 79 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293789 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293789&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45272173 104135340 CHEMBL549545 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50883415 FC(F)(F)c1ccc(NC(=O)N2[C@@H]3CC[C@@H]2CC(C3)S(=O)(=O)c2ccccn2)cc1 |r,THB:19:17:11:13.14| 50293789 3-endo-(Pyridin-2-ylsulfonyl)-N-[4-(trifluoromethyl)phenyl]-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL549545 Elongation of very long chain fatty acids protein 6 Mus musculus 94 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293789 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004047&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293789&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45272173 104135340 CHEMBL549545 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKVKKATKAE Very long chain fatty acid elongase 6 ELOV6_MOUSE Q920L5 Q8CE45 50883416 FC(F)(F)c1ccc(NC(=O)N2[C@@H]3CC[C@@H]2CC(C3)S(=O)(=O)c2ccncc2)cc1 |r,THB:19:17:11:13.14| 50293792 3-endo-(Pyridin-4-ylsulfonyl)-N-[4-(trifluoromethyl)phenyl]-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL549947 Elongation of very long chain fatty acids protein 6 Homo sapiens 510 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293792 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293792&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45272181 104135343 CHEMBL549947 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50883417 FC(F)(F)c1ccc(NC(=O)N2[C@@H]3CC[C@@H]2CC(C3)S(=O)(=O)c2cccnc2)cc1 |r,THB:19:17:11:13.14| 50293793 3-endo-(Pyridin-3-ylsulfonyl)-N-[4-(trifluoromethyl)phenyl]-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL552037 Elongation of very long chain fatty acids protein 6 Homo sapiens 560 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293793 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293793&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45270455 104135344 CHEMBL552037 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50883418 FC(F)(F)c1ccc(NC(=O)N2[C@@H]3CC[C@@H]2CC(C3)S(=O)(=O)c2cccc(Cl)c2)cc1 |r,THB:19:17:11:13.14| 50293794 3-endo-[(3-Chlorophenyl)sulfonyl]-N-[4-(trifluoromethyl)phenyl]-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL564942 Elongation of very long chain fatty acids protein 6 Homo sapiens 600 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293794 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293794&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45268772 104135345 CHEMBL564942 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50883419 COc1cccc(c1)S(=O)(=O)C1C[C@H]2CC[C@H](C1)N2C(=O)Nc1ccc(cc1)C(F)(F)F |r,TLB:8:11:18:14.15| InChI=1S/C22H23F3N2O4S/c1-31-18-3-2-4-19(13-18)32(29,30)20-11-16-9-10-17(12-20)27(16)21(28)26-15-7-5-14(6-8-15)22(23,24)25/h2-8,13,16-17,20H,9-12H2,1H3,(H,26,28) FOSKYQNDWZIQJF-UHFFFAOYSA-N 50293795 3-endo-[(3-Methoxyphenyl)sulfonyl]-N-[4-(trifluoromethyl)phenyl]-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL564640 Elongation of very long chain fatty acids protein 6 Homo sapiens 840 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293795 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293795&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45268769 104135346 CHEMBL564640 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50883420 Clc1ccc(NC(=O)N2[C@@H]3CC[C@@H]2CC(C3)S(=O)(=O)c2ccccc2)cc1 |r,THB:16:14:8:10.11| 50293796 N-(4-Chlorophenyl)-3-endo-(phenylsulfonyl)-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL561155 Elongation of very long chain fatty acids protein 6 Homo sapiens 970 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293796 