BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50458430 CCCN1C2=C(C(=O)CC(C)(C)C2)C(C1=O)(c1c(C)[nH]n(-c2ccccc2)c1=O)C(F)(F)F |t:4| InChI=1S/C24H26F3N3O3/c1-5-11-29-16-12-22(3,4)13-17(31)19(16)23(21(29)33,24(25,26)27)18-14(2)28-30(20(18)32)15-9-7-6-8-10-15/h6-10,28H,5,11-13H2,1-4H3 MTNQDFWIEBABOS-UHFFFAOYSA-N 50249560 6,6-dimethyl-3-(5-methyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-yl)-1-propyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL470730 Elongation of very long chain fatty acids protein 6 Homo sapiens 185 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249560 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249560&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 25027341 104103826 CHEMBL470730 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458431 CCN1C2=C(C(=O)CC(C)(C)C2)C(C1=O)(c1c(C)[nH]n(-c2ccccc2)c1=O)C(F)(F)F |t:3| InChI=1S/C23H24F3N3O3/c1-5-28-15-11-21(3,4)12-16(30)18(15)22(20(28)32,23(24,25)26)17-13(2)27-29(19(17)31)14-9-7-6-8-10-14/h6-10,27H,5,11-12H2,1-4H3 WRMRRJYVWNKAIL-UHFFFAOYSA-N 50249559 1-ethyl-6,6-dimethyl-3-(5-methyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-yl)-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL452144 Elongation of very long chain fatty acids protein 6 Homo sapiens 550 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249559 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249559&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 25027340 104103825 CHEMBL452144 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458432 CN1C2=C(C(=O)CC(C)(C)C2)C(C1=O)(c1c(C)[nH]n(-c2ccccc2)c1=O)C(F)(F)F |t:2| InChI=1S/C22H22F3N3O3/c1-12-16(18(30)28(26-12)13-8-6-5-7-9-13)21(22(23,24)25)17-14(27(4)19(21)31)10-20(2,3)11-15(17)29/h5-9,26H,10-11H2,1-4H3 CGGUJOHFSCOJKD-UHFFFAOYSA-N 50250166 1,6,6-trimethyl-3-(5-methyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-yl)-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL522448 Elongation of very long chain fatty acids protein 6 Homo sapiens 520 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50250166 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50250166&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 25027339 104104148 CHEMBL522448 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458433 Cc1[nH]n(-c2ccccc2)c(=O)c1C1(C(=O)NC2=C1C(=O)CC(C)(C)C2)C(F)(F)F |c:19| InChI=1S/C21H20F3N3O3/c1-11-15(17(29)27(26-11)12-7-5-4-6-8-12)20(21(22,23)24)16-13(25-18(20)30)9-19(2,3)10-14(16)28/h4-8,26H,9-10H2,1-3H3,(H,25,30) GJJXOFBOLFWQGV-UHFFFAOYSA-N 50250165 6,6-dimethyl-3-(5-methyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-yl)-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL523485 Elongation of very long chain fatty acids protein 6 Homo sapiens 1710 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50250165 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50250165&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44138816 104104147 CHEMBL523485 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458434 Cc1[nH]n(-c2ccccc2)c(=O)c1C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:19| InChI=1S/C27H24F3N3O3/c1-16-21(23(35)33(31-16)18-12-8-5-9-13-18)26(27(28,29)30)22-19(14-25(2,3)15-20(22)34)32(24(26)36)17-10-6-4-7-11-17/h4-13,31H,14-15H2,1-3H3 XNUIQJWHESYIAP-UHFFFAOYSA-N 50250164 6,6-dimethyl-3-(5-methyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-yl)-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL491537 Elongation of very long chain fatty acids protein 6 Homo sapiens 290 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50250164 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50250164&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 2962082 104104146 CHEMBL491537 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458435 CC(C)N1C2=C(C(=O)CC(C)(C)C2)C(C1=O)(c1c(C)[nH]n(-c2ccccc2)c1=O)C(F)(F)F |t:4| InChI=1S/C24H26F3N3O3/c1-13(2)29-16-11-22(4,5)12-17(31)19(16)23(21(29)33,24(25,26)27)18-14(3)28-30(20(18)32)15-9-7-6-8-10-15/h6-10,13,28H,11-12H2,1-5H3 CMZFNIGZPFYNRY-UHFFFAOYSA-N 50249561 1-isopropyl-6,6-dimethyl-3-(5-methyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-yl)-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL513730 Elongation of very long chain fatty acids protein 6 Homo sapiens 600 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249561 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249561&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44138943 104103827 CHEMBL513730 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458436 Cc1[nH]n(-c2ccccc2)c(=O)c1C1(C(=O)N(C2CC2)C2=C1C(=O)CC(C)(C)C2)C(F)(F)F |c:23| InChI=1S/C24H24F3N3O3/c1-13-18(20(32)30(28-13)15-7-5-4-6-8-15)23(24(25,26)27)19-16(11-22(2,3)12-17(19)31)29(21(23)33)14-9-10-14/h4-8,14,28H,9-12H2,1-3H3 NPGRQAWXQPOZLD-UHFFFAOYSA-N 50249562 1-cyclopropyl-6,6-dimethyl-3-(5-methyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-yl)-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL470918 Elongation of very long chain fatty acids protein 6 Homo sapiens 144 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249562 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249562&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44138944 104103828 CHEMBL470918 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458437 Cc1[nH]n(-c2ccccc2)c(=O)c1C1(C(=O)N(C2CCC2)C2=C1C(=O)CC(C)(C)C2)C(F)(F)F |c:24| InChI=1S/C25H26F3N3O3/c1-14-19(21(33)31(29-14)16-8-5-4-6-9-16)24(25(26,27)28)20-17(12-23(2,3)13-18(20)32)30(22(24)34)15-10-7-11-15/h4-6,8-9,15,29H,7,10-13H2,1-3H3 