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293796&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45268753 104135347 CHEMBL561155 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50883421 FC(F)(F)c1cccc(NC(=O)N2[C@@H]3CC[C@@H]2CC(C3)S(=O)(=O)c2ccccc2)c1 |r,THB:20:18:12:14.15| 50293797 3-endo-(Phenylsulfonyl)-N-[3-(trifluoromethyl)phenyl]-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL561558 Elongation of very long chain fatty acids protein 6 Homo sapiens 1400 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293797 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293797&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45268758 104135348 CHEMBL561558 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50883422 Cc1ccc(NC(=O)N2[C@@H]3CC[C@@H]2CC(C3)S(=O)(=O)c2ccccc2)cc1 |r,THB:16:14:8:10.11| 50293798 N-(4-Methylphenyl)-3-endo-(phenylsulfonyl)-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL560023 Elongation of very long chain fatty acids protein 6 Homo sapiens 1750 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293798 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293798&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45269604 104135349 CHEMBL560023 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50883423 FC(F)(F)c1ccc(cc1)C(=O)N1[C@@H]2CC[C@@H]1CC(C2)S(=O)(=O)c1ccccc1 |r,THB:20:18:12:14.15| 50293799 [3-endo-(Phenylsulfonyl)-8-azabicyclo[3.2.1]oct-8-yl][4-(trifluoromethyl)phenyl]methanone::CHEMBL564891 Elongation of very long chain fatty acids protein 6 Homo sapiens 1750 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293799 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293799&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45271277 104135350 CHEMBL564891 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50883424 FC(F)(F)c1ccc(NC(=O)N2[C@@H]3CC[C@@H]2CC(C3)S(=O)(=O)c2ccc(Cl)cc2)cc1 |r,THB:19:17:11:13.14| 50293800 3-endo-[(4-Chlorophenyl)sulfonyl]-N-[4-(trifluoromethyl)phenyl]-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL563653 Elongation of very long chain fatty acids protein 6 Homo sapiens 2850 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293800 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293800&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45269619 104135351 CHEMBL563653 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50883425 FC(F)(F)c1ccc(NC(=O)N2[C@@H]3CC[C@@H]2CC(C3)S(=O)(=O)c2ccccc2Cl)cc1 |r,THB:19:17:11:13.14| 50293801 3-endo-[(2-Chlorophenyl)sulfonyl]-N-[4-(trifluoromethyl)phenyl]-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL563472 Elongation of very long chain fatty acids protein 6 Homo sapiens 3390 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293801 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293801&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45268770 104135352 CHEMBL563472 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50883426 COc1ccc(NC(=O)N2[C@@H]3CC[C@@H]2CC(C3)S(=O)(=O)c2ccccc2)cc1 |r,THB:17:15:9:11.12| 50293802 N-(4-Methoxyphenyl)-3-endo-(phenylsulfonyl)-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL550627 Elongation of very long chain fatty acids protein 6 Homo sapiens 5070 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293802 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293802&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45270445 104135353 CHEMBL550627 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50883427 COc1ccc(cc1)S(=O)(=O)C1C[C@H]2CC[C@H](C1)N2C(=O)Nc1ccc(cc1)C(F)(F)F |r,TLB:8:11:18:14.15| InChI=1S/C22H23F3N2O4S/c1-31-18-8-10-19(11-9-18)32(29,30)20-12-16-6-7-17(13-20)27(16)21(28)26-15-4-2-14(3-5-15)22(23,24)25/h2-5,8-11,16-17,20H,6-7,12-13H2,1H3,(H,26,28) HSJZHEYXOWMKGG-UHFFFAOYSA-N 