QQOJWKYNRIHJHJ-UHFFFAOYSA-N 50249614 1-cyclobutyl-6,6-dimethyl-3-(5-methyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-yl)-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL474835 Elongation of very long chain fatty acids protein 6 Homo sapiens 271 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249614 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249614&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44138945 104103844 CHEMBL474835 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458438 Cc1[nH]n(-c2ccccc2)c(=O)c1C1(C(=O)N(C2CCCC2)C2=C1C(=O)CC(C)(C)C2)C(F)(F)F |c:25| InChI=1S/C26H28F3N3O3/c1-15-20(22(34)32(30-15)17-11-5-4-6-12-17)25(26(27,28)29)21-18(13-24(2,3)14-19(21)33)31(23(25)35)16-9-7-8-10-16/h4-6,11-12,16,30H,7-10,13-14H2,1-3H3 LZKNKGJVMIBSLT-UHFFFAOYSA-N 50250163 1-cyclopentyl-6,6-dimethyl-3-(5-methyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-yl)-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL491371 Elongation of very long chain fatty acids protein 6 Homo sapiens 411 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50250163 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50250163&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44138946 104104145 CHEMBL491371 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458439 Cc1[nH]n(-c2ccccc2)c(=O)c1C1(C(=O)N(C2CCCCC2)C2=C1C(=O)CC(C)(C)C2)C(F)(F)F |c:26| InChI=1S/C27H30F3N3O3/c1-16-21(23(35)33(31-16)18-12-8-5-9-13-18)26(27(28,29)30)22-19(14-25(2,3)15-20(22)34)32(24(26)36)17-10-6-4-7-11-17/h5,8-9,12-13,17,31H,4,6-7,10-11,14-15H2,1-3H3 QQMPSNBXVVTBPN-UHFFFAOYSA-N 50249641 1-cyclohexyl-6,6-dimethyl-3-(5-methyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-yl)-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL490746 Elongation of very long chain fatty acids protein 6 Homo sapiens 210 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249641 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249641&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44138947 104103869 CHEMBL490746 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458440 Cc1[nH]n(-c2ccccc2)c(=O)c1C1(C(=O)N(Cc2ccccc2)C2=C1C(=O)CC(C)(C)C2)C(F)(F)F |c:27| InChI=1S/C28H26F3N3O3/c1-17-22(24(36)34(32-17)19-12-8-5-9-13-19)27(28(29,30)31)23-20(14-26(2,3)15-21(23)35)33(25(27)37)16-18-10-6-4-7-11-18/h4-13,32H,14-16H2,1-3H3 GKBZOXSFCMQPIU-UHFFFAOYSA-N 50249642 1-benzyl-6,6-dimethyl-3-(5-methyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-yl)-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL490747 Elongation of very long chain fatty acids protein 6 Homo sapiens 879 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249642 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249642&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 5200029 104103870 CHEMBL490747 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458441 COc1ccccc1N1C2=C(C(=O)CC(C)(C)C2)C(C1=O)(c1c(C)[nH]n(-c2ccccc2)c1=O)C(F)(F)F |t:10| InChI=1S/C28H26F3N3O4/c1-16-22(24(36)34(32-16)17-10-6-5-7-11-17)27(28(29,30)31)23-19(14-26(2,3)15-20(23)35)33(25(27)37)18-12-8-9-13-21(18)38-4/h5-13,32H,14-15H2,1-4H3 BKQARKHNCKFGHO-UHFFFAOYSA-N 50249643 1-(2-methoxyphenyl)-6,6-dimethyl-3-(5-methyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-yl)-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL524130 Elongation of very long chain fatty acids protein 6 Homo sapiens 6340 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249643 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249643&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44139075 104103871 CHEMBL524130 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458442 COc1cccc(c1)N1C2=C(C(=O)CC(C)(C)C2)C(C1=O)(c1c(C)[nH]n(-c2ccccc2)c1=O)C(F)(F)F |t:10| InChI=1S/C28H26F3N3O4/c1-16-22(24(36)34(32-16)17-9-6-5-7-10-17)27(28(29,30)31)23-20(14-26(2,3)15-21(23)35)33(25(27)37)18-11-8-12-19(13-18)38-4/h5-13,32H,14-15H2,1-4H3 OISFZXUCAHBWGA-UHFFFAOYSA-N 50249665 1-(3-methoxyphenyl)-6,6-dimethyl-3-(5-methyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-yl)-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL489920 Elongation of very long chain fatty acids protein 6 Homo sapiens 226 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249665 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249665&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 25030793 104103883 CHEMBL489920 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458443 COc1ccc(cc1)N1C2=C(C(=O)CC(C)(C)C2)C(C1=O)(c1c(C)[nH]n(-c2ccccc2)c1=O)C(F)(F)F |t:10| InChI=1S/C28H26F3N3O4/c1-16-22(24(36)34(32-16)18-8-6-5-7-9-18)27(28(29,30)31)23-20(14-26(2,3)15-21(23)35)33(25(27)37)17-10-12-19(38-4)13-11-17/h5-13,32H,14-15H2,1-4H3 SIONQJFIRLZVBE-UHFFFAOYSA-N 50249666 1-(4-methoxyphenyl)-6,6-dimethyl-3-(5-methyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-yl)-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL521776 Elongation of very long chain fatty acids protein 6 Homo sapiens 566 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249666 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249666&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 3937173 104103884 CHEMBL521776 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458444 Cc1[nH]n(-c2ccccc2)c(=O)c1C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1Cl)C(F)(F)F |c:19| InChI=1S/C27H23ClF3N3O3/c1-15-21(23(36)34(32-15)16-9-5-4-6-10-16)26(27(29,30)31)22-19(13-25(2,3)14-20(22)35)33(24(26)37)18-12-8-7-11-17(18)28/h4-12,32H,13-14H2,1-3H3 OWACOCJGOCRHEK-UHFFFAOYSA-N 50249667 1-(2-chlorophenyl)-6,6-dimethyl-3-(5-methyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-yl)-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL490762 Elongation of very long chain fatty acids protein 6 Homo sapiens 6520 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249667 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249667&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44139076 104103885 CHEMBL490762 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458445 Cc1[nH]n(-c2ccccc2)c(=O)c1C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1cccc(Cl)c1)C(F)(F)F |c:19| InChI=1S/C27H23ClF3N3O3/c1-15-21(23(36)34(32-15)17-9-5-4-6-10-17)26(27(29,30)31)22-19(13-25(2,3)14-20(22)35)33(24(26)37)18-11-7-8-16(28)12-18/h4-12,32H,13-14H2,1-3H3 CQENTNJXTSZYFA-UHFFFAOYSA-N 50249711 1-(3-chlorophenyl)-6,6-dimethyl-3-(5-methyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-yl)-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL491125 Elongation of very long chain fatty acids protein 6 Homo sapiens 245 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249711 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249711&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 22332738 104103920 CHEMBL491125 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458446 Cc1[nH]n(-c2ccccc2)c(=O)c1C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccc(Cl)cc1)C(F)(F)F |c:19| InChI=1S/C27H23ClF3N3O3/c1-15-21(23(36)34(32-15)18-7-5-4-6-8-18)26(27(29,30)31)22-19(13-25(2,3)14-20(22)35)33(24(26)37)17-11-9-16(28)10-12-17/h4-12,32H,13-14H2,1-3H3 PKXRVSAGLULXTB-UHFFFAOYSA-N 50249712 1-(4-chlorophenyl)-6,6-dimethyl-3-(5-methyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-yl)-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL521763 Elongation of very long chain fatty acids protein 6 Homo sapiens 603 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249712 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249712&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 25030792 104103921 CHEMBL521763 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458447 CCc1[nH]n(-c2ccccc2)c(=O)c1C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:20| InChI=1S/C28H26F3N3O3/c1-4-19-22(24(36)34(32-19)18-13-9-6-10-14-18)27(28(29,30)31)23-20(15-26(2,3)16-21(23)35)33(25(27)37)17-11-7-5-8-12-17/h5-14,32H,4,15-16H2,1-3H3 CWKSSAUPQAOVRF-UHFFFAOYSA-N 50249713 3-(5-ethyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-yl)-6,6-dimethyl-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL491131 Elongation of very long chain fatty acids protein 6 Homo sapiens 99 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249713 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249713&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44139189 104103922 CHEMBL491131 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458448 CC(C)c1[nH]n(-c2ccccc2)c(=O)c1C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:21| InChI=1S/C29H28F3N3O3/c1-17(2)24-23(25(37)35(33-24)19-13-9-6-10-14-19)28(29(30,31)32)22-20(15-27(3,4)16-21(22)36)34(26(28)38)18-11-7-5-8-12-18/h5-14,17,33H,15-16H2,1-4H3 IBAZJLFDEONECU-UHFFFAOYSA-N 50249745 3-(5-isopropyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-yl)-6,6-dimethyl-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL490725 Elongation of very long chain fatty acids protein 6 Homo sapiens >10000 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249745 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249745&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44139190 104103929 CHEMBL490725 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458449 Cc1[nH]n(-c2ccccc2)c(=O)c1C1(C(=O)N(C2=C1C(=O)CCC2)c1ccccc1)C(F)(F)F |c:19| InChI=1S/C25H20F3N3O3/c1-15-20(22(33)31(29-15)17-11-6-3-7-12-17)24(25(26,27)28)21-18(13-8-14-19(21)32)30(23(24)34)16-9-4-2-5-10-16/h2-7,9-12,29H,8,13-14H2,1H3 GEWALNYMQCWWGO-UHFFFAOYSA-N 50249746 3-(5-methyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-yl)-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL491717 Elongation of very long chain fatty acids protein 6 Homo sapiens 4500 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249746 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249746&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44139191 104103930 CHEMBL491717 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458450 CC1CC2=C(C(=O)C1)C(C(=O)N2c1ccccc1)(c1c(C)[nH]n(-c2ccccc2)c1=O)C(F)(F)F |c:3| InChI=1S/C26H22F3N3O3/c1-15-13-19-22(20(33)14-15)25(26(27,28)29,24(35)31(19)17-9-5-3-6-10-17)21-16(2)30-32(23(21)34)18-11-7-4-8-12-18/h3-12,15,30H,13-14H2,1-2H3 RGIHNCPDOQLMPX-UHFFFAOYSA-N 50249747 6-methyl-3-(5-methyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-yl)-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL522979 Elongation of very long chain fatty acids protein 6 Homo sapiens 704 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249747 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249747&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44139192 104103931 CHEMBL522979 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458451 Cc1[nH]n(-c2ccccc2)c(=O)c1C1(C(=O)N(C2=C1C(=O)CC(C2)c1ccccc1)c1ccccc1)C(F)(F)F |c:19| InChI=1S/C31H24F3N3O3/c1-19-26(28(39)37(35-19)23-15-9-4-10-16-23)30(31(32,33)34)27-24(36(29(30)40)22-13-7-3-8-14-22)17-21(18-25(27)38)20-11-5-2-6-12-20/h2-16,21,35H,17-18H2,1H3 YBQPNKMVIPFDRM-UHFFFAOYSA-N 50249748 