50293803 3-endo-[(4-Methoxyphenyl)sulfonyl]-N-[4-(trifluoromethyl)phenyl]-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL549335 Elongation of very long chain fatty acids protein 6 Homo sapiens 5630 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293803 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293803&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45272170 104135354 CHEMBL549335 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50883428 FC(F)(F)c1ccc(NC(=O)N2[C@@H]3CC[C@@H]2CC(C3)S(=O)(=O)c2ccccn2)cc1 |r,THB:19:17:11:13.14| 50293789 3-endo-(Pyridin-2-ylsulfonyl)-N-[4-(trifluoromethyl)phenyl]-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL549545 Elongation of very long chain fatty acids protein 3 Homo sapiens 6940 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293789 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004294&target=Elongation+of+very+long+chain+fatty+acids+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293789&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+3&column=ki&startPg=0&Increment=50&submit=Search 45272173 104135340 CHEMBL549545 1 MVTAMNVSHEVNQLFQPYNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVFLLSKVIELGDTAFIILRKRPLIFIHWYHHSTVLVYTSFGYKNKVPAGGWFVTMNFGVHAIMYTYYTLKAANVKPPKMLPMLITSLQILQMFVGAIVSILTYIWRQDQGCHTTMEHLFWSFILYMTYFILFAHFFCQTYIRPKVKAKTKSQ Very long chain fatty acid elongase 3 ELOV3_HUMAN Q9HB03 Q5VZL3 Q8N180 50883429 COc1ccccc1S(=O)(=O)C1C[C@H]2CC[C@H](C1)N2C(=O)Nc1ccc(cc1)C(F)(F)F |r,TLB:8:11:18:14.15| InChI=1S/C22H23F3N2O4S/c1-31-19-4-2-3-5-20(19)32(29,30)18-12-16-10-11-17(13-18)27(16)21(28)26-15-8-6-14(7-9-15)22(23,24)25/h2-9,16-18H,10-13H2,1H3,(H,26,28) SDIPTSLQJNCKJQ-UHFFFAOYSA-N 50293804 3-endo-[(2-Methoxyphenyl)sulfonyl]-N-[4-(trifluoromethyl)phenyl]-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL563559 Elongation of very long chain fatty acids protein 6 Homo sapiens 7970 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293804 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293804&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45271281 104135355 CHEMBL563559 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50883430 FC(F)(F)c1ccc(NC(=O)N2[C@@H]3CC[C@@H]2CC(C3)S(=O)(=O)c2ccccn2)cc1 |r,THB:19:17:11:13.14| 50293789 3-endo-(Pyridin-2-ylsulfonyl)-N-[4-(trifluoromethyl)phenyl]-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL549545 Potassium voltage-gated channel subfamily H member 2 Homo sapiens >10000 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293789 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2132&target=Potassium+voltage-gated+channel+subfamily+H+member+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293789&enzyme=Potassium+voltage-gated+channel+subfamily+H+member+2&column=ki&startPg=0&Increment=50&submit=Search 45272173 104135340 CHEMBL549545 1 MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEKDMVGSPAHDTNHRGPPTSWLAPGRAKTFRLKLPALLALTARESSVRSGGAGGAGAPGAVVVDVDLTPAAPSSESLALDEVTAMDNHVAGLGPAEERRALVGPGSPPRSAPGQLPSPRAHSLNPDASGSSCSLARTRSRESCASVRRASSADDIEAMRAGVLPPPPRHASTGAMHPLRSGLLNSTSDSDLVRYRTISKIPQITLNFVDLKGDPFLASPTSDREIIAPKIKERTHNVTEKVTQVLSLGADVLPEYKLQAPRIHRWTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLKETEEGPPATECGYACQPLAVVDLIVDIMFIVDILINFRTTYVNANEEVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEELIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNMEQPHMDSRIGWLHNLGDQIGKPYNSSGLGGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLNRSLLQHCKPFRGATKGCLRALAMKFKTTHAPPGDTLVHAGDLLTALYFISRGSIEILRGDVVVAILGKNDIFGEPLNLYARPGKSNGDVRALTYCDLHKIHRDDLLEVLDMYPEFSDHFWSSLEITFNLRDTNMIPGSPGSTELEGGFSRQRKRKLSFRRRTDKDTEQPGEVSALGPGRAGAGPSSRGRPGGPWGESPSSGPSSPESSEDEGPGRSSSPLRLVPFSSPRPPGEPPGGEPLMEDCEKSSDTCNPLSGAFSGVSNIFSFWGDSRGRQYQELPRCPAPTPSLLNIPLSSPGRRPRGDVESRLDALQRQLNRLETRLSADMATVLQLLQRQMTLVPPAYSAVTTPGPGPTSTSPLLPVSPLPTLTLDSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS 8IOB,8IO5,8IO4,5VA2,8ZYQ,8ZYP,8ZYO,8ZYN,7CN1,7CN0,5VA1,9CHS,9CHR,9CHQ,9CHP,5VA3,2L4R,4HQA,2L0W,6SYG,2N7G Voltage-gated inwardly rectifying potassium channel KCNH2 KCNH2_HUMAN Q12809 A5H1P7 C4PFH9 D3DX04 O75418 O75680 Q708S9 Q9BT72 Q9BUT7 Q9H3P0 Voltage-gated inwardly rectifying potassium channel KCNH2 A0A090N8Q0_HUMAN A0A090N8Q0 50883431 FC(F)(F)c1ccc(NC(=O)N2[C@@H]3CC[C@@H]2CC(C3)S(=O)(=O)c2ccccn2)cc1 |r,THB:19:17:11:13.14| 50293789 3-endo-(Pyridin-2-ylsulfonyl)-N-[4-(trifluoromethyl)phenyl]-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL549545 Elongation of very long chain fatty acids protein 3 Mus musculus >1000 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293789 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004063&target=Elongation+of+very+long+chain+fatty+acids+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293789&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+3&column=ki&startPg=0&Increment=50&submit=Search 45272173 104135340 CHEMBL549545 1 MDTSMNFSRGLKMDLMQPYDFETFQDLRPFLEEYWVSSFLIVVVYLLLIVVGQTYMRTRKSFSLQRPLILWSFFLAIFSILGTLRMWKFMATVMFTVGLKQTVCFAIYTDDAVVRFWSFLFLLSKVVELGDTAFIILRKRPLIFVHWYHHSTVLLFTSFGYKNKVPSGGWFMTMNFGVHSVMYTYYTMKAAKLKHPNLLPMVITSLQILQMVLGTIFGILNYIWRQEKGCHTTTEHFFWSFMLYGTYFILFAHFFHRAYLRPKGKVASKSQ Very long chain fatty acid elongase 3 ELOV3_MOUSE O35949 50883432 O=C(Nc1ccccc1)N1[C@@H]2CC[C@@H]1CC(C2)S(=O)(=O)c1ccccc1 |r,THB:17:15:9:11.12| 50293805 N-Phenyl-3-endo-(phenylsulfonyl)-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL563279 Elongation of very long chain fatty acids protein 6 Homo sapiens >10000 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293805 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293805&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45273006 104135356 CHEMBL563279 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50883433 O=C(Nc1ccccn1)N1[C@@H]2CC[C@@H]1CC(C2)S(=O)(=O)c1ccccc1 |r,THB:17:15:9:11.12| 50293806 3-endo-(Phenylsulfonyl)-N-(pyridin-2-yl)-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL563337 Elongation of very long chain fatty acids protein 6 Homo sapiens >10000 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293806 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293806&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45268747 104135357 CHEMBL563337 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50883434 O=C(Nc1cccnc1)N1[C@@H]2CC[C@@H]1CC(C2)S(=O)(=O)c1ccccc1 |r,THB:17:15:9:11.12| 50293807 3-endo-(Phenylsulfonyl)-N-(pyridin-3-yl)-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL563208 Elongation of very long chain fatty acids protein 6 Homo sapiens >10000 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293807 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293807&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45271274 104135358 CHEMBL563208 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50883435 O=C(Nc1ccncc1)N1[C@@H]2CC[C@@H]1CC(C2)S(=O)(=O)c1ccccc1 |r,THB:17:15:9:11.12| 50293808 3-endo-(Phenylsulfonyl)-N-(pyridin-4-yl)-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL539435 Elongation of very long chain fatty acids protein 6 Homo sapiens >10000 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293808 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293808&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45270439 104135359 CHEMBL539435 