3-(5-methyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-yl)-1,6-diphenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL524000 Elongation of very long chain fatty acids protein 6 Homo sapiens 6260 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249748 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249748&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44139193 104103932 CHEMBL524000 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458452 Cc1[nH]n(-c2ccccc2)c(=O)c1C1(C(=O)N(C2=C1C(=O)CC1(CCC1)C2)c1ccccc1)C(F)(F)F |c:19| InChI=1S/C28H24F3N3O3/c1-17-22(24(36)34(32-17)19-11-6-3-7-12-19)27(28(29,30)31)23-20(15-26(13-8-14-26)16-21(23)35)33(25(27)37)18-9-4-2-5-10-18/h2-7,9-12,32H,8,13-16H2,1H3 DVUAYTZAKOHYQP-UHFFFAOYSA-N 50249764 3'-(5-methyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-yl)-1'-phenyl-3'-(trifluoromethyl)-3',7'-dihydrospiro[cyclobutane-1,6'-indole]-2',4'(1'H,5'H)-dione::CHEMBL523990 Elongation of very long chain fatty acids protein 6 Homo sapiens 123 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249764 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249764&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44139318 104103940 CHEMBL523990 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458453 Cc1[nH]n(C)c(=O)c1C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:13| InChI=1S/C22H22F3N3O3/c1-12-16(18(30)27(4)26-12)21(22(23,24)25)17-14(10-20(2,3)11-15(17)29)28(19(21)31)13-8-6-5-7-9-13/h5-9,26H,10-11H2,1-4H3 YLMMXWDOGKRQHK-UHFFFAOYSA-N 50249765 3-(2,5-dimethyl-3-oxo-2,3-dihydro-1H-pyrazol-4-yl)-6,6-dimethyl-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL491901 Elongation of very long chain fatty acids protein 6 Homo sapiens 2020 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249765 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249765&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44139319 104103941 CHEMBL491901 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458454 CC(C)n1[nH]c(C)c(c1=O)C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:15| InChI=1S/C24H26F3N3O3/c1-13(2)30-20(32)18(14(3)28-30)23(24(25,26)27)19-16(11-22(4,5)12-17(19)31)29(21(23)33)15-9-7-6-8-10-15/h6-10,13,28H,11-12H2,1-5H3 QLFRHAHRESFSML-UHFFFAOYSA-N 50249766 3-(2-isopropyl-5-methyl-3-oxo-2,3-dihydro-1H-pyrazol-4-yl)-6,6-dimethyl-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL492078 Elongation of very long chain fatty acids protein 6 Homo sapiens >10000 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249766 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249766&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44139320 104103942 CHEMBL492078 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458455 Cc1[nH]n(C2CCCCC2)c(=O)c1C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:19| InChI=1S/C27H30F3N3O3/c1-16-21(23(35)33(31-16)18-12-8-5-9-13-18)26(27(28,29)30)22-19(14-25(2,3)15-20(22)34)32(24(26)36)17-10-6-4-7-11-17/h4,6-7,10-11,18,31H,5,8-9,12-15H2,1-3H3 GLWAVOGIWXMVAM-UHFFFAOYSA-N 50249767 3-(2-cyclohexyl-5-methyl-3-oxo-2,3-dihydro-1H-pyrazol-4-yl)-6,6-dimethyl-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL492079 Elongation of very long chain fatty acids protein 6 Homo sapiens >10000 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249767 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249767&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44139321 104103943 CHEMBL492079 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458456 Cc1[nH]n(-c2ccccc2Cl)c(=O)c1C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:20| InChI=1S/C27H23ClF3N3O3/c1-15-21(23(36)34(32-15)18-12-8-7-11-17(18)28)26(27(29,30)31)22-19(13-25(2,3)14-20(22)35)33(24(26)37)16-9-5-4-6-10-16/h4-12,32H,13-14H2,1-3H3 TWRVFLWRJAIASR-UHFFFAOYSA-N 50249789 3-[2-(2-chlorophenyl)-5-methyl-3-oxo-2,3-dihydro-1H-pyrazol-4-yl]-6,6-dimethyl-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL521630 Elongation of very long chain fatty acids protein 6 Homo sapiens 4330 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249789 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249789&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44139322 104103955 CHEMBL521630 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458457 Cc1[nH]n(-c2cccc(Cl)c2)c(=O)c1C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:20| InChI=1S/C27H23ClF3N3O3/c1-15-21(23(36)34(32-15)18-11-7-8-16(28)12-18)26(27(29,30)31)22-19(13-25(2,3)14-20(22)35)33(24(26)37)17-9-5-4-6-10-17/h4-12,32H,13-14H2,1-3H3 PHWCUTHHXRDTFZ-UHFFFAOYSA-N 50249790 3-[2-(3-chlorophenyl)-5-methyl-3-oxo-2,3-dihydro-1H-pyrazol-4-yl]-6,6-dimethyl-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL491921 Elongation of very long chain fatty acids protein 6 Homo sapiens 44 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249790 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249790&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44139439 104103956 CHEMBL491921 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458458 Cc1[nH]n(-c2ccc(Cl)cc2)c(=O)c1C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:20| InChI=1S/C27H23ClF3N3O3/c1-15-21(23(36)34(32-15)18-11-9-16(28)10-12-18)26(27(29,30)31)22-19(13-25(2,3)14-20(22)35)33(24(26)37)17-7-5-4-6-8-17/h4-12,32H,13-14H2,1-3H3 KNYRXFMLHDQTLC-UHFFFAOYSA-N 50249791 3-[2-(4-chlorophenyl)-5-methyl-3-oxo-2,3-dihydro-1H-pyrazol-4-yl]-6,6-dimethyl-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL490750 Elongation of very long chain fatty