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50883436 Fc1ccc(NC(=O)N2[C@@H]3CC[C@@H]2CC(C3)S(=O)(=O)c2ccccc2)cc1 |r,THB:16:14:8:10.11| 50293809 N-(4-Fluorophenyl)-3-endo-(phenylsulfonyl)-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL560232 Elongation of very long chain fatty acids protein 6 Homo sapiens >10000 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293809 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293809&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45267024 104135360 CHEMBL560232 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50883437 O=C(Nc1ccc(cc1)-c1ccccc1)N1[C@@H]2CC[C@@H]1CC(C2)S(=O)(=O)c1ccccc1 |r,THB:23:21:15:17.18| 50293810 N-(4-Biphenyl)-3-endo-(phenylsulfonyl)-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL563778 Elongation of very long chain fatty acids protein 6 Homo sapiens >10000 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293810 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293810&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45273009 104135361 CHEMBL563778 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50883438 FC(F)(F)c1ccccc1NC(=O)N1[C@@H]2CC[C@@H]1CC(C2)S(=O)(=O)c1ccccc1 |r,THB:21:19:13:15.16| 50293811 3-endo-(Phenylsulfonyl)-N-[2-(trifluoromethyl)phenyl]-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL549541 Elongation of very long chain fatty acids protein 6 Homo sapiens >10000 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293811 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293811&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45272167 104135362 CHEMBL549541 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50883439 FC(F)(F)c1ccc(CC(=O)N2[C@@H]3CC[C@@H]2CC(C3)S(=O)(=O)c2ccccc2)cc1 |r,THB:19:17:11:13.14| 50293812 1-[3-endo-(Phenylsulfonyl)-8-azabicyclo[3.2.1]oct-8-yl]-2-[4-(trifluoromethyl)phenyl]ethanone::CHEMBL562159 Elongation of very long chain fatty acids protein 6 Homo sapiens >10000 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293812 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293812&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45268762 104135363 CHEMBL562159 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50883440 FC(F)(F)c1ccc(NC(=O)N2[C@@H]3CC[C@@H]2CC(C3)S(=O)c2ccccc2)cc1 |r,THB:19:17:11:13.14| 50293813 3-endo-(Phenylsulfinyl)-N-[4-(trifluoromethyl)phenyl]-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL564167 Elongation of very long chain fatty acids protein 6 Homo sapiens >10000 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293813 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293813&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45268763 104135364 CHEMBL564167 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50883441 FC(F)(F)c1ccc(NC(=O)N2[C@@H]3CC[C@@H]2CC(C3)S(=O)(=O)c2ccccc2)cc1 |r,THB:19:17:11:13.14| 50293791 3-exo-(Phenylsulfonyl)-N-[4-(trifluoromethyl)phenyl]-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL560833 Elongation of very long chain fatty acids protein 6 Homo sapiens >10000 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293791 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293791&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 45266993 104135342 CHEMBL560833 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50883442 FC(F)(F)c1ccc(NC(=O)N2CCC(CC2)S(=O)(=O)c2ccccc2)cc1 InChI=1S/C19H19F3N2O3S/c20-19(21,22)14-6-8-15(9-7-14)23-18(25)24-12-10-17(11-13-24)28(26,27)16-4-2-1-3-5-16/h1-9,17H,10-13H2,(H,23,25) LZTPFCBJSVLNNR-UHFFFAOYSA-N 50293814 3-(Phenylsulfonyl)-N-[4-(trifluoromethyl)phenyl]piperidine-1-carboxamide::CHEMBL562160 Elongation of very long chain fatty acids