acids protein 6 Homo sapiens 12 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249791 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249791&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 24970320 104103957 CHEMBL490750 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458459 COc1ccccc1-n1[nH]c(C)c(c1=O)C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:21| InChI=1S/C28H26F3N3O4/c1-16-22(24(36)34(32-16)18-12-8-9-13-21(18)38-4)27(28(29,30)31)23-19(14-26(2,3)15-20(23)35)33(25(27)37)17-10-6-5-7-11-17/h5-13,32H,14-15H2,1-4H3 KMISXYLTKZSCGX-UHFFFAOYSA-N 50249813 3-[2-(2-methoxyphenyl)-5-methyl-3-oxo-2,3-dihydro-1H-pyrazol-4-yl]-6,6-dimethyl-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL490760 Elongation of very long chain fatty acids protein 6 Homo sapiens 58 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249813 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249813&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44139440 104103965 CHEMBL490760 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458460 COc1cccc(c1)-n1[nH]c(C)c(c1=O)C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:21| InChI=1S/C28H26F3N3O4/c1-16-22(24(36)34(32-16)18-11-8-12-19(13-18)38-4)27(28(29,30)31)23-20(14-26(2,3)15-21(23)35)33(25(27)37)17-9-6-5-7-10-17/h5-13,32H,14-15H2,1-4H3 FIJNXDIXLMBYHK-UHFFFAOYSA-N 50249814 3-[2-(3-methoxyphenyl)-5-methyl-3-oxo-2,3-dihydro-1H-pyrazol-4-yl]-6,6-dimethyl-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL521775 Elongation of very long chain fatty acids protein 6 Homo sapiens 43 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249814 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249814&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44139441 104103966 CHEMBL521775 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458461 COc1ccc(cc1)-n1[nH]c(C)c(c1=O)C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:21| InChI=1S/C28H26F3N3O4/c1-16-22(24(36)34(32-16)18-10-12-19(38-4)13-11-18)27(28(29,30)31)23-20(14-26(2,3)15-21(23)35)33(25(27)37)17-8-6-5-7-9-17/h5-13,32H,14-15H2,1-4H3 HRALEUPTUFQWEC-UHFFFAOYSA-N 50249815 3-[2-(4-methoxyphenyl)-5-methyl-3-oxo-2,3-dihydro-1H-pyrazol-4-yl]-6,6-dimethyl-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL491944 Elongation of very long chain fatty acids protein 6 Homo sapiens 17 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249815 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249815&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44139442 104103967 CHEMBL491944 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458462 Cc1[nH]n(-c2ccc(F)cc2)c(=O)c1C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:20| InChI=1S/C27H23F4N3O3/c1-15-21(23(36)34(32-15)18-11-9-16(28)10-12-18)26(27(29,30)31)22-19(13-25(2,3)14-20(22)35)33(24(26)37)17-7-5-4-6-8-17/h4-12,32H,13-14H2,1-3H3 REJJVGPYBBJSFS-UHFFFAOYSA-N 50249842 3-[2-(4-fluorophenyl)-5-methyl-3-oxo-2,3-dihydro-1H-pyrazol-4-yl]-6,6-dimethyl-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL491948 Elongation of very long chain fatty acids protein 6 Homo sapiens 44 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249842 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249842&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44139443 104103976 CHEMBL491948 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458463 Cc1[nH]n(-c2ccc(cc2)C#N)c(=O)c1C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:21| InChI=1S/C28H23F3N4O3/c1-16-22(24(37)35(33-16)19-11-9-17(15-32)10-12-19)27(28(29,30)31)23-20(13-26(2,3)14-21(23)36)34(25(27)38)18-7-5-4-6-8-18/h4-12,33H,13-14H2,1-3H3 WQJOSKIUUNBYRH-UHFFFAOYSA-N 50249843 3-[2-(4-cyanophenyl)-5-methyl-3-oxo-2,3-dihydro-1H-pyrazol-4-yl]-6,6-dimethyl-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL491949 Elongation of very long chain fatty acids protein 6 Homo sapiens 14 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249843 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249843&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44139564 104103977 CHEMBL491949 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458464 CC(C)c1ccc(cc1)-n1[nH]c(C)c(c1=O)C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:22| InChI=1S/C30H30F3N3O3/c1-17(2)19-11-13-21(14-12-19)36-26(38)24(18(3)34-36)29(30(31,32)33)25-22(15-28(4,5)16-23(25)37)35(27(29)39)20-9-7-6-8-10-20/h6-14,17,34H,15-16H2,1-5H3 UWWUSSGYXCFNCE-UHFFFAOYSA-N 50249844 3-[2-(4-isopropylphenyl)-5-methyl-3-oxo-2,3-dihydro-1H-pyrazol-4-yl]-6,6-dimethyl-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL493642 Elongation of very long chain fatty acids protein 6 Homo sapiens 10 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249844 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249844&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44139565 104103978 CHEMBL493642 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458465 Cc1[nH]n(-c2ccc(C)cc2)c(=O)c1C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:20| InChI=1S/C28H26F3N3O3/c1-16-10-12-19(13-11-16)34-24(36)22(17(2)32-34)27(28(29,30)31)23-20(14-26(3,4)15-21(23)35)33(25(27)37)18-8-6-5-7-9-18/h5-13,32H,14-15H2,1-4H3 CNOFNQCCSDASTB-UHFFFAOYSA-N 50249891 3-[2-(4-methyllphenyl)-5-methyl-3-oxo-2,3-dihydro-1H-pyrazol-4-yl]-6,6-dimethyl-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL490110 Elongation of very long chain fatty acids protein 6 Homo sapiens 8.7 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249891 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249891&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44139566 104104002 CHEMBL490110 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458466 Cc1[nH]n(-c2ccc(OC(F)(F)F)cc2)c(=O)c1C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:24| InChI=1S/C28H23F6N3O4/c1-15-21(23(39)37(35-15)17-9-11-18(12-10-17)41-28(32,33)34)26(27(29,30)31)22-19(13-25(2,3)14-20(22)38)36(24(26)40)16-7-5-4-6-8-16/h4-12,35H,13-14H2,1-3H3 XLEVMSDNWOWFNX-UHFFFAOYSA-N 50249892 6,6-dimethyl-3-{5-methyl-3-oxo-2-[4-(trifluoromethoxy)phenyl]-2,3-dihydro-1H-pyrazol-4-yl}-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL449121 Elongation of very long chain fatty acids protein 6 Homo sapiens 8.9 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249892 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249892&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44139567 104104003 CHEMBL449121 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458467 Cc1[nH]n(-c2ccc(Oc3ccccc3)cc2)c(=O)c1C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:27| InChI=1S/C33H28F3N3O4/c1-20-27(29(41)39(37-20)22-14-16-24(17-15-22)43-23-12-8-5-9-13-23)32(33(34,35)36)28-25(18-31(2,3)19-26(28)40)38(30(32)42)21-10-6-4-7-11-21/h4-17,37H,18-19H2,1-3H3 OAWGHDMXHHNCLN-UHFFFAOYSA-N 50249893 6,6-dimethyl-3-[5-methyl-3-oxo-2-(4-phenoxyphenyl)-2,3-dihydro-1H-pyrazol-4-yl]-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL447672 Elongation of very long chain fatty acids protein 6 Homo sapiens 196 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249893 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004249&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249893&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44139568 104104004 CHEMBL447672 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE Very long chain fatty acid elongase 6 ELOV6_HUMAN Q9H5J4 Q4W5L0 Q8NCD1 50458468 Cc1[nH]n(-c2ccccc2)c(=O)c1C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:19| InChI=1S/C27H24F3N3O3/c1-16-21(23(35)33(31-16)18-12-8-5-9-13-18)26(27(28,29)30)22-19(14-25(2,3)15-20(22)34)32(24(26)36)17-10-6-4-7-11-17/h4-13,31H,14-15H2,1-3H3 XNUIQJWHESYIAP-UHFFFAOYSA-N 50250164 6,6-dimethyl-3-(5-methyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-yl)-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL491537 Elongation of very long chain fatty acids protein 3 Homo sapiens >10 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50250164 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004294&target=Elongation+of+very+long+chain+fatty+acids+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50250164&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+3&column=ki&startPg=0&Increment=50&submit=Search 2962082 104104146 CHEMBL491537 1 MVTAMNVSHEVNQLFQPYNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVFLLSKVIELGDTAFIILRKRPLIFIHWYHHSTVLVYTSFGYKNKVPAGGWFVTMNFGVHAIMYTYYTLKAANVKPPKMLPMLITSLQILQMFVGAIVSILTYIWRQDQGCHTTMEHLFWSFILYMTYFILFAHFFCQTYIRPKVKAKTKSQ Very long chain fatty acid elongase 3 ELOV3_HUMAN Q9HB03 Q5VZL3 Q8N180 50458469 Cc1[nH]n(-c2ccc(Cl)cc2)c(=O)c1C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:20| InChI=1S/C27H23ClF3N3O3/c1-15-21(23(36)34(32-15)18-11-9-16(28)10-12-18)26(27(29,30)31)22-19(13-25(2,3)14-20(22)35)33(24(26)37)17-7-5-4-6-8-17/h4-12,32H,13-14H2,1-3H3 KNYRXFMLHDQTLC-UHFFFAOYSA-N 50249791 3-[2-(4-chlorophenyl)-5-methyl-3-oxo-2,3-dihydro-1H-pyrazol-4-yl]-6,6-dimethyl-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL490750 Elongation of very long chain fatty acids protein 3 Homo sapiens 221 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249791 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004294&target=Elongation+of+very+long+chain+fatty+acids+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249791&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+3&column=ki&startPg=0&Increment=50&submit=Search 24970320 104103957 CHEMBL490750 1 MVTAMNVSHEVNQLFQPYNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVFLLSKVIELGDTAFIILRKRPLIFIHWYHHSTVLVYTSFGYKNKVPAGGWFVTMNFGVHAIMYTYYTLKAANVKPPKMLPMLITSLQILQMFVGAIVSILTYIWRQDQGCHTTMEHLFWSFILYMTYFILFAHFFCQTYIRPKVKAKTKSQ Very long chain fatty acid elongase 3 ELOV3_HUMAN Q9HB03 Q5VZL3 Q8N180 50458470 COc1ccc(cc1)-n1[nH]c(C)c(c1=O)C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:21| InChI=1S/C28H26F3N3O4/c1-16-22(24(36)34(32-16)18-10-12-19(38-4)13-11-18)27(28(29,30)31)23-20(14-26(2,3)15-21(23)35)33(25(27)37)17-8-6-5-7-9-17/h5-13,32H,14-15H2,1-4H3 HRALEUPTUFQWEC-UHFFFAOYSA-N 50249815 3-[2-(4-methoxyphenyl)-5-methyl-3-oxo-2,3-dihydro-1H-pyrazol-4-yl]-6,6-dimethyl-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL491944 Elongation of very long chain fatty acids protein 3 Homo sapiens 503 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249815 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004294&target=Elongation+of+very+long+chain+fatty+acids+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249815&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+3&column=ki&startPg=0&Increment=50&submit=Search 44139442 104103967 CHEMBL491944 1 MVTAMNVSHEVNQLFQPYNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVFLLSKVIELGDTAFIILRKRPLIFIHWYHHSTVLVYTSFGYKNKVPAGGWFVTMNFGVHAIMYTYYTLKAANVKPPKMLPMLITSLQILQMFVGAIVSILTYIWRQDQGCHTTMEHLFWSFILYMTYFILFAHFFCQTYIRPKVKAKTKSQ Very long chain fatty acid elongase 3 ELOV3_HUMAN Q9HB03 Q5VZL3 Q8N180 50458471 