protein 6 Homo sapiens >10000 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293814 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293814&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44190719 104135365 CHEMBL562160 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50883443 FC(F)(F)c1ccc(NC(=O)N2[C@@H]3CC[C@@H]2CC(C3)S(=O)(=O)c2ccccn2)cc1 |r,THB:19:17:11:13.14| 50293789 3-endo-(Pyridin-2-ylsulfonyl)-N-[4-(trifluoromethyl)phenyl]-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL549545 Elongation of very long chain fatty acids protein 1 Homo sapiens >10000 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293789 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004146&target=Elongation+of+very+long+chain+fatty+acids+protein+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293789&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+1&column=ki&startPg=0&Increment=50&submit=Search 45272173 104135340 CHEMBL549545 1 MEAVVNLYQEVMKHADPRIQGYPLMGSPLLMTSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYNFSLVALSLYIVYEFLMSGWLSTYTWRCDPVDYSNSPEALRMVRVAWLFLFSKFIELMDTVIFILRKKDGQVTFLHVFHHSVLPWSWWWGVKIAPGGMGSFHAMINSSVHVIMYLYYGLSAFGPVAQPYLWWKKHMTAIQLIQFVLVSLHISQYYFMSSCNYQYPVIIHLIWMYGTIFFMLFSNFWYHSYTKGKRLPRALQQNGAPGIAKVKAN Very long chain fatty acid elongase 1 ELOV1_HUMAN Q9BW60 B4DP24 Q53HT2 Q5JUY3 Q8WXU3 Q9NVD9 Q9Y396 50883444 FC(F)(F)c1ccc(NC(=O)N2[C@@H]3CC[C@@H]2CC(C3)S(=O)(=O)c2ccccn2)cc1 |r,THB:19:17:11:13.14| 50293789 3-endo-(Pyridin-2-ylsulfonyl)-N-[4-(trifluoromethyl)phenyl]-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL549545 Elongation of very long chain fatty acids protein 2 Homo sapiens >10000 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293789 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004345&target=Elongation+of+very+long+chain+fatty+acids+protein+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293789&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+2&column=ki&startPg=0&Increment=50&submit=Search 45272173 104135340 CHEMBL549545 1 MEHLKAFDDEINAFLDNMFGPRDSRVRGWFMLDSYLPTFFLTVMYLLSIWLGNKYMKNRPALSLRGILTLYNLGITLLSAYMLAELILSTWEGGYNLQCQDLTSAGEADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTSQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVFPSMHKYLWWKKYLTQAQLVQFVLTITHTMSAVVKPCGFPFGCLIFQSSYMLTLVILFLNFYVQTYRKKPMKKDMQEPPAGKEVKNGFSKAYFTAANGVMNKKAQ Very long chain fatty acid elongase 2 ELOV2_HUMAN Q9NXB9 Q6P9E1 Q86W94 50883445 FC(F)(F)c1ccc(NC(=O)N2[C@@H]3CC[C@@H]2CC(C3)S(=O)(=O)c2ccccn2)cc1 |r,THB:19:17:11:13.14| 50293789 3-endo-(Pyridin-2-ylsulfonyl)-N-[4-(trifluoromethyl)phenyl]-8-azabicyclo[3.2.1]octane-8-carboxamide::CHEMBL549545 Elongation of very long chain fatty acids protein 5 Homo sapiens >10000 ChEMBL 10.1021/jm900488k 10.7270/Q25D8SRQ 19522500 Nagase, T; Takahashi, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 7/16/2009 12/23/2012 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50293789 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004348&target=Elongation+of+very+long+chain+fatty+acids+protein+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50293789&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+5&column=ki&startPg=0&Increment=50&submit=Search 45272173 104135340 CHEMBL549545 1 MEHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPKYMRNKQPFSCRGILVVYNLGLTLLSLYMFCELVTGVWEGKYNFFCQGTRTAGESDMKIIRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYHHASMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSSVPSMRPYLWWKKYITQGQLLQFVLTIIQTSCGVIWPCTFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD Very long chain fatty acid elongase 5 ELOV5_HUMAN Q9NYP7 B4DZJ2 F6SH78 Q59EL3 Q5TGH5 Q6NXE7 Q7L2S5 Q8NCG4 Q9UI22