Cc1[nH]n(-c2ccc(cc2)C#N)c(=O)c1C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:21| InChI=1S/C28H23F3N4O3/c1-16-22(24(37)35(33-16)19-11-9-17(15-32)10-12-19)27(28(29,30)31)23-20(13-26(2,3)14-21(23)36)34(25(27)38)18-7-5-4-6-8-18/h4-12,33H,13-14H2,1-3H3 WQJOSKIUUNBYRH-UHFFFAOYSA-N 50249843 3-[2-(4-cyanophenyl)-5-methyl-3-oxo-2,3-dihydro-1H-pyrazol-4-yl]-6,6-dimethyl-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL491949 Elongation of very long chain fatty acids protein 3 Homo sapiens 1100 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249843 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004294&target=Elongation+of+very+long+chain+fatty+acids+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249843&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+3&column=ki&startPg=0&Increment=50&submit=Search 44139564 104103977 CHEMBL491949 1 MVTAMNVSHEVNQLFQPYNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVFLLSKVIELGDTAFIILRKRPLIFIHWYHHSTVLVYTSFGYKNKVPAGGWFVTMNFGVHAIMYTYYTLKAANVKPPKMLPMLITSLQILQMFVGAIVSILTYIWRQDQGCHTTMEHLFWSFILYMTYFILFAHFFCQTYIRPKVKAKTKSQ Very long chain fatty acid elongase 3 ELOV3_HUMAN Q9HB03 Q5VZL3 Q8N180 50458472 CC(C)c1ccc(cc1)-n1[nH]c(C)c(c1=O)C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:22| InChI=1S/C30H30F3N3O3/c1-17(2)19-11-13-21(14-12-19)36-26(38)24(18(3)34-36)29(30(31,32)33)25-22(15-28(4,5)16-23(25)37)35(27(29)39)20-9-7-6-8-10-20/h6-14,17,34H,15-16H2,1-5H3 UWWUSSGYXCFNCE-UHFFFAOYSA-N 50249844 3-[2-(4-isopropylphenyl)-5-methyl-3-oxo-2,3-dihydro-1H-pyrazol-4-yl]-6,6-dimethyl-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL493642 Elongation of very long chain fatty acids protein 3 Homo sapiens 59 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249844 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004294&target=Elongation+of+very+long+chain+fatty+acids+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249844&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+3&column=ki&startPg=0&Increment=50&submit=Search 44139565 104103978 CHEMBL493642 1 MVTAMNVSHEVNQLFQPYNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVFLLSKVIELGDTAFIILRKRPLIFIHWYHHSTVLVYTSFGYKNKVPAGGWFVTMNFGVHAIMYTYYTLKAANVKPPKMLPMLITSLQILQMFVGAIVSILTYIWRQDQGCHTTMEHLFWSFILYMTYFILFAHFFCQTYIRPKVKAKTKSQ Very long chain fatty acid elongase 3 ELOV3_HUMAN Q9HB03 Q5VZL3 Q8N180 50458473 Cc1[nH]n(-c2ccc(C)cc2)c(=O)c1C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:20| InChI=1S/C28H26F3N3O3/c1-16-10-12-19(13-11-16)34-24(36)22(17(2)32-34)27(28(29,30)31)23-20(14-26(3,4)15-21(23)35)33(25(27)37)18-8-6-5-7-9-18/h5-13,32H,14-15H2,1-4H3 CNOFNQCCSDASTB-UHFFFAOYSA-N 50249891 3-[2-(4-methyllphenyl)-5-methyl-3-oxo-2,3-dihydro-1H-pyrazol-4-yl]-6,6-dimethyl-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL490110 Elongation of very long chain fatty acids protein 3 Homo sapiens 375 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249891 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004294&target=Elongation+of+very+long+chain+fatty+acids+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249891&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+3&column=ki&startPg=0&Increment=50&submit=Search 44139566 104104002 CHEMBL490110 1 MVTAMNVSHEVNQLFQPYNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVFLLSKVIELGDTAFIILRKRPLIFIHWYHHSTVLVYTSFGYKNKVPAGGWFVTMNFGVHAIMYTYYTLKAANVKPPKMLPMLITSLQILQMFVGAIVSILTYIWRQDQGCHTTMEHLFWSFILYMTYFILFAHFFCQTYIRPKVKAKTKSQ Very long chain fatty acid elongase 3 ELOV3_HUMAN Q9HB03 Q5VZL3 Q8N180 50458474 Cc1[nH]n(-c2ccc(OC(F)(F)F)cc2)c(=O)c1C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:24| InChI=1S/C28H23F6N3O4/c1-15-21(23(39)37(35-15)17-9-11-18(12-10-17)41-28(32,33)34)26(27(29,30)31)22-19(13-25(2,3)14-20(22)38)36(24(26)40)16-7-5-4-6-8-16/h4-12,35H,13-14H2,1-3H3 XLEVMSDNWOWFNX-UHFFFAOYSA-N 50249892 6,6-dimethyl-3-{5-methyl-3-oxo-2-[4-(trifluoromethoxy)phenyl]-2,3-dihydro-1H-pyrazol-4-yl}-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL449121 Elongation of very long chain fatty acids protein 3 Homo sapiens 337 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249892 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004294&target=Elongation+of+very+long+chain+fatty+acids+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249892&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+3&column=ki&startPg=0&Increment=50&submit=Search 44139567 104104003 CHEMBL449121 1 MVTAMNVSHEVNQLFQPYNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVFLLSKVIELGDTAFIILRKRPLIFIHWYHHSTVLVYTSFGYKNKVPAGGWFVTMNFGVHAIMYTYYTLKAANVKPPKMLPMLITSLQILQMFVGAIVSILTYIWRQDQGCHTTMEHLFWSFILYMTYFILFAHFFCQTYIRPKVKAKTKSQ Very long chain fatty acid elongase 3 ELOV3_HUMAN Q9HB03 Q5VZL3 Q8N180 50458475 Cc1[nH]n(-c2ccc(OC(F)(F)F)cc2)c(=O)c1C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:24| InChI=1S/C28H23F6N3O4/c1-15-21(23(39)37(35-15)17-9-11-18(12-10-17)41-28(32,33)34)26(27(29,30)31)22-19(13-25(2,3)14-20(22)38)36(24(26)40)16-7-5-4-6-8-16/h4-12,35H,13-14H2,1-3H3 XLEVMSDNWOWFNX-UHFFFAOYSA-N 50249892 6,6-dimethyl-3-{5-methyl-3-oxo-2-[4-(trifluoromethoxy)phenyl]-2,3-dihydro-1H-pyrazol-4-yl}-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL449121 Elongation of very long chain fatty acids protein 1 Homo sapiens >10000 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249892 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004146&target=Elongation+of+very+long+chain+fatty+acids+protein+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249892&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+1&column=ki&startPg=0&Increment=50&submit=Search 44139567 104104003 CHEMBL449121 1 MEAVVNLYQEVMKHADPRIQGYPLMGSPLLMTSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYNFSLVALSLYIVYEFLMSGWLSTYTWRCDPVDYSNSPEALRMVRVAWLFLFSKFIELMDTVIFILRKKDGQVTFLHVFHHSVLPWSWWWGVKIAPGGMGSFHAMINSSVHVIMYLYYGLSAFGPVAQPYLWWKKHMTAIQLIQFVLVSLHISQYYFMSSCNYQYPVIIHLIWMYGTIFFMLFSNFWYHSYTKGKRLPRALQQNGAPGIAKVKAN Very long chain fatty acid elongase 1 ELOV1_HUMAN Q9BW60 B4DP24 Q53HT2 Q5JUY3 Q8WXU3 Q9NVD9 Q9Y396 50458476 Cc1[nH]n(-c2ccc(OC(F)(F)F)cc2)c(=O)c1C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:24| InChI=1S/C28H23F6N3O4/c1-15-21(23(39)37(35-15)17-9-11-18(12-10-17)41-28(32,33)34)26(27(29,30)31)22-19(13-25(2,3)14-20(22)38)36(24(26)40)16-7-5-4-6-8-16/h4-12,35H,13-14H2,1-3H3 XLEVMSDNWOWFNX-UHFFFAOYSA-N 50249892 6,6-dimethyl-3-{5-methyl-3-oxo-2-[4-(trifluoromethoxy)phenyl]-2,3-dihydro-1H-pyrazol-4-yl}-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL449121 Elongation of very long chain fatty acids protein 2 Homo sapiens >10000 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249892 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004345&target=Elongation+of+very+long+chain+fatty+acids+protein+2&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249892&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+2&column=ki&startPg=0&Increment=50&submit=Search 44139567 104104003 CHEMBL449121 1 MEHLKAFDDEINAFLDNMFGPRDSRVRGWFMLDSYLPTFFLTVMYLLSIWLGNKYMKNRPALSLRGILTLYNLGITLLSAYMLAELILSTWEGGYNLQCQDLTSAGEADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTSQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVFPSMHKYLWWKKYLTQAQLVQFVLTITHTMSAVVKPCGFPFGCLIFQSSYMLTLVILFLNFYVQTYRKKPMKKDMQEPPAGKEVKNGFSKAYFTAANGVMNKKAQ Very long chain fatty acid elongase 2 ELOV2_HUMAN Q9NXB9 Q6P9E1 Q86W94 50458477 Cc1[nH]n(-c2ccc(OC(F)(F)F)cc2)c(=O)c1C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:24| InChI=1S/C28H23F6N3O4/c1-15-21(23(39)37(35-15)17-9-11-18(12-10-17)41-28(32,33)34)26(27(29,30)31)22-19(13-25(2,3)14-20(22)38)36(24(26)40)16-7-5-4-6-8-16/h4-12,35H,13-14H2,1-3H3 XLEVMSDNWOWFNX-UHFFFAOYSA-N 50249892 6,6-dimethyl-3-{5-methyl-3-oxo-2-[4-(trifluoromethoxy)phenyl]-2,3-dihydro-1H-pyrazol-4-yl}-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL449121 Elongation of very long chain fatty acids protein 5 Homo sapiens >10000 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249892 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004348&target=Elongation+of+very+long+chain+fatty+acids+protein+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249892&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+5&column=ki&startPg=0&Increment=50&submit=Search 44139567 104104003 CHEMBL449121 1 MEHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPKYMRNKQPFSCRGILVVYNLGLTLLSLYMFCELVTGVWEGKYNFFCQGTRTAGESDMKIIRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYHHASMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSSVPSMRPYLWWKKYITQGQLLQFVLTIIQTSCGVIWPCTFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD Very long chain fatty acid elongase 5 ELOV5_HUMAN Q9NYP7 B4DZJ2 F6SH78 Q59EL3 Q5TGH5 Q6NXE7 Q7L2S5 Q8NCG4 Q9UI22 50458478 Cc1[nH]n(-c2ccc(OC(F)(F)F)cc2)c(=O)c1C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:24| InChI=1S/C28H23F6N3O4/c1-15-21(23(39)37(35-15)17-9-11-18(12-10-17)41-28(32,33)34)26(27(29,30)31)22-19(13-25(2,3)14-20(22)38)36(24(26)40)16-7-5-4-6-8-16/h4-12,35H,13-14H2,1-3H3 XLEVMSDNWOWFNX-UHFFFAOYSA-N 50249892 6,6-dimethyl-3-{5-methyl-3-oxo-2-[4-(trifluoromethoxy)phenyl]-2,3-dihydro-1H-pyrazol-4-yl}-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL449121 Elongation of very long chain fatty acids protein 6 Mus musculus 31 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249892 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004047&target=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249892&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+6&column=ki&startPg=0&Increment=50&submit=Search 44139567 104104003 CHEMBL449121 1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKVKKATKAE Very long chain fatty acid elongase 6 ELOV6_MOUSE Q920L5 Q8CE45 50458479 Cc1[nH]n(-c2ccc(OC(F)(F)F)cc2)c(=O)c1C1(C(=O)N(C2=C1C(=O)CC(C)(C)C2)c1ccccc1)C(F)(F)F |c:24| InChI=1S/C28H23F6N3O4/c1-15-21(23(39)37(35-15)17-9-11-18(12-10-17)41-28(32,33)34)26(27(29,30)31)22-19(13-25(2,3)14-20(22)38)36(24(26)40)16-7-5-4-6-8-16/h4-12,35H,13-14H2,1-3H3 XLEVMSDNWOWFNX-UHFFFAOYSA-N 50249892 6,6-dimethyl-3-{5-methyl-3-oxo-2-[4-(trifluoromethoxy)phenyl]-2,3-dihydro-1H-pyrazol-4-yl}-1-phenyl-3-(trifluoromethyl)-3,5,6,7-tetrahydro-1H-indole-2,4-dione::CHEMBL449121 Elongation of very long chain fatty acids protein 3 Mus musculus 194 ChEMBL 10.1021/jm900391x 10.7270/Q20P0ZX6 19388647 Takahashi, T; Nagase, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N 5/22/2009 1/11/2010 Tsukuba Research Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50249892 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004063&target=Elongation+of+very+long+chain+fatty+acids+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50249892&enzyme=Elongation+of+very+long+chain+fatty+acids+protein+3&column=ki&startPg=0&Increment=50&submit=Search 44139567 104104003 CHEMBL449121 1 MDTSMNFSRGLKMDLMQPYDFETFQDLRPFLEEYWVSSFLIVVVYLLLIVVGQTYMRTRKSFSLQRPLILWSFFLAIFSILGTLRMWKFMATVMFTVGLKQTVCFAIYTDDAVVRFWSFLFLLSKVVELGDTAFIILRKRPLIFVHWYHHSTVLLFTSFGYKNKVPSGGWFMTMNFGVHSVMYTYYTMKAAKLKHPNLLPMVITSLQILQMVLGTIFGILNYIWRQEKGCHTTTEHFFWSFMLYGTYFILFAHFFHRAYLRPKGKVASKSQ Very long chain fatty acid elongase 3 ELOV3_MOUSE O35949